BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018M04

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009768928.1|  PREDICTED: triosephosphate isomerase, chloro...    203   6e-61   Nicotiana sylvestris
ref|XP_009590743.1|  PREDICTED: triosephosphate isomerase, chloro...    203   7e-61   Nicotiana tomentosiformis
ref|XP_004230885.1|  PREDICTED: triosephosphate isomerase, chloro...    201   4e-60   Solanum lycopersicum
ref|XP_009788094.1|  PREDICTED: triosephosphate isomerase, chloro...    199   2e-59   Nicotiana sylvestris
ref|XP_006359648.1|  PREDICTED: triosephosphate isomerase, chloro...    198   6e-59   Solanum tuberosum [potatoes]
ref|XP_009610674.1|  PREDICTED: triosephosphate isomerase, chloro...    197   7e-59   Nicotiana tomentosiformis
ref|XP_007041930.1|  Triosephosphate isomerase isoform 2                192   4e-57   Theobroma cacao [chocolate]
ref|XP_011088504.1|  PREDICTED: triosephosphate isomerase, chloro...    192   7e-57   Sesamum indicum [beniseed]
ref|XP_006367334.1|  PREDICTED: triosephosphate isomerase, chloro...    192   1e-56   Solanum tuberosum [potatoes]
ref|XP_010690445.1|  PREDICTED: triosephosphate isomerase, chloro...    191   2e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB15724.1|  hypothetical protein B456_002G192900                    188   2e-56   Gossypium raimondii
gb|EYU37874.1|  hypothetical protein MIMGU_mgv1a008655mg                192   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_010268686.1|  PREDICTED: triosephosphate isomerase, chloro...    191   3e-56   Nelumbo nucifera [Indian lotus]
emb|CDO96949.1|  unnamed protein product                                187   6e-56   Coffea canephora [robusta coffee]
ref|XP_010268160.1|  PREDICTED: triosephosphate isomerase, chloro...    189   8e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010268151.1|  PREDICTED: triosephosphate isomerase, chloro...    189   1e-55   Nelumbo nucifera [Indian lotus]
gb|KJB77731.1|  hypothetical protein B456_012G153600                    189   1e-55   Gossypium raimondii
gb|KJB15722.1|  hypothetical protein B456_002G192900                    187   3e-55   Gossypium raimondii
gb|ADG27841.1|  triosephosphate isomerase                               187   5e-55   Gossypium hirsutum [American cotton]
ref|XP_010090286.1|  Triosephosphate isomerase                          186   3e-54   Morus notabilis
ref|XP_011092863.1|  PREDICTED: triosephosphate isomerase, chloro...    185   4e-54   Sesamum indicum [beniseed]
ref|XP_002274871.1|  PREDICTED: triosephosphate isomerase, chloro...    182   5e-53   Vitis vinifera
ref|XP_003542557.1|  PREDICTED: triosephosphate isomerase, chloro...    182   6e-53   Glycine max [soybeans]
ref|XP_010028689.1|  PREDICTED: triosephosphate isomerase, chloro...    181   9e-53   Eucalyptus grandis [rose gum]
ref|XP_009117434.1|  PREDICTED: triosephosphate isomerase, chloro...    181   1e-52   Brassica rapa
ref|XP_004248665.1|  PREDICTED: triosephosphate isomerase, chloro...    181   1e-52   Solanum lycopersicum
emb|CDY13836.1|  BnaA09g43380D                                          181   1e-52   Brassica napus [oilseed rape]
ref|XP_004147017.1|  PREDICTED: triosephosphate isomerase, chloro...    181   2e-52   Cucumis sativus [cucumbers]
ref|XP_002529248.1|  triosephosphate isomerase, putative                181   2e-52   Ricinus communis
emb|CDX99612.1|  BnaC04g33690D                                          180   2e-52   
gb|KHN48239.1|  Triosephosphate isomerase, chloroplastic                180   3e-52   Glycine soja [wild soybean]
ref|XP_008457647.1|  PREDICTED: triosephosphate isomerase, chloro...    180   3e-52   Cucumis melo [Oriental melon]
ref|XP_004494086.1|  PREDICTED: triosephosphate isomerase, chloro...    180   4e-52   Cicer arietinum [garbanzo]
gb|ABK24413.1|  unknown                                                 180   4e-52   Picea sitchensis
gb|ABR16682.1|  unknown                                                 180   4e-52   Picea sitchensis
gb|KDP27586.1|  hypothetical protein JCGZ_19591                         180   5e-52   Jatropha curcas
ref|XP_009140258.1|  PREDICTED: triosephosphate isomerase, chloro...    179   6e-52   Brassica rapa
gb|EPS59362.1|  triosephosphate isomerase                               179   6e-52   Genlisea aurea
ref|XP_009418696.1|  PREDICTED: triosephosphate isomerase, chloro...    179   6e-52   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY15911.1|  BnaA04g12000D                                          179   7e-52   Brassica napus [oilseed rape]
ref|XP_003554399.1|  PREDICTED: triosephosphate isomerase, chloro...    179   9e-52   Glycine max [soybeans]
emb|CDX82002.1|  BnaC08g35990D                                          179   9e-52   
ref|NP_001240895.1|  uncharacterized protein LOC100799358               179   1e-51   Glycine max [soybeans]
ref|XP_004289838.1|  PREDICTED: triosephosphate isomerase, chloro...    179   1e-51   Fragaria vesca subsp. vesca
ref|XP_011037267.1|  PREDICTED: triosephosphate isomerase, chloro...    179   1e-51   Populus euphratica
ref|XP_007162792.1|  hypothetical protein PHAVU_001G181000g             178   2e-51   Phaseolus vulgaris [French bean]
gb|KHN18687.1|  Triosephosphate isomerase, chloroplastic                177   3e-51   Glycine soja [wild soybean]
gb|ACU23262.1|  unknown                                                 177   4e-51   Glycine max [soybeans]
gb|KFK41726.1|  hypothetical protein AALP_AA2G164900                    177   5e-51   Arabis alpina [alpine rockcress]
ref|XP_009392888.1|  PREDICTED: triosephosphate isomerase, chloro...    177   6e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB15723.1|  hypothetical protein B456_002G192900                    176   1e-50   Gossypium raimondii
ref|XP_002306169.2|  hypothetical protein POPTR_0004s17530g             176   1e-50   Populus trichocarpa [western balsam poplar]
sp|P48496.1|TPIC_SPIOL  RecName: Full=Triosephosphate isomerase, ...    176   1e-50   Spinacia oleracea
gb|AFK41708.1|  unknown                                                 175   3e-50   Medicago truncatula
gb|KEH24057.1|  triosephosphate isomerase                               175   3e-50   Medicago truncatula
ref|XP_004957468.1|  PREDICTED: triosephosphate isomerase, chloro...    174   5e-50   Setaria italica
ref|NP_001063777.1|  Os09g0535000                                       174   6e-50   
gb|EAZ09878.1|  hypothetical protein OsI_32171                          174   6e-50   Oryza sativa Indica Group [Indian rice]
gb|KHN39016.1|  Triosephosphate isomerase, chloroplastic                173   1e-49   Glycine soja [wild soybean]
ref|NP_001241611.1|  uncharacterized protein LOC100798459               173   1e-49   Glycine max [soybeans]
gb|ACF79785.1|  unknown                                                 172   1e-49   Zea mays [maize]
ref|NP_001152578.1|  triosephosphate isomerase                          173   1e-49   
ref|XP_006661479.1|  PREDICTED: triosephosphate isomerase, chloro...    172   1e-49   
gb|AFK45656.1|  unknown                                                 173   1e-49   Lotus japonicus
ref|XP_002312980.1|  triosephosphate isomerase family protein           173   2e-49   Populus trichocarpa [western balsam poplar]
gb|ACF85433.1|  unknown                                                 172   2e-49   Zea mays [maize]
ref|NP_001130128.1|  uncharacterized protein LOC100191222               172   2e-49   
ref|XP_011046787.1|  PREDICTED: triosephosphate isomerase, chloro...    173   2e-49   Populus euphratica
ref|XP_006423593.1|  hypothetical protein CICLE_v10028924mg             172   3e-49   Citrus clementina [clementine]
ref|XP_008236196.1|  PREDICTED: triosephosphate isomerase, chloro...    172   5e-49   Prunus mume [ume]
sp|Q9M4S8.1|TPIC_FRAAN  RecName: Full=Triosephosphate isomerase, ...    172   6e-49   Fragaria x ananassa
ref|XP_003578514.1|  PREDICTED: triosephosphate isomerase, chloro...    171   6e-49   Brachypodium distachyon [annual false brome]
ref|XP_007201375.1|  hypothetical protein PRUPE_ppa007813mg             172   8e-49   
dbj|BAJ98333.1|  predicted protein                                      171   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001131642.1|  uncharacterized protein LOC100193000               170   1e-48   
tpg|DAA40632.1|  TPA: triosephosphate isomerase                         170   1e-48   
ref|XP_009346630.1|  PREDICTED: triosephosphate isomerase, chloro...    171   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_009369018.1|  PREDICTED: triosephosphate isomerase, chloro...    171   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_010416860.1|  PREDICTED: triosephosphate isomerase, chloro...    170   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002462733.1|  hypothetical protein SORBIDRAFT_02g031030          169   5e-48   Sorghum bicolor [broomcorn]
ref|XP_008799414.1|  PREDICTED: triosephosphate isomerase, chloro...    169   7e-48   Phoenix dactylifera
ref|XP_006404556.1|  hypothetical protein EUTSA_v10000249mg             169   7e-48   Eutrema salsugineum [saltwater cress]
ref|XP_006294633.1|  hypothetical protein CARUB_v10023671mg             169   8e-48   Capsella rubella
ref|XP_010555242.1|  PREDICTED: triosephosphate isomerase, chloro...    169   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010526563.1|  PREDICTED: triosephosphate isomerase, chloro...    167   2e-47   Tarenaya hassleriana [spider flower]
emb|CBI37923.3|  unnamed protein product                                166   2e-47   Vitis vinifera
ref|XP_010941282.1|  PREDICTED: triosephosphate isomerase, chloro...    167   2e-47   Elaeis guineensis
ref|XP_010429012.1|  PREDICTED: triosephosphate isomerase, chloro...    167   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008788636.1|  PREDICTED: triosephosphate isomerase, chloro...    166   5e-47   Phoenix dactylifera
ref|XP_010935053.1|  PREDICTED: triosephosphate isomerase, chloro...    166   5e-47   Elaeis guineensis
sp|P46225.1|TPIC_SECCE  RecName: Full=Triosephosphate isomerase, ...    166   8e-47   Secale cereale
ref|XP_002880361.1|  hypothetical protein ARALYDRAFT_900526             166   9e-47   Arabidopsis lyrata subsp. lyrata
ref|NP_179713.1|  triosephosphate isomerase                             166   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337933.1|  PREDICTED: triosephosphate isomerase, chloro...    166   1e-46   Pyrus x bretschneideri [bai li]
gb|EMT18057.1|  Triosephosphate isomerase, chloroplastic                162   8e-46   
pdb|4OHQ|A  Chain A, Crystal Structure Of Chloroplast Triose Phos...    160   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041929.1|  Triosephosphate isomerase isoform 1                163   5e-45   
ref|XP_002986327.1|  hypothetical protein SELMODRAFT_157971             159   7e-45   
ref|XP_001763435.1|  predicted protein                                  159   1e-44   
gb|KHG23864.1|  Triosephosphate isomerase, chloroplastic                159   2e-44   Gossypium arboreum [tree cotton]
gb|KDO44199.1|  hypothetical protein CISIN_1g024925mg                   158   2e-44   Citrus sinensis [apfelsine]
ref|XP_006487404.1|  PREDICTED: triosephosphate isomerase, chloro...    158   6e-44   Citrus sinensis [apfelsine]
ref|XP_001782032.1|  predicted protein                                  154   2e-42   
gb|EMS46255.1|  Triosephosphate isomerase, chloroplastic                149   1e-40   Triticum urartu
ref|XP_001759539.1|  predicted protein                                  145   3e-39   
ref|XP_001768780.1|  predicted protein                                  144   4e-39   
ref|XP_006404555.1|  hypothetical protein EUTSA_v10000249mg             144   2e-38   
ref|XP_010472095.1|  PREDICTED: triosephosphate isomerase, chloro...    142   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002988724.1|  hypothetical protein SELMODRAFT_447410             140   2e-37   
ref|XP_001751243.1|  predicted protein                                  137   3e-36   
ref|XP_006423592.1|  hypothetical protein CICLE_v10028924mg             135   1e-35   
ref|NP_001077931.1|  triosephosphate isomerase                          136   2e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE48229.1|  triosephosphate isomerase chloroplast type             122   2e-30   Auxenochlorella pyrenoidosa
ref|XP_003056637.1|  triosephosphate isomerase                          122   3e-30   Micromonas pusilla CCMP1545
ref|XP_005650184.1|  Triosephosphate isomerase                          121   4e-30   Coccomyxa subellipsoidea C-169
gb|AAV65344.1|  triosephosphate isomerase plastid isozyme               118   1e-29   Prototheca wickerhamii
ref|XP_001422959.1|  predicted protein                                  119   2e-29   Ostreococcus lucimarinus CCE9901
ref|XP_001419463.1|  predicted protein                                  119   2e-29   Ostreococcus lucimarinus CCE9901
gb|AAU93945.1|  triose phosphate isomerase                              117   7e-29   Helicosporidium sp. ex Simulium jonesi
ref|XP_002506262.1|  triosephosphate isomerase                          119   9e-29   Micromonas commoda
ref|XP_007510733.1|  triosephosphate isomerase                          117   2e-28   Bathycoccus prasinos
gb|KIZ03638.1|  triosephosphate isomerase (TIM)                         116   4e-28   Monoraphidium neglectum
gb|KIZ02768.1|  triosephosphate isomerase (TIM)                         115   4e-28   Monoraphidium neglectum
pdb|4MKN|A  Chain A, Crystal Structure Of Chloroplastic Triosepho...    114   2e-27   Chlamydomonas reinhardtii
ref|XP_001690035.1|  triose phosphate isomerase                         114   2e-27   Chlamydomonas reinhardtii
ref|XP_005846199.1|  triosephosphate isomerase chloroplast type         113   5e-27   Chlorella variabilis
gb|KDO44198.1|  hypothetical protein CISIN_1g024925mg                   112   7e-27   Citrus sinensis [apfelsine]
gb|ABE11555.1|  cytosolic triosephosphate isomerase                     112   7e-27   Euglena deses var. intermedia
ref|XP_002955427.1|  hypothetical protein VOLCADRAFT_109969             113   8e-27   Volvox carteri f. nagariensis
emb|CEF98905.1|  Triosephosphate isomerase                              112   1e-26   Ostreococcus tauri
ref|XP_003080998.1|  triose-phosphate isomerase (ISS)                   112   3e-26   
gb|ABH10995.1|  plastid triose phosphate isomerase                      107   2e-25   Polytomella parva
gb|EYU38446.1|  hypothetical protein MIMGU_mgv1a012264mg                106   1e-24   Erythranthe guttata [common monkey flower]
gb|AAR04016.1|  cytosolic triosephosphate isomerase                     105   2e-24   Euglena gracilis
ref|XP_010685754.1|  PREDICTED: triosephosphate isomerase, cytoso...    105   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004144643.1|  PREDICTED: triosephosphate isomerase, cytoso...    105   3e-24   Cucumis sativus [cucumbers]
ref|XP_004144642.1|  PREDICTED: triosephosphate isomerase, cytoso...    105   4e-24   
ref|XP_004170197.1|  PREDICTED: triosephosphate isomerase, cytoso...    105   4e-24   
ref|XP_008442057.1|  PREDICTED: triosephosphate isomerase, cytosolic    105   4e-24   Cucumis melo [Oriental melon]
ref|XP_001422591.1|  predicted protein                                  105   5e-24   Ostreococcus lucimarinus CCE9901
emb|CDP09059.1|  unnamed protein product                                104   1e-23   Coffea canephora [robusta coffee]
gb|AIN39806.1|  hypothetical protein                                    103   1e-23   Zoysia matrella [Japanese carpet grass]
gb|ACU17423.1|  unknown                                                 100   4e-23   Glycine max [soybeans]
gb|KCW50197.1|  hypothetical protein EUGRSUZ_J00008                     102   5e-23   Eucalyptus grandis [rose gum]
ref|XP_011400938.1|  Triosephosphate isomerase, chloroplastic           107   5e-23   Auxenochlorella protothecoides
ref|XP_009587903.1|  PREDICTED: triosephosphate isomerase, cytoso...    102   5e-23   Nicotiana tomentosiformis
ref|XP_009793253.1|  PREDICTED: triosephosphate isomerase, cytoso...    102   5e-23   Nicotiana sylvestris
gb|KCW50198.1|  hypothetical protein EUGRSUZ_J00008                     101   6e-23   Eucalyptus grandis [rose gum]
ref|XP_010030961.1|  PREDICTED: triosephosphate isomerase, cytosolic    102   6e-23   Eucalyptus grandis [rose gum]
tpg|DAA53469.1|  TPA: triosephosphate isomerase, cytosolic              102   9e-23   
ref|XP_007150325.1|  hypothetical protein PHAVU_005G144100g             101   1e-22   Phaseolus vulgaris [French bean]
gb|AHA84226.1|  triose-phosphate isomerase                              101   1e-22   Phaseolus vulgaris [French bean]
emb|CAI43251.1|  triose-phosphate isomerase                             101   1e-22   Phaseolus vulgaris var. nanus
ref|NP_001132639.1|  uncharacterized protein LOC100194114               101   1e-22   Zea mays [maize]
gb|ACG24648.1|  triosephosphate isomerase, cytosolic                    101   1e-22   Zea mays [maize]
ref|XP_010651015.1|  PREDICTED: triosephosphate isomerase, cytoso...    100   1e-22   Vitis vinifera
ref|NP_001140424.1|  triosephosphate isomerase, cytosolic               101   1e-22   Zea mays [maize]
ref|XP_002531441.1|  triosephosphate isomerase, putative              97.8    1e-22   
ref|XP_008810613.1|  PREDICTED: triosephosphate isomerase, cytosolic    100   2e-22   Phoenix dactylifera
ref|XP_003547334.1|  PREDICTED: triosephosphate isomerase, cytosolic    100   2e-22   
emb|CAN67342.1|  hypothetical protein VITISV_033715                     100   2e-22   Vitis vinifera
gb|ABB02628.1|  triose phosphate isomerase cytosolic isoform-like       100   2e-22   Solanum tuberosum [potatoes]
ref|XP_008784587.1|  PREDICTED: triosephosphate isomerase, cytoso...    100   2e-22   Phoenix dactylifera
gb|KHG17172.1|  Triosephosphate isomerase, cytosolic                    100   2e-22   Gossypium arboreum [tree cotton]
ref|XP_002283671.1|  PREDICTED: triosephosphate isomerase, cytoso...    100   2e-22   Vitis vinifera
gb|EMS61639.1|  Triosephosphate isomerase, cytosolic                  98.6    2e-22   Triticum urartu
gb|ABA86966.1|  triosephosphate isomerase                               100   3e-22   Glycine max [soybeans]
ref|NP_001237472.1|  triosephosphate isomerase                          100   3e-22   Glycine max [soybeans]
ref|XP_006593480.1|  PREDICTED: triosephosphate isomerase isoform X1    100   3e-22   
ref|XP_002283693.1|  PREDICTED: triosephosphate isomerase, cytosolic    100   3e-22   Vitis vinifera
emb|CAN70587.1|  hypothetical protein VITISV_041523                     100   3e-22   Vitis vinifera
sp|P46226.3|TPIS_SECCE  RecName: Full=Triosephosphate isomerase, ...    100   3e-22   Secale cereale
ref|XP_006644990.1|  PREDICTED: triosephosphate isomerase, cytoso...  99.8    4e-22   Oryza brachyantha
ref|XP_006365701.1|  PREDICTED: triosephosphate isomerase, cytoso...  99.8    4e-22   
gb|AAR11379.1|  triose phosphate isomerase cytosolic isoform          99.8    4e-22   Solanum chacoense
gb|AFL48185.1|  triose phosphate isomerase cytosolic isoform-like...  99.8    4e-22   Capsicum annuum
gb|KJB20069.1|  hypothetical protein B456_003G131500                  99.8    5e-22   Gossypium raimondii
ref|XP_006846201.1|  hypothetical protein AMTR_s00012p00219470        99.4    5e-22   Amborella trichopoda
ref|XP_006643754.1|  PREDICTED: triosephosphate isomerase, cytoso...  99.4    5e-22   Oryza brachyantha
emb|CAC14917.1|  triosephosphat-isomerase                             99.4    5e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009174523.1|  hypothetical protein T265_10014                  99.0    6e-22   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_009353661.1|  PREDICTED: triosephosphate isomerase, cytosolic  99.4    6e-22   Pyrus x bretschneideri [bai li]
gb|ACN33440.1|  unknown                                               99.4    7e-22   Zea mays [maize]
ref|XP_003568647.1|  PREDICTED: triosephosphate isomerase, cytosolic  99.0    7e-22   Brachypodium distachyon [annual false brome]
ref|XP_002455200.1|  hypothetical protein SORBIDRAFT_03g006130        99.0    7e-22   Sorghum bicolor [broomcorn]
gb|KDD74205.1|  triosephosphate isomerase                             99.4    8e-22   Helicosporidium sp. ATCC 50920
emb|CDM81250.1|  unnamed protein product                              99.0    8e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009587902.1|  PREDICTED: triosephosphate isomerase, cytoso...  99.0    8e-22   Nicotiana tomentosiformis
gb|KHG21991.1|  Triosephosphate isomerase, cytosolic                  99.0    8e-22   Gossypium arboreum [tree cotton]
gb|ACU23435.1|  unknown                                               99.0    9e-22   Glycine max [soybeans]
gb|AAV65491.1|  cytosolic triosephosphate isomerase                   98.6    1e-21   Euglena longa
gb|KJB73932.1|  hypothetical protein B456_011G261700                  98.6    1e-21   Gossypium raimondii
sp|P48497.1|TPIS_STELP  RecName: Full=Triosephosphate isomerase, ...  98.6    1e-21   Stellaria longipes
ref|XP_010535492.1|  PREDICTED: triosephosphate isomerase, cytoso...  98.6    1e-21   Tarenaya hassleriana [spider flower]
gb|ACJ11723.1|  triosephosphate isomerase                             98.6    1e-21   Gossypium hirsutum [American cotton]
ref|NP_001275435.1|  triosphosphate isomerase-like protein            98.6    1e-21   Solanum tuberosum [potatoes]
ref|XP_009622343.1|  PREDICTED: triosephosphate isomerase, cytosolic  98.2    1e-21   Nicotiana tomentosiformis
ref|XP_010256927.1|  PREDICTED: triosephosphate isomerase, cytosolic  98.2    1e-21   Nelumbo nucifera [Indian lotus]
dbj|GAA50994.1|  triosephosphate isomerase (TIM)                      98.2    1e-21   Clonorchis sinensis [oriental liver fluke]
ref|XP_004240361.1|  PREDICTED: triosephosphate isomerase, cytosolic  98.2    1e-21   Solanum lycopersicum
gb|KDP44954.1|  hypothetical protein JCGZ_01454                       98.2    1e-21   Jatropha curcas
ref|XP_002533147.1|  triosephosphate isomerase, putative              98.2    1e-21   Ricinus communis
gb|AFK44027.1|  unknown                                               98.2    1e-21   Lotus japonicus
ref|XP_010554607.1|  PREDICTED: triosephosphate isomerase, cytoso...  98.2    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_008223629.1|  PREDICTED: triosephosphate isomerase, cytosolic  98.2    2e-21   Prunus mume [ume]
ref|XP_007205760.1|  hypothetical protein PRUPE_ppa010312mg           97.8    2e-21   Prunus persica
ref|XP_010920579.1|  PREDICTED: triosephosphate isomerase, cytoso...  97.8    2e-21   Elaeis guineensis
gb|ABU96664.1|  mitochondrial triosephosphate isomerase/glycerald...    100   2e-21   Dictyota dichotoma
ref|XP_011077218.1|  PREDICTED: triosephosphate isomerase, cytosolic  97.8    2e-21   Sesamum indicum [beniseed]
gb|AEK69741.1|  (S)-tetrahydroprotoberberine oxidase                  97.4    2e-21   Corydalis saxicola
emb|CCJ30729.1|  unnamed protein product                              97.4    2e-21   Pneumocystis jirovecii
dbj|GAA50993.1|  triosephosphate isomerase (TIM)                      97.4    2e-21   Clonorchis sinensis [oriental liver fluke]
ref|XP_010516113.1|  PREDICTED: triosephosphate isomerase, cytoso...  97.8    2e-21   Camelina sativa [gold-of-pleasure]
emb|CDY02937.1|  BnaC04g25490D                                        97.8    2e-21   
sp|P48495.1|TPIS_PETHY  RecName: Full=Triosephosphate isomerase, ...  97.8    2e-21   Petunia x hybrida [garden petunia]
ref|XP_004307511.1|  PREDICTED: triosephosphate isomerase, cytosolic  97.8    2e-21   Fragaria vesca subsp. vesca
gb|KFH49076.1|  Triosephosphate isomerase-like protein                97.4    3e-21   Acremonium chrysogenum ATCC 11550
ref|XP_009793252.1|  PREDICTED: triosephosphate isomerase, cytoso...  97.4    3e-21   Nicotiana sylvestris
ref|XP_006403458.1|  hypothetical protein EUTSA_v10010654mg           97.4    3e-21   Eutrema salsugineum [saltwater cress]
gb|ELT97198.1|  hypothetical protein CAPTEDRAFT_172464                97.4    3e-21   Capitella teleta
ref|XP_004487007.1|  PREDICTED: triosephosphate isomerase, cytoso...  97.4    3e-21   Cicer arietinum [garbanzo]
gb|EMS58952.1|  Elicitor-responsive protein 1                         97.4    3e-21   Triticum urartu
ref|XP_002117956.1|  hypothetical protein TRIADDRAFT_38509            97.1    3e-21   Trichoplax adhaerens
ref|XP_007009326.1|  Triosephosphate isomerase isoform 2              97.1    4e-21   
ref|XP_007537109.1|  PREDICTED: triosephosphate isomerase isoform X1  97.4    5e-21   Erinaceus europaeus [common hedgehog]
ref|XP_002508897.1|  triosephosphate isomerase                        97.4    5e-21   Micromonas commoda
ref|XP_009774716.1|  PREDICTED: triosephosphate isomerase, cytoso...  96.7    5e-21   Nicotiana sylvestris
ref|XP_007009325.1|  Triosephosphate isomerase isoform 1              97.1    6e-21   
ref|XP_009174526.1|  hypothetical protein T265_10017                  96.3    6e-21   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_004438751.1|  PREDICTED: triosephosphate isomerase             96.7    7e-21   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004766701.1|  PREDICTED: triosephosphate isomerase             96.7    7e-21   Mustela putorius furo [black ferret]
ref|XP_007644948.1|  PREDICTED: triosephosphate isomerase isoform X1  97.1    7e-21   
ref|XP_007633208.1|  PREDICTED: triosephosphate isomerase isoform X2  96.7    7e-21   
ref|XP_008565897.1|  PREDICTED: triosephosphate isomerase             96.7    8e-21   Galeopterus variegatus [Malayan flying lemur]
gb|AAB63603.1|  triosephosphate isomerase                             96.3    8e-21   Oryza sativa [red rice]
gb|KHJ77640.1|  triose-phosphate isomerase                            94.4    8e-21   Oesophagostomum dentatum [nodule worm]
ref|XP_010531561.1|  PREDICTED: triosephosphate isomerase, cytosolic  96.3    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_003796519.1|  PREDICTED: triosephosphate isomerase             96.3    9e-21   
ref|XP_002906178.1|  triosephosphate isomerase                        95.9    9e-21   Phytophthora infestans T30-4
gb|EPQ63062.1|  Triose phosphate isomerase abundant glycolytic en...  95.9    9e-21   Blumeria graminis f. sp. tritici 96224
ref|XP_007170196.1|  PREDICTED: triosephosphate isomerase             96.3    9e-21   Balaenoptera acutorostrata scammoni
gb|ADM86861.1|  triosephosphate isomerase                             95.9    9e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CCU82480.1|  triosephosphate isomerase/triosephosphate isomer...  95.9    1e-20   Blumeria graminis f. sp. hordei DH14
gb|AAK27513.1|AF344331_1  triosephosphate isomerase                   94.4    1e-20   Oesophagostomum dentatum [nodule worm]
emb|CDX76095.1|  BnaA04g03590D                                        95.9    1e-20   
ref|NP_001042016.1|  Os01g0147900                                     95.9    1e-20   
ref|NP_191104.1|  triosephosphate isomerase                           95.9    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAA03449.1|  cytosolic triose phosphate isomerase                  95.9    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427315.1|  PREDICTED: triosephosphate isomerase, cytosolic  95.9    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008233628.1|  PREDICTED: triosephosphate isomerase, cytosolic  95.9    1e-20   Prunus mume [ume]
ref|XP_002876302.1|  predicted protein                                95.9    1e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010937618.1|  PREDICTED: triosephosphate isomerase, cytoso...  95.9    1e-20   Elaeis guineensis
gb|EDM01926.1|  rCG29914, isoform CRA_d                               94.7    1e-20   Rattus norvegicus [brown rat]
ref|XP_002299871.1|  hypothetical protein POPTR_0001s24710g           95.5    1e-20   Populus trichocarpa [western balsam poplar]
gb|EYU19908.1|  hypothetical protein MIMGU_mgv1a012309mg              95.5    1e-20   Erythranthe guttata [common monkey flower]
gb|KFK34792.1|  hypothetical protein AALP_AA5G193800                  95.5    1e-20   Arabis alpina [alpine rockcress]
gb|AAK27514.1|AF344332_1  triosephosphate isomerase                   94.0    2e-20   Oesophagostomum quadrispinulatum
emb|CDP00096.1|  unnamed protein product                              95.5    2e-20   Coffea canephora [robusta coffee]
ref|XP_005718997.1|  triose-phosphate isomerase                       95.9    2e-20   Chondrus crispus [carageen]
ref|XP_010111131.1|  Triosephosphate isomerase                        95.1    2e-20   Morus notabilis
gb|ABY76196.1|  triosephosphate isomerase                             95.1    2e-20   Oryza coarctata
emb|CDY02939.1|  BnaC04g25470D                                        95.1    2e-20   
ref|XP_009139163.1|  PREDICTED: triosephosphate isomerase, cytosolic  95.1    2e-20   Brassica rapa
gb|EDM01925.1|  rCG29914, isoform CRA_c                               94.4    2e-20   Rattus norvegicus [brown rat]
ref|XP_003463291.1|  PREDICTED: triosephosphate isomerase             95.5    2e-20   Cavia porcellus [guinea pig]
ref|XP_002960386.1|  hypothetical protein SELMODRAFT_73442            95.1    2e-20   
gb|KHJ85713.1|  triose-phosphate isomerase                            94.7    2e-20   Oesophagostomum dentatum [nodule worm]
ref|XP_010504398.1|  PREDICTED: triosephosphate isomerase, cytoso...  95.1    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006737921.1|  PREDICTED: triosephosphate isomerase             95.1    2e-20   Leptonychotes weddellii
ref|XP_006291722.1|  hypothetical protein CARUB_v10017891mg           94.7    2e-20   Capsella rubella
gb|EFB13962.1|  hypothetical protein PANDA_011247                     95.1    3e-20   Ailuropoda melanoleuca
ref|XP_003371670.1|  triosephosphate isomerase                        95.1    3e-20   Trichinella spiralis
gb|KEZ41570.1|  hypothetical protein SAPIO_CDS7740                    94.7    3e-20   Scedosporium apiospermum
ref|XP_002712957.1|  PREDICTED: triosephosphate isomerase             95.1    3e-20   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005652645.1|  PREDICTED: triosephosphate isomerase isoform X1  95.5    4e-20   
ref|XP_006914710.1|  PREDICTED: triosephosphate isomerase             94.7    4e-20   Pteropus alecto
ref|XP_003273803.1|  PREDICTED: triosephosphate isomerase isoform 1   94.7    4e-20   Nomascus leucogenys [White-cheeked Gibbon]
emb|CDX76094.1|  BnaA04g03580D                                        94.4    4e-20   
ref|XP_004413981.1|  PREDICTED: triosephosphate isomerase             94.7    4e-20   Odobenus rosmarus divergens
ref|XP_010233547.1|  PREDICTED: triosephosphate isomerase, cytoso...  94.4    4e-20   
ref|XP_005106755.1|  PREDICTED: triosephosphate isomerase-like        94.0    4e-20   
ref|XP_002752312.2|  PREDICTED: triosephosphate isomerase             95.1    4e-20   
ref|XP_002314179.1|  hypothetical protein POPTR_0009s03650g           94.4    5e-20   
ref|XP_006933527.1|  PREDICTED: triosephosphate isomerase             94.4    5e-20   
ref|NP_001152759.1|  triosephosphate isomerase isoform 2              94.4    5e-20   
ref|XP_004869515.1|  PREDICTED: triosephosphate isomerase             94.0    5e-20   
gb|EFW99503.1|  triosephosphate isomerase                             94.0    5e-20   
ref|XP_006862693.1|  PREDICTED: triosephosphate isomerase isoform X1  94.4    5e-20   
ref|XP_008823594.1|  PREDICTED: triosephosphate isomerase             94.4    5e-20   
ref|XP_007469457.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...  94.4    5e-20   
ref|XP_006693025.1|  triosephosphate isomerase-like protein           94.0    5e-20   
ref|XP_003750702.2|  PREDICTED: triosephosphate isomerase             94.4    6e-20   
gb|AGJ83762.1|  triose phosphate isomerase                            94.0    6e-20   
gb|EKG16860.1|  Triosephosphate isomerase                             93.6    6e-20   
ref|XP_003905933.1|  PREDICTED: triosephosphate isomerase             94.0    6e-20   
gb|ETP37913.1|  triose-phosphate isomerase                            94.0    6e-20   
ref|XP_010384203.1|  PREDICTED: triosephosphate isomerase             94.0    7e-20   
ref|XP_004643583.1|  PREDICTED: triosephosphate isomerase             94.0    7e-20   
gb|AAZ57433.1|  triose-phosphate isomerase                            93.6    7e-20   
ref|XP_004236746.1|  PREDICTED: triosephosphate isomerase, cytosolic  93.6    7e-20   
ref|XP_007108358.1|  PREDICTED: triosephosphate isomerase             94.0    8e-20   
ref|XP_002167611.1|  PREDICTED: triosephosphate isomerase-like        93.2    8e-20   
gb|KDD74978.1|  triosephosphate isomerase                             93.2    8e-20   
ref|XP_008512210.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...  93.6    9e-20   
ref|XP_001497522.2|  PREDICTED: triosephosphate isomerase             93.6    9e-20   
gb|ETN69743.1|  triose-phosphate isomerase                            93.2    9e-20   
gb|ELK10405.1|  Triosephosphate isomerase                             93.2    9e-20   
ref|XP_008143086.1|  PREDICTED: triosephosphate isomerase             93.6    9e-20   
ref|XP_009139165.1|  PREDICTED: triosephosphate isomerase, cytoso...  93.2    9e-20   
ref|XP_003791751.1|  PREDICTED: triosephosphate isomerase-like        93.2    9e-20   
ref|XP_008343539.1|  PREDICTED: triosephosphate isomerase, cytosolic  93.2    9e-20   
ref|XP_008370609.1|  PREDICTED: triosephosphate isomerase, cytosolic  93.2    1e-19   
ref|NP_001126005.1|  triosephosphate isomerase                        93.2    1e-19   
pdb|4POC|A  Chain A, Structure Of Triosephosphate Isomerase Wild ...  93.2    1e-19   
pdb|4POD|A  Chain A, Structure Of Triosephosphate Isomerase I170v...  93.2    1e-19   
ref|XP_959063.1|  triosephosphate isomerase                           93.2    1e-19   
gb|AHY18975.1|  triosephosphate isomerase                             93.2    1e-19   
ref|XP_005907547.1|  PREDICTED: triosephosphate isomerase             93.6    1e-19   
ref|XP_005957952.1|  PREDICTED: triosephosphate isomerase             93.2    1e-19   
gb|AAH70129.1|  TPI1 protein                                          92.8    1e-19   
ref|XP_006065910.1|  PREDICTED: triosephosphate isomerase             93.2    1e-19   
ref|XP_011035316.1|  PREDICTED: triosephosphate isomerase, cytoso...  93.6    1e-19   
ref|XP_008910152.1|  triose-phosphate isomerase                       93.2    1e-19   
gb|ETO68762.1|  triose-phosphate isomerase                            93.2    1e-19   
ref|XP_001752170.1|  predicted protein                                92.8    1e-19   
dbj|BAD96358.1|  triosephosphate isomerase 1 variant                  92.8    1e-19   
ref|XP_005706061.1|  triosephosphate isomerase (TIM)                  93.2    1e-19   
ref|XP_010690624.1|  PREDICTED: triosephosphate isomerase, cytosolic  92.8    1e-19   
gb|AAH17917.1|  Triosephosphate isomerase 1                           92.8    1e-19   
gb|AAA42278.1|  triosephosphate isomerase                             92.8    1e-19   
dbj|BAF62362.1|  triosephosphate isomerase 1                          92.8    1e-19   
ref|XP_004708189.1|  PREDICTED: triosephosphate isomerase isoform X1  93.2    1e-19   
ref|NP_000356.1|  triosephosphate isomerase isoform 1                 92.8    1e-19   
emb|CDW58011.1|  triosephosphate isomerase                            92.8    1e-19   
ref|XP_006170851.1|  PREDICTED: triosephosphate isomerase             93.2    2e-19   
ref|XP_009343505.1|  PREDICTED: triosephosphate isomerase, cytosolic  92.8    2e-19   
ref|XP_005378895.1|  PREDICTED: triosephosphate isomerase             92.4    2e-19   
gb|KIV87420.1|  triosephosphate isomerase                             92.4    2e-19   
ref|NP_075211.2|  triosephosphate isomerase                           92.4    2e-19   
ref|XP_008337176.1|  PREDICTED: triosephosphate isomerase, cytoso...  90.9    2e-19   
ref|XP_004692958.1|  PREDICTED: triosephosphate isomerase isoform X1  92.4    2e-19   
ref|NP_705954.2|  triosephosphate isomerase B                         92.4    2e-19   
ref|XP_005538108.1|  triose-phosphate isomerase                       92.8    2e-19   
ref|XP_006992124.1|  PREDICTED: triosephosphate isomerase             92.8    2e-19   
emb|CDQ80447.1|  unnamed protein product                              92.4    2e-19   
ref|XP_010609974.1|  PREDICTED: triosephosphate isomerase             92.4    2e-19   
gb|AFK34912.1|  unknown                                               92.4    2e-19   
gb|ABD92704.1|  triosephosphate isomerase 1                           92.4    2e-19   
sp|Q90XG0.1|TPISB_DANRE  RecName: Full=Triosephosphate isomerase ...  92.4    2e-19   
ref|XP_007218840.1|  hypothetical protein PRUPE_ppa010323mg           92.4    2e-19   
dbj|BAI48105.1|  triosephosphate isomerase 1                          92.4    2e-19   
ref|XP_002621266.1|  triosephosphate isomerase                        92.4    2e-19   
ref|XP_005066069.1|  PREDICTED: triosephosphate isomerase             92.8    2e-19   
ref|NP_001133174.1|  triosephosphate isomerase B                      92.0    2e-19   
ref|XP_005338375.1|  PREDICTED: triosephosphate isomerase             92.4    2e-19   
gb|ADP21052.1|  cytosolic triosephosphate isomerase                   92.0    2e-19   
ref|XP_007935321.1|  PREDICTED: triosephosphate isomerase isoform X1  92.4    2e-19   
ref|XP_009357729.1|  PREDICTED: triosephosphate isomerase, cytoso...  92.0    2e-19   
ref|XP_008371752.1|  PREDICTED: triosephosphate isomerase, cytoso...  92.0    2e-19   
ref|NP_001028244.1|  triosephosphate isomerase                        92.0    2e-19   
ref|XP_004448557.1|  PREDICTED: triosephosphate isomerase isoform 2   92.4    3e-19   
ref|XP_004357462.1|  triose phosphate isomerase                       92.0    3e-19   
ref|NP_001013607.1|  triosephosphate isomerase                        92.0    3e-19   
ref|NP_001183983.1|  triosephosphate isomerase                        92.0    3e-19   
ref|XP_007006730.1|  hypothetical protein TREMEDRAFT_40506            92.0    3e-19   
gb|ADP21053.1|  cytosolic triosephosphate isomerase                   92.0    3e-19   
ref|XP_003003266.1|  triosephosphate isomerase                        91.7    3e-19   
emb|CBJ30340.1|  triosephosphate isomerase/glyceraldehyde-3-phosp...  94.7    3e-19   
gb|ESA13669.1|  hypothetical protein GLOINDRAFT_176549                91.7    3e-19   
gb|KIW00039.1|  triosephosphate isomerase                             91.7    3e-19   
ref|XP_004026051.1|  PREDICTED: triosephosphate isomerase-like is...  91.7    3e-19   
ref|XP_004569774.1|  PREDICTED: triosephosphate isomerase-like        91.7    3e-19   
emb|CDQ58416.1|  unnamed protein product                              91.7    3e-19   
ref|XP_009653583.1|  triosephosphate isomerase                        91.7    3e-19   
ref|XP_004279116.1|  PREDICTED: triosephosphate isomerase isoform 2   91.7    4e-19   
ref|XP_001587441.1|  triosephosphate isomerase                        91.3    4e-19   
ref|XP_006776159.1|  PREDICTED: triosephosphate isomerase-like        89.4    4e-19   
ref|XP_004387287.1|  PREDICTED: triosephosphate isomerase isoform 2   91.7    5e-19   
sp|P15426.2|TPIS_MACMU  RecName: Full=Triosephosphate isomerase; ...  91.3    5e-19   
ref|XP_011273813.1|  Triosephosphate isomerase                        91.3    5e-19   
ref|XP_010371267.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...  91.3    5e-19   
ref|XP_007839236.1|  Triosephosphate isomerase                        91.3    5e-19   
ref|XP_006891319.1|  PREDICTED: triosephosphate isomerase isoform X2  91.7    5e-19   
ref|XP_003303258.1|  hypothetical protein PTT_15400                   90.9    5e-19   
gb|ADP21072.1|  cytosolic triosephosphate isomerase                   91.3    6e-19   
gb|ADP21065.1|  cytosolic triosephosphate isomerase                   90.9    6e-19   
ref|XP_001936088.1|  triosephosphate isomerase                        90.9    6e-19   
gb|ADP21058.1|  cytosolic triosephosphate isomerase                   90.9    6e-19   
gb|ADP21077.1|  cytosolic triosephosphate isomerase                   90.9    6e-19   
gb|ABC59698.1|  triosephosphate isomerase                             90.9    6e-19   
gb|ADP21064.1|  cytosolic triosephosphate isomerase                   90.9    6e-19   
sp|Q589R5.1|TPIS_ORYLA  RecName: Full=Triosephosphate isomerase; ...  90.9    6e-19   
gb|ADP21061.1|  cytosolic triosephosphate isomerase                   90.9    6e-19   
ref|XP_003771273.1|  PREDICTED: triosephosphate isomerase             90.9    6e-19   
ref|NP_001032228.1|  triosephosphate isomerase                        90.9    7e-19   
ref|XP_004074104.1|  PREDICTED: triosephosphate isomerase             90.9    7e-19   
gb|KFH67239.1|  triosephosphate isomerase                             90.9    7e-19   
sp|P48501.1|TPIS_SCHMA  RecName: Full=Triosephosphate isomerase; ...  90.9    7e-19   
gb|ADP21048.1|  cytosolic triosephosphate isomerase                   90.9    7e-19   
emb|CCD74748.1|  putative triosephosphate isomerase                   90.9    7e-19   
ref|XP_007587355.1|  putative triosephosphate isomerase protein       90.9    7e-19   
gb|KHN99617.1|  triosephosphate isomerase                             90.9    7e-19   
gb|AAK85201.1|AF387818_1  triosephosphate isomerase                   90.5    8e-19   
emb|CDR47632.1|  CYFA0S35e00386g1_1                                   90.5    8e-19   
ref|XP_004596449.1|  PREDICTED: triosephosphate isomerase             90.9    9e-19   
ref|XP_004668721.1|  PREDICTED: triosephosphate isomerase             90.9    9e-19   
ref|XP_008730461.1|  triosephosphate isomerase                        90.9    9e-19   
gb|KFH70366.1|  triosephosphate isomerase, chloroplastic              90.5    9e-19   
gb|ADR66027.1|  triosephosphate isomerase                             90.5    1e-18   
ref|NP_001232159.1|  putative triosephosphate isomerase               89.7    1e-18   
ref|XP_005873734.1|  PREDICTED: triosephosphate isomerase             90.5    1e-18   
gb|ADP21078.1|  cytosolic triosephosphate isomerase                   90.5    1e-18   
ref|XP_460653.1|  DEHA2F06754p                                        90.1    1e-18   
pdb|1HTI|A  Chain A, Crystal Structure Of Recombinant Human Trios...  90.1    1e-18   
ref|XP_010956137.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...  90.5    1e-18   
gb|AAH61781.1|  Tpi1 protein                                          90.1    1e-18   
gb|KJA15659.1|  hypothetical protein HYPSUDRAFT_48119                 90.1    1e-18   
sp|Q27775.1|TPIS_SCHJA  RecName: Full=Triosephosphate isomerase; ...  90.1    1e-18   
pdb|4UNL|A  Chain A, Crystal Structure Of A Single Mutant (n71d) ...  90.1    1e-18   
emb|CAX70868.1|  triosephosphate isomerase 1a                         90.1    1e-18   
pdb|1WYI|A  Chain A, Human Triosephosphate Isomerase Of New Cryst...  90.1    1e-18   
gb|KIW64580.1|  triosephosphate isomerase                             90.1    1e-18   
emb|CAX75985.1|  triosephosphate isomerase 1a                         90.1    1e-18   
ref|XP_010989200.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...  90.5    1e-18   
ref|XP_001552990.1|  hypothetical protein BC1G_08882                  90.1    1e-18   
ref|XP_011404011.1|  PREDICTED: triosephosphate isomerase-like        89.7    1e-18   
pdb|2VOM|A  Chain A, Structural Basis Of Human Triosephosphate Is...  90.1    1e-18   
ref|XP_003348983.1|  hypothetical protein SMAC_02004                  90.1    1e-18   
gb|AAR04017.2|  chloroplast trisophosphate isomerase                  90.5    2e-18   
gb|ABU96661.1|  mitochondrial triosephosphate isomerase/glycerald...  92.4    2e-18   
gb|AAP06170.1|  similar to GenBank Accession Number L07286 triose...  89.7    2e-18   
ref|XP_007290736.1|  triosephosphate isomerase                        89.7    2e-18   
gb|EGW04354.1|  Triosephosphate isomerase                             87.8    2e-18   
emb|CCO35627.1|  triosephosphate isomerase (TIM)                      88.6    2e-18   
gb|ABC40670.1|  rcTPI1                                                89.7    2e-18   
pdb|4BR1|A  Chain A, Protease-induced Heterodimer Of Human Triose...  89.7    2e-18   
gb|KFY51925.1|  hypothetical protein V496_08733                       89.7    2e-18   
ref|XP_006124207.1|  PREDICTED: triosephosphate isomerase             89.7    2e-18   
gb|ADP21051.1|  cytosolic triosephosphate isomerase                   89.7    2e-18   
gb|EQL03066.1|  Triosephosphate isomerase                             90.1    2e-18   
gb|ACH45463.1|  putative triosephosphate isomerase                    89.7    2e-18   
gb|ACH45461.1|  putative triosephosphate isomerase                    89.7    2e-18   
gb|KIH88287.1|  triosephosphate isomerase (TIM)                       89.7    2e-18   
gb|ABC40671.1|  rcTPI1                                                89.7    2e-18   
ref|XP_007674831.1|  hypothetical protein BAUCODRAFT_410219           89.4    2e-18   
ref|XP_003307088.1|  triosephosphate isomerase                        89.7    2e-18   
gb|EEH15755.1|  triosephosphate isomerase                             89.4    2e-18   
ref|XP_007250949.1|  PREDICTED: triosephosphate isomerase B-like      89.4    2e-18   
ref|XP_003170440.1|  triosephosphate isomerase                        89.4    2e-18   
ref|XP_003452735.1|  PREDICTED: triosephosphate isomerase-like        89.4    2e-18   
ref|XP_006690070.1|  Triosephosphate isomerase                        89.4    2e-18   
ref|XP_006642422.1|  PREDICTED: triosephosphate isomerase B-like      89.4    2e-18   
ref|XP_010762134.1|  triosephosphate isomerase                        89.7    2e-18   
ref|XP_007699138.1|  hypothetical protein COCSADRAFT_36280            89.4    2e-18   
gb|ERT02000.1|  triose-phosphate isomerase                            89.4    2e-18   
ref|XP_007688722.1|  hypothetical protein COCMIDRAFT_26987            89.4    2e-18   
sp|P00939.1|TPIS_RABIT  RecName: Full=Triosephosphate isomerase; ...  89.4    3e-18   
gb|AAP02959.2|  triose phosphate isomerase                            89.0    3e-18   
gb|KFD57747.1|  hypothetical protein M513_01417                       89.0    3e-18   
ref|XP_001229743.1|  hypothetical protein CHGG_03227                  89.0    3e-18   
ref|XP_003655217.1|  hypothetical protein THITE_2118655               89.0    3e-18   
ref|XP_002795879.1|  triosephosphate isomerase                        89.0    3e-18   
ref|XP_007910800.1|  putative triosephosphate isomerase protein       89.0    3e-18   
gb|EFQ24919.1|  triosephosphate isomerase                             89.0    3e-18   
emb|CAX75987.1|  triosephosphate isomerase 1a                         89.0    3e-18   
ref|XP_003713934.1|  triosephosphate isomerase                        89.0    3e-18   
gb|KIW60200.1|  triosephosphate isomerase                             89.0    3e-18   
gb|AAV65489.1|  chloroplast triosephosphate isomerase                 89.4    3e-18   
gb|EEH40530.2|  triosephosphate isomerase                             89.0    3e-18   
ref|XP_006037108.1|  PREDICTED: triosephosphate isomerase             89.0    3e-18   
dbj|BAG09540.1|  triosephosphate isomerase                            89.4    3e-18   
gb|ADO27908.1|  triosephosphate isomerase b                           89.0    3e-18   
ref|NP_001171739.1|  triosephosphate isomerase 1                      89.0    3e-18   
gb|KGB42150.1|  Triosephosphate isomerase                             87.8    4e-18   
ref|XP_009252937.1|  hypothetical protein FPSE_01542                  88.6    4e-18   
ref|XP_011326337.1|  triosephosphate isomerase                        88.6    4e-18   
gb|KIN04889.1|  hypothetical protein OIDMADRAFT_157350                88.6    4e-18   
gb|KIV93909.1|  triosephosphate isomerase                             88.6    4e-18   
ref|XP_007874541.1|  triosephosphate isomerase                        88.6    4e-18   
gb|KDQ16852.1|  hypothetical protein BOTBODRAFT_156838                89.0    4e-18   
ref|XP_008958180.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...  88.6    4e-18   
ref|XP_008497346.1|  PREDICTED: triosephosphate isomerase             88.6    4e-18   
pdb|4UNK|A  Chain A, Crystal Structure Of Human Triosephosphate I...  88.6    4e-18   
ref|XP_003450634.1|  PREDICTED: triosephosphate isomerase B-like      88.6    4e-18   
dbj|BAO40149.1|  triosephosphate isomerase                            88.6    4e-18   
gb|KIL88976.1|  hypothetical protein FAVG1_07370                      88.6    4e-18   
emb|CEL59915.1|  triosephosphate isomerase (TIM)                      88.6    4e-18   
ref|XP_005925275.1|  PREDICTED: triosephosphate isomerase B-like      88.6    4e-18   
ref|XP_004550862.1|  PREDICTED: triosephosphate isomerase B-like      88.6    4e-18   
ref|XP_008712677.1|  triosephosphate isomerase                        88.6    5e-18   
gb|KIW21329.1|  triosephosphate isomerase                             88.6    5e-18   
gb|AFX60860.1|  triosephosphate isomerase                             89.0    5e-18   
ref|XP_008025870.1|  hypothetical protein SETTUDRAFT_163397           88.2    5e-18   
ref|XP_003410703.2|  PREDICTED: triosephosphate isomerase             88.6    5e-18   
gb|ELK24938.1|  Triosephosphate isomerase                             86.3    5e-18   
sp|Q70JN8.1|TPIS_KLUMA  RecName: Full=Triosephosphate isomerase; ...  88.2    6e-18   
emb|CCG81107.1|  Triosephosphate isomerase                            88.2    6e-18   
ref|XP_008337175.1|  PREDICTED: triosephosphate isomerase, cytoso...  86.7    6e-18   
pdb|4P61|A  Chain A, Chicken Triosephosphate Isomerase With Loop6...  88.2    7e-18   
gb|KFA69999.1|  hypothetical protein S40285_02081                     88.2    7e-18   



>ref|XP_009768928.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nicotiana 
sylvestris]
Length=322

 Score =   203 bits (516),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+FS LR S   S++ STTQSF Q VDS LR+SSS KGCRAVV MAGSGKFFVGGNWKCN
Sbjct  23   PHFSGLRPSSLNSISFSTTQSFSQNVDSHLRLSSSQKGCRAVVTMAGSGKFFVGGNWKCN  82

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI+KL+S+LNS+KLE DVDVVVAPPFLYIDQVK++LT+R+EISAQNCW GKGGAFT
Sbjct  83   GTKDSISKLISDLNSAKLESDVDVVVAPPFLYIDQVKSSLTDRIEISAQNCWTGKGGAFT  142

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL D+GCK
Sbjct  143  GEISVEQLKDLGCK  156



>ref|XP_009590743.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   203 bits (516),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+FS LR S   S++ STTQSFFQ VDS+LR+SSS KGCRAVV MAGSGKFFVGGNWKCN
Sbjct  23   PHFSGLRPSSLNSVSFSTTQSFFQNVDSQLRLSSSQKGCRAVVTMAGSGKFFVGGNWKCN  82

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI+KL+S+LNS+KLE DVDVVVAPPFLYIDQVK++LT+R+EISAQNCW GKGGAFT
Sbjct  83   GTKDSISKLISDLNSAKLESDVDVVVAPPFLYIDQVKSSLTDRIEISAQNCWTGKGGAFT  142

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL D+GCK
Sbjct  143  GEISVEQLKDLGCK  156



>ref|XP_004230885.1| PREDICTED: triosephosphate isomerase, chloroplastic [Solanum 
lycopersicum]
Length=326

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 113/137 (82%), Gaps = 3/137 (2%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffq---tVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNW  281
            P FS LR+S+       +  +       VDS LR+SS  KGCRAVVAMAGSGKFFVGGNW
Sbjct  24   PQFSGLRKSLSKLDNSVSFSTSQAFFQNVDSHLRISSDRKGCRAVVAMAGSGKFFVGGNW  83

Query  282  KCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGG  461
            KCNGTK+SI+KLVS+LNS++LE DVDVVVAPPFLYIDQVKN+LT+R+E+SAQNCW GKGG
Sbjct  84   KCNGTKDSISKLVSDLNSAQLESDVDVVVAPPFLYIDQVKNSLTDRIEVSAQNCWTGKGG  143

Query  462  AFTGEISVEQLNDIGCK  512
            AFTGEISVEQ+ D+GCK
Sbjct  144  AFTGEISVEQVKDLGCK  160



>ref|XP_009788094.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nicotiana 
sylvestris]
Length=327

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 113/137 (82%), Gaps = 3/137 (2%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffq---tVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNW  281
            P FS LR+S        +  +       VDS+LR+SS+ +GCRAVV MAGSGKFFVGGNW
Sbjct  25   PQFSGLRKSFSKFENSVSFSTSLAFFHNVDSQLRLSSAQRGCRAVVTMAGSGKFFVGGNW  84

Query  282  KCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGG  461
            KCNGTK+SI+KLVS+LNS++LE DVDVVVAPPFLYIDQVKN+LT+R+E+SAQNCW GKGG
Sbjct  85   KCNGTKDSISKLVSDLNSAQLESDVDVVVAPPFLYIDQVKNSLTDRIEVSAQNCWTGKGG  144

Query  462  AFTGEISVEQLNDIGCK  512
            AFTGEISVEQL D+GCK
Sbjct  145  AFTGEISVEQLKDLGCK  161



>ref|XP_006359648.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Solanum 
tuberosum]
Length=326

 Score =   198 bits (503),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 3/137 (2%)
 Frame = +3

Query  111  PNFSALRRS---IPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNW  281
            P FS LR+S   +  S++ ST+Q+FFQTVDS LR+S+  KGCRAVVAMAGSGKFFVGGNW
Sbjct  24   PQFSGLRKSFSKLDNSVSFSTSQAFFQTVDSHLRLSADRKGCRAVVAMAGSGKFFVGGNW  83

Query  282  KCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGG  461
            KCNGTK+SI+KLVS+LN+++LE DVDVVVAPPFLYIDQVKN+LT+R+E+SAQNCW GKGG
Sbjct  84   KCNGTKDSISKLVSDLNNAQLESDVDVVVAPPFLYIDQVKNSLTDRIEVSAQNCWTGKGG  143

Query  462  AFTGEISVEQLNDIGCK  512
            AFTGEISVEQ+ D+GCK
Sbjct  144  AFTGEISVEQVKDLGCK  160



>ref|XP_009610674.1| PREDICTED: triosephosphate isomerase, chloroplastic [Nicotiana 
tomentosiformis]
Length=327

 Score =   197 bits (502),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 113/137 (82%), Gaps = 3/137 (2%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffq---tVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNW  281
            P FS LR+S        +  +       VDS+LR+SS+ KGCRAVV MAGSGKFFVGGNW
Sbjct  25   PQFSGLRKSFSKFENSVSFSTSQAFFHNVDSQLRLSSAQKGCRAVVTMAGSGKFFVGGNW  84

Query  282  KCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGG  461
            KCNGTK+SI+KLVS+LNS++LE DVDVVVAPPFLYIDQ+KN++T+R+E+SAQNCW GKGG
Sbjct  85   KCNGTKDSISKLVSDLNSAQLESDVDVVVAPPFLYIDQIKNSITDRIEVSAQNCWTGKGG  144

Query  462  AFTGEISVEQLNDIGCK  512
            AFTGEISVEQL D+GCK
Sbjct  145  AFTGEISVEQLIDLGCK  161



>ref|XP_007041930.1| Triosephosphate isomerase isoform 2 [Theobroma cacao]
 gb|EOX97761.1| Triosephosphate isomerase isoform 2 [Theobroma cacao]
Length=307

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P FS LRRS P      +       ++S+LR+SSS K CRAV+AMAGSGKFFVGGNWKCN
Sbjct  9    PQFSGLRRSCPKLDNSQSQSFVQH-INSQLRLSSSPKPCRAVLAMAGSGKFFVGGNWKCN  67

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GT ESI KLVS+LNSS LE DVDVVVAPPF+Y+DQVK +LT+R+E+SAQN WIGKGGAFT
Sbjct  68   GTNESITKLVSDLNSSTLESDVDVVVAPPFVYLDQVKASLTDRIEVSAQNSWIGKGGAFT  127

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  128  GEISVEQLKDIGCK  141



>ref|XP_011088504.1| PREDICTED: triosephosphate isomerase, chloroplastic [Sesamum 
indicum]
Length=319

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  117  FSALRRSIPtsltlsttqsff--qtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            FS LRRS     T ++  +    + V+S L ++SS +GCR VV MAGSGKFFVGGNWKCN
Sbjct  20   FSGLRRSFLKLDTSNSNSTQAFFRNVNSHLHLASSSRGCRGVVTMAGSGKFFVGGNWKCN  79

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI+KLVSELNS+ LE DVDVVVAPPF+YIDQVKN+L++R+EISAQNCWIGKGGAFT
Sbjct  80   GTKDSISKLVSELNSATLESDVDVVVAPPFVYIDQVKNSLSDRIEISAQNCWIGKGGAFT  139

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL D+GCK
Sbjct  140  GEISVEQLKDLGCK  153



>ref|XP_006367334.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Solanum 
tuberosum]
Length=319

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 2/134 (1%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+FS LR S  ++  L  T SFFQ VDS LR+S S K CR VV+MAGSGKFFVGGNWKCN
Sbjct  22   PHFSGLRPS--SNFKLDNTHSFFQNVDSHLRLSPSHKACRPVVSMAGSGKFFVGGNWKCN  79

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI+KLVS+LNS+KLE DVDVVVAPPFLYIDQVK++LT+R+EIS QNCW GKGGAFT
Sbjct  80   GTKDSISKLVSDLNSAKLESDVDVVVAPPFLYIDQVKSSLTDRIEISGQNCWTGKGGAFT  139

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL D+GCK
Sbjct  140  GEISVEQLKDVGCK  153



>ref|XP_010690445.1| PREDICTED: triosephosphate isomerase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  108  TPNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
            +  FS LRRS     T  +TQS FQ V+S LR+SS+ +G R VVAMA SGKFFVGGNWKC
Sbjct  20   STQFSGLRRSFFKLETSVSTQSLFQNVESHLRLSSTRRGSRGVVAMAASGKFFVGGNWKC  79

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTKESI KLVS+LNS+ LE DVD+VVAPPF+YIDQVK++LTNRVEISAQNCWIGKGGAF
Sbjct  80   NGTKESITKLVSDLNSATLEADVDIVVAPPFVYIDQVKSSLTNRVEISAQNCWIGKGGAF  139

Query  468  TGEISVEQLNDIGCK  512
            TGEIS EQ+ D+GC+
Sbjct  140  TGEISAEQVKDLGCQ  154



>gb|KJB15724.1| hypothetical protein B456_002G192900 [Gossypium raimondii]
Length=216

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+FS LRRS P      +         S+LR+ SS K CRAV+AM+GSGKFFVGGNWKCN
Sbjct  9    PHFSGLRRSSPNLHNAPSQSFLQH-FGSQLRLPSSPKPCRAVIAMSGSGKFFVGGNWKCN  67

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI KLVS+LNS+KLE DVDVVVAPPF+Y+DQV ++LT+R+E+SAQN WIGKGGAFT
Sbjct  68   GTKDSITKLVSDLNSAKLESDVDVVVAPPFVYLDQVTSSLTDRIEVSAQNSWIGKGGAFT  127

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  128  GEISVEQLKDIGCK  141



>gb|EYU37874.1| hypothetical protein MIMGU_mgv1a008655mg [Erythranthe guttata]
Length=366

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            VDS LR++SS KGCR VVAMAGSGKFFVGGNWKCNGTK+SI+KLV+ELNS+ LE DVDVV
Sbjct  92   VDSHLRLASSNKGCRGVVAMAGSGKFFVGGNWKCNGTKDSISKLVTELNSAALESDVDVV  151

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVK++L++R+EI+AQNCW+GKGGAFTGEISVEQ+ D+GCK
Sbjct  152  VAPPFVYIDQVKSSLSDRIEIAAQNCWVGKGGAFTGEISVEQIQDLGCK  200



>ref|XP_010268686.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nelumbo 
nucifera]
Length=315

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            VDS L +S++ +GCR V+ MAGSGKFFVGGNWKCNGTK+SI+KLVS+LN++KLE DVDVV
Sbjct  41   VDSHLHLSAARRGCRGVITMAGSGKFFVGGNWKCNGTKDSISKLVSDLNNAKLEADVDVV  100

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN+LT+R+EISAQN W+GKGGAFTGEISVEQLNDIGCK
Sbjct  101  VAPPFVYIDQVKNSLTDRIEISAQNSWVGKGGAFTGEISVEQLNDIGCK  149



>emb|CDO96949.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   187 bits (474),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 113/142 (80%), Gaps = 8/142 (6%)
 Frame = +3

Query  111  PNFSALRRS-IPtsltlsttqsffqt----VDSRLRVSSSG---KGCRAVVAMAGSGKFF  266
            P FS LRRS  P   +   + S  Q+    +DS LR+SSS    K CR VVAMAGSGKFF
Sbjct  11   PQFSGLRRSSCPMLDSPPLSISTAQSFFQNLDSHLRLSSSSPRNKACRPVVAMAGSGKFF  70

Query  267  VGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCW  446
            VGGNWKCNGTKESI KL+S+LNS+ LE DVDVVVAPPF+YIDQVK++LT+R+E+SAQNCW
Sbjct  71   VGGNWKCNGTKESIGKLISDLNSAMLESDVDVVVAPPFIYIDQVKSSLTDRIEVSAQNCW  130

Query  447  IGKGGAFTGEISVEQLNDIGCK  512
            IGKGGAFTGEIS EQL DIGCK
Sbjct  131  IGKGGAFTGEISGEQLKDIGCK  152



>ref|XP_010268160.1| PREDICTED: triosephosphate isomerase, chloroplastic isoform X2 
[Nelumbo nucifera]
Length=316

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 115/138 (83%), Gaps = 5/138 (4%)
 Frame = +3

Query  111  PNFSALRRS-----IPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGG  275
            P FS LRRS     +  S T STTQSFF  V+S LR+S   +GCR V+ MAGSGKFFVGG
Sbjct  23   PQFSGLRRSGLSLKLDQSHTFSTTQSFFDHVNSHLRLSDGRRGCRGVITMAGSGKFFVGG  82

Query  276  NWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGK  455
            NWKCNGTKESI+KLVS+LN ++LE DVDVVVAPPF+YIDQVKN+LT+R+EISAQN W+GK
Sbjct  83   NWKCNGTKESISKLVSDLNGAELEADVDVVVAPPFIYIDQVKNSLTDRIEISAQNSWVGK  142

Query  456  GGAFTGEISVEQLNDIGC  509
            GGAFTGEISVEQL DIGC
Sbjct  143  GGAFTGEISVEQLKDIGC  160



>ref|XP_010268151.1| PREDICTED: triosephosphate isomerase, chloroplastic isoform X1 
[Nelumbo nucifera]
Length=327

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 115/138 (83%), Gaps = 5/138 (4%)
 Frame = +3

Query  111  PNFSALRRS-----IPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGG  275
            P FS LRRS     +  S T STTQSFF  V+S LR+S   +GCR V+ MAGSGKFFVGG
Sbjct  23   PQFSGLRRSGLSLKLDQSHTFSTTQSFFDHVNSHLRLSDGRRGCRGVITMAGSGKFFVGG  82

Query  276  NWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGK  455
            NWKCNGTKESI+KLVS+LN ++LE DVDVVVAPPF+YIDQVKN+LT+R+EISAQN W+GK
Sbjct  83   NWKCNGTKESISKLVSDLNGAELEADVDVVVAPPFIYIDQVKNSLTDRIEISAQNSWVGK  142

Query  456  GGAFTGEISVEQLNDIGC  509
            GGAFTGEISVEQL DIGC
Sbjct  143  GGAFTGEISVEQLKDIGC  160



>gb|KJB77731.1| hypothetical protein B456_012G153600 [Gossypium raimondii]
Length=307

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+F+ LRRS P   +  +       ++S+LR++SS K CRAV AMAGSGKFFVGGNWKCN
Sbjct  9    PHFNGLRRSSPKLDSSQSQSFLQH-INSQLRLASSRKPCRAVTAMAGSGKFFVGGNWKCN  67

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI KLVS+LNS+KLE DVDVVV+PPF+Y+DQV  +LT R+E+SAQN WIGKGGAFT
Sbjct  68   GTKDSITKLVSDLNSTKLETDVDVVVSPPFVYLDQVTASLTGRIEVSAQNSWIGKGGAFT  127

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  128  GEISVEQLKDIGCK  141



>gb|KJB15722.1| hypothetical protein B456_002G192900 [Gossypium raimondii]
Length=307

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 109/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+FS LRRS P      +         S+LR+ SS K CRAV+AM+GSGKFFVGGNWKCN
Sbjct  9    PHFSGLRRSSPNLHNAPSQSFLQH-FGSQLRLPSSPKPCRAVIAMSGSGKFFVGGNWKCN  67

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI KLVS+LNS+KLE DVDVVVAPPF+Y+DQV ++LT+R+E+SAQN WIGKGGAFT
Sbjct  68   GTKDSITKLVSDLNSAKLESDVDVVVAPPFVYLDQVTSSLTDRIEVSAQNSWIGKGGAFT  127

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  128  GEISVEQLKDIGCK  141



>gb|ADG27841.1| triosephosphate isomerase [Gossypium hirsutum]
Length=307

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+F+ L RS P   +  +       ++S+LR++SS K CRAV AMAGSGKFFVGGNWKCN
Sbjct  9    PHFNGLHRSSPKLDSSQSQSFLQH-INSQLRLASSRKPCRAVTAMAGSGKFFVGGNWKCN  67

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI KLVS+LNS+KLE DVDVVV+PPF+Y+DQV  +LT+R+E+SAQN WIGKGGAFT
Sbjct  68   GTKDSITKLVSDLNSAKLETDVDVVVSPPFVYLDQVTASLTSRIEVSAQNSWIGKGGAFT  127

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  128  GEISVEQLKDIGCK  141



>ref|XP_010090286.1| Triosephosphate isomerase [Morus notabilis]
 gb|EXB39256.1| Triosephosphate isomerase [Morus notabilis]
Length=324

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = +3

Query  111  PNFSALRRS---IPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNW  281
            PNFS LRRS   + T  ++S TQS FQ + S LR+SSS K  RAVVAM G+GKFFVGGNW
Sbjct  22   PNFSGLRRSCSKLETPHSISATQSLFQHLHSHLRLSSSAKPSRAVVAMVGTGKFFVGGNW  81

Query  282  KCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGG  461
            KCNGTKESI KLVS+LNS+KLE DVDVVVAPPF+Y+D VKN+LT+R++IS+QN W+GKGG
Sbjct  82   KCNGTKESITKLVSDLNSAKLESDVDVVVAPPFVYLDLVKNSLTHRIDISSQNSWVGKGG  141

Query  462  AFTGEISVEQLNDIGCK  512
            AFTGEISVEQL DIG K
Sbjct  142  AFTGEISVEQLKDIGAK  158



>ref|XP_011092863.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Sesamum 
indicum]
Length=319

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsffq--tVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
            +FS LRRS     + ++  +      V+S LR+ SS KGCR VV M+GSGKFFVGGNWKC
Sbjct  19   HFSGLRRSFLKLDSSNSDSTHSLFRDVNSHLRLVSSNKGCRGVVTMSGSGKFFVGGNWKC  78

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGT +SI+KLVS+LNS+ LE DVDVVVAPPF+YIDQVKN+L++R+EI+AQNCW GKGGAF
Sbjct  79   NGTGDSISKLVSDLNSAILESDVDVVVAPPFVYIDQVKNSLSDRIEIAAQNCWTGKGGAF  138

Query  468  TGEISVEQLNDIGCK  512
            TGEISVEQL D+GCK
Sbjct  139  TGEISVEQLKDLGCK  153



>ref|XP_002274871.1| PREDICTED: triosephosphate isomerase, chloroplastic [Vitis vinifera]
Length=324

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 107/133 (80%), Gaps = 6/133 (5%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsffqtVDSRLRVSSSG-KGCRAVVAMAGSGKFFVGGNWKCN  290
             FS LRRS       +   S      S LR+SSS  K CR +VAMAGSGKFFVGGNWKCN
Sbjct  30   QFSGLRRSF-----SNLDHSPQPFFSSNLRISSSPRKPCRGIVAMAGSGKFFVGGNWKCN  84

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI+KLVS+LNS+KLE DVDVVVAPPF+Y+DQVKN+LT+R+EISAQN W+GKGGAFT
Sbjct  85   GTKDSISKLVSDLNSAKLEADVDVVVAPPFVYLDQVKNSLTDRIEISAQNSWVGKGGAFT  144

Query  471  GEISVEQLNDIGC  509
            GEISVEQL DIGC
Sbjct  145  GEISVEQLKDIGC  157



>ref|XP_003542557.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Glycine 
max]
Length=305

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V S L   SS K  R VVAMAGSGKFFVGGNWKCNGTK+SI+KLVS+LNS+ LEPDVDVV
Sbjct  31   VHSTLSFPSSSKPSRGVVAMAGSGKFFVGGNWKCNGTKDSISKLVSDLNSATLEPDVDVV  90

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN++T+R+EISAQN W+GKGGAFTGEISVEQL D+GCK
Sbjct  91   VAPPFVYIDQVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLKDLGCK  139



>ref|XP_010028689.1| PREDICTED: triosephosphate isomerase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW55475.1| hypothetical protein EUGRSUZ_I01374 [Eucalyptus grandis]
Length=314

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 117/140 (84%), Gaps = 5/140 (4%)
 Frame = +3

Query  108  TPNFSALRRS--IPtsltlsttqsffqtVDSRL---RVSSSGKGCRAVVAMAGSGKFFVG  272
            T +FS LRRS  +  SL+LS  QSF + V+SR+     SS+ K CR VVAMAG+GKFFVG
Sbjct  9    TSHFSGLRRSSNLDRSLSLSPAQSFSEHVNSRICFSSASSNQKPCRGVVAMAGTGKFFVG  68

Query  273  GNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIG  452
            GNWKCNGTK+SI+KLVS+LNS+ LEPDVDVVVAPPF+YIDQVKN+LT R+EI++QN W G
Sbjct  69   GNWKCNGTKDSISKLVSDLNSATLEPDVDVVVAPPFVYIDQVKNSLTPRIEIASQNSWTG  128

Query  453  KGGAFTGEISVEQLNDIGCK  512
            KGGAFTGEISVEQL DIGCK
Sbjct  129  KGGAFTGEISVEQLKDIGCK  148



>ref|XP_009117434.1| PREDICTED: triosephosphate isomerase, chloroplastic [Brassica 
rapa]
Length=320

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = +3

Query  108  TPNFSALRRSIPtsltlsttqsff--qtVDSRLR-VSSSGKGCRAVVAMAGSGKFFVGGN  278
             P+FS LRR+ P      +         V+S +R VSSS +  R VVAMAGSGKFFVGGN
Sbjct  17   APSFSGLRRTCPKLDAAVSFSHQPFCNRVNSSIRLVSSSNRSPRGVVAMAGSGKFFVGGN  76

Query  279  WKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKG  458
            WKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++LT+R+EIS QN W+GKG
Sbjct  77   WKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKG  136

Query  459  GAFTGEISVEQLNDIGCK  512
            GAFTGEISVEQL DIGCK
Sbjct  137  GAFTGEISVEQLKDIGCK  154



>ref|XP_004248665.1| PREDICTED: triosephosphate isomerase, chloroplastic [Solanum 
lycopersicum]
Length=312

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  213  SGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYID  392
            S KGCR VV+MAGSGKFFVGGNWKCNGTK+SI+KLVS+LNS+KLE DVDVVVAPPF+YID
Sbjct  47   SHKGCRPVVSMAGSGKFFVGGNWKCNGTKDSISKLVSDLNSAKLESDVDVVVAPPFMYID  106

Query  393  QVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            QVK++LT+R+EIS QNCW GKGGAFTGEISVEQL DIGCK
Sbjct  107  QVKSSLTDRIEISGQNCWTGKGGAFTGEISVEQLKDIGCK  146



>emb|CDY13836.1| BnaA09g43380D [Brassica napus]
Length=320

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = +3

Query  108  TPNFSALRRSIPtsltlsttqsff--qtVDSRLRV-SSSGKGCRAVVAMAGSGKFFVGGN  278
             P+FS LRR+ P      +         V+S +R+ SSS +  R VVAMAGSGKFFVGGN
Sbjct  17   APSFSGLRRTCPKLDAAVSFSHHSFCNRVNSSIRLLSSSNRSPRGVVAMAGSGKFFVGGN  76

Query  279  WKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKG  458
            WKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++LT+R+EIS QN W+GKG
Sbjct  77   WKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKG  136

Query  459  GAFTGEISVEQLNDIGCK  512
            GAFTGEISVEQL DIGCK
Sbjct  137  GAFTGEISVEQLKDIGCK  154



>ref|XP_004147017.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004158393.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN61895.1| hypothetical protein Csa_2G263900 [Cucumis sativus]
Length=306

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V S++R++SS KG R VV MAGSGKFFVGGNWKCNGTKESIAKLV++LN++KLE DVDVV
Sbjct  32   VHSQIRLASSRKGSRGVVTMAGSGKFFVGGNWKCNGTKESIAKLVADLNNAKLEDDVDVV  91

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YI+QVK++LT+R+EISAQN W+ KGGAFTGEISVEQL DIGCK
Sbjct  92   VAPPFVYIEQVKSSLTSRIEISAQNSWVSKGGAFTGEISVEQLKDIGCK  140



>ref|XP_002529248.1| triosephosphate isomerase, putative [Ricinus communis]
 gb|EEF33126.1| triosephosphate isomerase, putative [Ricinus communis]
Length=313

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsf-fqtVDSRLR-VSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
             FS LR+S P  L   +      +  +S+LR +SSS K  R VVAMAG+G FFVGGNWKC
Sbjct  13   QFSGLRQSCPKLLETHSLSQSFLRHFNSQLRSISSSRKPSRHVVAMAGTGTFFVGGNWKC  72

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTKESI+KLVS+LN +KLE DVDVVVAPPF+YIDQVK++LT+R+EISAQN W+ KGGAF
Sbjct  73   NGTKESISKLVSDLNDAKLEADVDVVVAPPFIYIDQVKSSLTDRIEISAQNSWVSKGGAF  132

Query  468  TGEISVEQLNDIGCK  512
            TGEISVEQLNDIGCK
Sbjct  133  TGEISVEQLNDIGCK  147



>emb|CDX99612.1| BnaC04g33690D [Brassica napus]
Length=312

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLR-VSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
            P+FS LRR+    L L    SF   V+S +R VSSS +  R VVAMAGSGKFFVGGNWKC
Sbjct  15   PSFSGLRRTC---LKLEAAVSFSHRVNSSIRLVSSSQRSPRGVVAMAGSGKFFVGGNWKC  71

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTK+SI KLVS+LN++ LEPDVDVVV+PPF+YIDQVK++LT+R+EIS QN W+GKGGAF
Sbjct  72   NGTKDSITKLVSDLNTATLEPDVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKGGAF  131

Query  468  TGEISVEQLNDIGCK  512
            TGEISVEQL DIGCK
Sbjct  132  TGEISVEQLKDIGCK  146



>gb|KHN48239.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=305

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V S L   SS K  R VVAMAGSGKFFVGGNWKCNGTK+SI+KLVS+LN + LEPDVDVV
Sbjct  31   VHSALSFPSSSKPSRGVVAMAGSGKFFVGGNWKCNGTKDSISKLVSDLNRATLEPDVDVV  90

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN++T+R+EISAQN W+GKGGAFTGEISVEQL D+GCK
Sbjct  91   VAPPFVYIDQVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLKDLGCK  139



>ref|XP_008457647.1| PREDICTED: triosephosphate isomerase, chloroplastic [Cucumis 
melo]
Length=306

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V S++R++SS K  R VVAMAGSGKFFVGGNWKCNGTKESIAKLVS+LN++KLE DVDVV
Sbjct  32   VHSQIRLASSRKVSRGVVAMAGSGKFFVGGNWKCNGTKESIAKLVSDLNNAKLEDDVDVV  91

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YI+QVK++LT+R+EISAQN W+ KGGAFTGEISVEQL DIGCK
Sbjct  92   VAPPFVYIEQVKSSLTSRIEISAQNSWVSKGGAFTGEISVEQLKDIGCK  140



>ref|XP_004494086.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cicer 
arietinum]
Length=314

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +3

Query  189  DSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            D  LR+S SS K  R V+AMAGSGKFFVGGNWKCNGTK+SI+KL+S+LNS+KLEPDVDVV
Sbjct  40   DPNLRLSLSSTKPSRTVIAMAGSGKFFVGGNWKCNGTKDSISKLLSDLNSAKLEPDVDVV  99

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVK+++T+R+EISAQN W+GKGGAFTGEISVEQL D+GCK
Sbjct  100  VAPPFVYIDQVKSSITDRIEISAQNSWVGKGGAFTGEISVEQLKDLGCK  148



>gb|ABK24413.1| unknown [Picea sitchensis]
 gb|ACN40974.1| unknown [Picea sitchensis]
Length=328

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  204  VSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFL  383
            V + G GCR VV MAG+GKFFVGGNWKCNGTK+SI+KLV+ELNS+KLE DVD+VVAPPF+
Sbjct  60   VQAVGNGCRGVVTMAGTGKFFVGGNWKCNGTKDSISKLVTELNSAKLEDDVDIVVAPPFV  119

Query  384  YIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            YIDQVK++LT+R+EISAQN W+GKGGAFTGEISVEQL DIGCK
Sbjct  120  YIDQVKSSLTDRIEISAQNAWVGKGGAFTGEISVEQLKDIGCK  162



>gb|ABR16682.1| unknown [Picea sitchensis]
 gb|ACN40828.1| unknown [Picea sitchensis]
Length=328

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  204  VSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFL  383
            V + G GCR VV MAG+GKFFVGGNWKCNGTK+SI+KLV+ELNS+KLE DVD+VVAPPF+
Sbjct  60   VQAVGNGCRGVVTMAGTGKFFVGGNWKCNGTKDSISKLVTELNSAKLEDDVDIVVAPPFV  119

Query  384  YIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            YIDQVK++LT+R+EISAQN W+GKGGAFTGEISVEQL DIGCK
Sbjct  120  YIDQVKSSLTDRIEISAQNAWVGKGGAFTGEISVEQLKDIGCK  162



>gb|KDP27586.1| hypothetical protein JCGZ_19591 [Jatropha curcas]
Length=321

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtV---DSRLRVSSSGKGCRAVVAMAGSGKFFVGGNW  281
            P FS LRRS P   + ++       +   +S+LRV SS K    VVAMAG+G FFVGGNW
Sbjct  19   PQFSGLRRSCPKLESTNSHSLSQSFLRHFNSQLRVPSSRKPSGHVVAMAGTGTFFVGGNW  78

Query  282  KCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGG  461
            KCNGTKESI KLVS+LN +KLE DVDVVVAPPF+YIDQVK++LT+R+EIS QN W+ KGG
Sbjct  79   KCNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKSSLTDRIEISGQNSWVSKGG  138

Query  462  AFTGEISVEQLNDIGCK  512
            AFTGEISVEQL DIGCK
Sbjct  139  AFTGEISVEQLKDIGCK  155



>ref|XP_009140258.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Brassica 
rapa]
Length=312

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLR-VSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
            P+FS LRR+ P      +       V+S +R VSSS +  R VVAMAGSGKFFVGGNWKC
Sbjct  15   PSFSGLRRTCPKLDAAVSFSHR---VNSSIRLVSSSQRSPRGVVAMAGSGKFFVGGNWKC  71

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTK++I KLVS+LN++ LE DVDVVV+PPF+YIDQVK++LT+R+EIS QN W+GKGGAF
Sbjct  72   NGTKDTITKLVSDLNTATLESDVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKGGAF  131

Query  468  TGEISVEQLNDIGCK  512
            TGEISVEQL DIGCK
Sbjct  132  TGEISVEQLKDIGCK  146



>gb|EPS59362.1| triosephosphate isomerase [Genlisea aurea]
Length=314

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNG  293
             FS LR+S P     S+   F + V+S +R++S+ KGCRAV  M GSGKFFVGGNWKCNG
Sbjct  16   QFSGLRKSFPKLDNSSSRSLFLK-VESHVRLASTSKGCRAVATMLGSGKFFVGGNWKCNG  74

Query  294  TKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTN-RVEISAQNCWIGKGGAFT  470
            +KESI KLVSELN++ LE DVDVVVAPPF+YIDQVKN+L N R++I+AQNCW GKGGAFT
Sbjct  75   SKESIGKLVSELNNATLEADVDVVVAPPFVYIDQVKNSLVNSRIQIAAQNCWTGKGGAFT  134

Query  471  GEISVEQLNDIGC  509
            GEISVEQ+ DIG 
Sbjct  135  GEISVEQIKDIGA  147



>ref|XP_009418696.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=309

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNG  293
             FS LRR + +     +T  F ++V SR+R+ +S +  R VVAMAG+GKFFVGGNWKCNG
Sbjct  11   QFSGLRREVLSREAAPSTALFLRSVHSRIRLPASCRPPRGVVAMAGTGKFFVGGNWKCNG  70

Query  294  TKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTG  473
            T++SI KLV++LN +KLE DVD+VVAPP++YIDQVK +LT+R+EISAQN WIGKGGAFTG
Sbjct  71   TRDSITKLVADLNDAKLETDVDIVVAPPYIYIDQVKQSLTDRIEISAQNSWIGKGGAFTG  130

Query  474  EISVEQLNDIGCK  512
            EIS EQL DIGCK
Sbjct  131  EISAEQLVDIGCK  143



>emb|CDY15911.1| BnaA04g12000D [Brassica napus]
Length=312

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLR-VSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
            P+FS LRR+ P      +       V+S +R VSSS +  R VVAMAGSGKFFVGGNWKC
Sbjct  15   PSFSGLRRTCPKLDAAVSFSHR---VNSSVRLVSSSQRSPRGVVAMAGSGKFFVGGNWKC  71

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTK++I KLVS+LN++ LE DVDVVV+PPF+YIDQVK++LT+R+EIS QN W+GKGGAF
Sbjct  72   NGTKDTITKLVSDLNTATLESDVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKGGAF  131

Query  468  TGEISVEQLNDIGCK  512
            TGEISVEQL DIGCK
Sbjct  132  TGEISVEQLKDIGCK  146



>ref|XP_003554399.1| PREDICTED: triosephosphate isomerase, chloroplastic [Glycine 
max]
 gb|KHN02301.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=309

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +3

Query  189  DSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            D  LR+S S  +  RA+VAMAG+GKFFVGGNWKCNGTK+SI+KLV++LNS+KLEPDVDVV
Sbjct  35   DPNLRLSLSPPRPSRAIVAMAGTGKFFVGGNWKCNGTKDSISKLVADLNSAKLEPDVDVV  94

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPFLYIDQVKN+LT R+EISAQN W+GKGGAFTGEIS EQL D+GCK
Sbjct  95   VAPPFLYIDQVKNSLTERIEISAQNSWVGKGGAFTGEISAEQLKDLGCK  143



>emb|CDX82002.1| BnaC08g35990D [Brassica napus]
Length=320

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = +3

Query  108  TPNFSALRRSIPtsltlsttqsff--qtVDSRLR-VSSSGKGCRAVVAMAGSGKFFVGGN  278
             P+FS LRR+ P      +         V+S +R VSSS +  R VVAMAGSGKFFVGGN
Sbjct  17   APSFSGLRRTCPKLDAAISFSHQSFCNRVNSSIRLVSSSNRSPRGVVAMAGSGKFFVGGN  76

Query  279  WKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKG  458
            WKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++LT+ +EIS QN W+GKG
Sbjct  77   WKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSLTDLIEISGQNSWVGKG  136

Query  459  GAFTGEISVEQLNDIGCK  512
            GAFTGEISVEQL DIGCK
Sbjct  137  GAFTGEISVEQLKDIGCK  154



>ref|NP_001240895.1| uncharacterized protein LOC100799358 [Glycine max]
 gb|ACU17908.1| unknown [Glycine max]
Length=309

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +3

Query  189  DSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            D  LR+S S  K  RAV+AMAG+GKFFVGGNWKCNGTK+SI+KLV++LN++KLEPDVDVV
Sbjct  35   DPNLRLSLSPPKPSRAVIAMAGTGKFFVGGNWKCNGTKDSISKLVADLNNAKLEPDVDVV  94

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPFLYIDQVKN+LT R+EISAQN W+GKGGAFTGEIS EQL D+GCK
Sbjct  95   VAPPFLYIDQVKNSLTERIEISAQNSWVGKGGAFTGEISAEQLKDLGCK  143



>ref|XP_004289838.1| PREDICTED: triosephosphate isomerase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +3

Query  219  KGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQV  398
            K  RAVVAMAG+GKFFVGGNWKCNGTK+SI+KLVS+LNS+KLEPDVDVVVAPPFLY+DQV
Sbjct  55   KASRAVVAMAGTGKFFVGGNWKCNGTKDSISKLVSDLNSAKLEPDVDVVVAPPFLYLDQV  114

Query  399  KNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            K++LT+R+EIS QN W+GKGGAFTGEISVEQL DIGCK
Sbjct  115  KSSLTDRIEISGQNSWVGKGGAFTGEISVEQLKDIGCK  152



>ref|XP_011037267.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Populus 
euphratica]
Length=313

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 106/134 (79%), Gaps = 6/134 (4%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P FS LRR  P + T ++         S LR SS  K  R V+AMAG+G+FFVGGNWKCN
Sbjct  20   PEFSGLRRLCPNNNTNNSHS------QSFLRFSSPRKPLRGVLAMAGTGQFFVGGNWKCN  73

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTKESI KL+S+LNS+KLE DVDVVVAPPF+YIDQVK++LT+R+EISAQN W+ KGGAFT
Sbjct  74   GTKESITKLISDLNSAKLESDVDVVVAPPFIYIDQVKSSLTDRIEISAQNSWVSKGGAFT  133

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  134  GEISVEQLKDIGCK  147



>ref|XP_007162792.1| hypothetical protein PHAVU_001G181000g [Phaseolus vulgaris]
 gb|ESW34786.1| hypothetical protein PHAVU_001G181000g [Phaseolus vulgaris]
Length=309

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  FSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGT  296
            +  LRR  P   + ++        + RL +S   K  R+VVAMAGSGKFFVGGNWKCNGT
Sbjct  13   YIGLRRPCPKLDSFNSPSFSAFGPNIRLSLSPP-KPSRSVVAMAGSGKFFVGGNWKCNGT  71

Query  297  KESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGE  476
            K+SI+KLV++LNS+KLEPDVDVVVAPPFLYIDQVK++LT+R+EISAQN W+GKGGAFTGE
Sbjct  72   KDSISKLVADLNSAKLEPDVDVVVAPPFLYIDQVKSSLTDRIEISAQNSWVGKGGAFTGE  131

Query  477  ISVEQLNDIGCK  512
            ISVEQL D+GCK
Sbjct  132  ISVEQLKDLGCK  143



>gb|KHN18687.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=309

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +3

Query  189  DSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            D  LR+S S  +  RA+VAMAG+GKFFVGGNWKCNGTK+SI+KLV++LN++KLEPDVDVV
Sbjct  35   DPNLRLSLSPPRPSRAIVAMAGTGKFFVGGNWKCNGTKDSISKLVADLNNAKLEPDVDVV  94

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPFLYIDQVKN+LT R+EISAQN W+GKGGAFTGEIS EQL D+GCK
Sbjct  95   VAPPFLYIDQVKNSLTERIEISAQNSWVGKGGAFTGEISAEQLKDLGCK  143



>gb|ACU23262.1| unknown [Glycine max]
Length=309

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +3

Query  189  DSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            D  LR+  S  +  RA+VAMAG+GKFFVGGNWKCNGTK+SI+KLV++LNS+KLEPDVDVV
Sbjct  35   DPNLRLPLSPPRPSRAIVAMAGTGKFFVGGNWKCNGTKDSISKLVADLNSAKLEPDVDVV  94

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPFLYIDQVKN+LT R+EISAQN W+GKGGAFTGEIS EQL D+GCK
Sbjct  95   VAPPFLYIDQVKNSLTERIEISAQNSWVGKGGAFTGEISAEQLKDLGCK  143



>gb|KFK41726.1| hypothetical protein AALP_AA2G164900 [Arabis alpina]
Length=315

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = +3

Query  108  TPNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
             P+FS LRR  P      +      +  +RL VSSS +  R VVAMAGSGKFFVGGNWKC
Sbjct  17   APSFSGLRRICPNLDAAVSFSHRVYS-STRL-VSSSRRSPRGVVAMAGSGKFFVGGNWKC  74

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTK+SIAKL+S+LN++ LE DVDVVV+PPF+YIDQVK++LT+R+EIS QN W+GKGGAF
Sbjct  75   NGTKDSIAKLISDLNAATLEADVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKGGAF  134

Query  468  TGEISVEQLNDIGCK  512
            TGEISVEQL D+GCK
Sbjct  135  TGEISVEQLKDLGCK  149



>ref|XP_009392888.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  120  SALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTK  299
            S LRR + +  +   T  F ++V SRLR+ S  +  R VVAMAG+GKFFVGGNWKCNGTK
Sbjct  15   SGLRREVLSRESAPPTALFLRSVHSRLRLPSIRRPHRGVVAMAGTGKFFVGGNWKCNGTK  74

Query  300  ESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEI  479
            +SI KLV++LN +KLE DVD+VVAPP++Y DQVK +LT+R+EISAQNCW+GKGGAFTGEI
Sbjct  75   DSITKLVADLNDAKLENDVDIVVAPPYIYADQVKQSLTDRIEISAQNCWVGKGGAFTGEI  134

Query  480  SVEQLNDIGCK  512
            S EQL DIGCK
Sbjct  135  SAEQLIDIGCK  145



>gb|KJB15723.1| hypothetical protein B456_002G192900 [Gossypium raimondii]
Length=317

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 108/144 (75%), Gaps = 11/144 (8%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+FS LRRS P      +         S+LR+ SS K CRAV+AM+GSGKFFVGGNWKCN
Sbjct  9    PHFSGLRRSSPNLHNAPSQSFLQH-FGSQLRLPSSPKPCRAVIAMSGSGKFFVGGNWKCN  67

Query  291  GTKESIAKLVSELNSSKLEPDVD----------VVVAPPFLYIDQVKNNLTNRVEISAQN  440
            GTK+SI KLVS+LNS+KLE DV           VVVAPPF+Y+DQV ++LT+R+E+SAQN
Sbjct  68   GTKDSITKLVSDLNSAKLESDVGILQPLFFNPYVVVAPPFVYLDQVTSSLTDRIEVSAQN  127

Query  441  CWIGKGGAFTGEISVEQLNDIGCK  512
             WIGKGGAFTGEISVEQL DIGCK
Sbjct  128  SWIGKGGAFTGEISVEQLKDIGCK  151



>ref|XP_002306169.2| hypothetical protein POPTR_0004s17530g [Populus trichocarpa]
 gb|ABK95670.1| unknown [Populus trichocarpa]
 gb|EEE86680.2| hypothetical protein POPTR_0004s17530g [Populus trichocarpa]
Length=313

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 104/134 (78%), Gaps = 6/134 (4%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P FS LRR  P + T ++         S LR SS  K  R V AMAG+G+FFVGGNWKCN
Sbjct  20   PEFSGLRRLCPNNNTNNSHS------QSFLRFSSPRKPLRGVFAMAGTGQFFVGGNWKCN  73

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTKESI  L+S+LNS+KLE DVDVVVAPPF+YIDQVK++LT+R+EISAQN W+ KGGAFT
Sbjct  74   GTKESITTLISDLNSAKLESDVDVVVAPPFIYIDQVKSSLTDRIEISAQNSWVSKGGAFT  133

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  134  GEISVEQLKDIGCK  147



>sp|P48496.1|TPIC_SPIOL RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Spinacia 
oleracea]
 gb|AAA66289.1| triosephosphate isomerase, chloroplast isozyme [Spinacia oleracea]
Length=322

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  108  TPNFSALRRS-IPtsltlsttqsffqtVDSRLRVSSSGKGC-RAVVAMAGSGKFFVGGNW  281
            +  FS LRRS +    ++ST  SFFQ VDS LR+SSS + C R VVAMAGSGKFFVGGNW
Sbjct  20   STQFSGLRRSFLKLENSVSTQSSFFQNVDSHLRLSSSSRRCPRGVVAMAGSGKFFVGGNW  79

Query  282  KCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGG  461
            KCNGTKESI KLVS+LNS+ LE DVDVVVAPPF+YIDQVK++LT RVEISAQNCWIGKGG
Sbjct  80   KCNGTKESITKLVSDLNSATLEADVDVVVAPPFVYIDQVKSSLTGRVEISAQNCWIGKGG  139

Query  462  AFTGEISVEQLNDIGCK  512
            AFTGEISVEQL D+GC+
Sbjct  140  AFTGEISVEQLKDLGCQ  156



>gb|AFK41708.1| unknown [Medicago truncatula]
Length=312

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = +3

Query  186  VDSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDV  362
            +   LR+S SS K  R V+AMAGSGKFFVGGNWKCNGTK+SI+KL+S+LN++KLEPDVDV
Sbjct  37   IHPNLRLSISSPKPSRTVIAMAGSGKFFVGGNWKCNGTKDSISKLISDLNNAKLEPDVDV  96

Query  363  VVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VVAPPF+YIDQVK ++T+R+EIS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  97   VVAPPFVYIDQVKTSITDRIEISGQNSWVGKGGAFTGEISVEQLKDLGCK  146



>gb|KEH24057.1| triosephosphate isomerase [Medicago truncatula]
Length=312

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = +3

Query  186  VDSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDV  362
            +   LR+S SS K  R V+AMAGSGKFFVGGNWKCNGTK+SI+KL+S+LN++KLEPDVDV
Sbjct  37   IHPNLRLSISSPKPSRTVIAMAGSGKFFVGGNWKCNGTKDSISKLISDLNNAKLEPDVDV  96

Query  363  VVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VVAPPF+YIDQVK ++T+R+EIS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  97   VVAPPFVYIDQVKTSITDRIEISGQNSWVGKGGAFTGEISVEQLKDLGCK  146



>ref|XP_004957468.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Setaria 
italica]
Length=304

 Score =   174 bits (441),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            +LR+ SS +  + VVAMAGSGKFFVGGNWKCNGTK+SI+KLVSELN++ LE DVDVVVAP
Sbjct  33   QLRIGSSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLEADVDVVVAP  92

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  138



>ref|NP_001063777.1| Os09g0535000 [Oryza sativa Japonica Group]
 dbj|BAD33340.1| putative Triosephosphate isomerase, chloroplast precursor [Oryza 
sativa Japonica Group]
 dbj|BAD34212.1| putative Triosephosphate isomerase, chloroplast precursor [Oryza 
sativa Japonica Group]
 dbj|BAF25691.1| Os09g0535000 [Oryza sativa Japonica Group]
Length=304

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            +LR+  S +  + VVAMAGSGKFFVGGNWKCNGTK+S++KLV+ELN++ LEPDVDVVVAP
Sbjct  33   QLRLGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVTELNAATLEPDVDVVVAP  92

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PF+YIDQVKN+LT+R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  93   PFIYIDQVKNSLTDRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  138



>gb|EAZ09878.1| hypothetical protein OsI_32171 [Oryza sativa Indica Group]
Length=304

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            +LR+  S +  + VVAMAGSGKFFVGGNWKCNGTK+S++KLV+ELN++ LEPDVDVVVAP
Sbjct  33   QLRLGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVTELNAATLEPDVDVVVAP  92

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PF+YIDQVKN+LT+R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  93   PFIYIDQVKNSLTDRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  138



>gb|KHN39016.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=303

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  213  SGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYID  392
            S K  R VVAMAGSGKFFVGGNWKCNGTK+SI KLVS+LNS+ LE DVDVVVAPPF+YID
Sbjct  38   SSKPSRGVVAMAGSGKFFVGGNWKCNGTKDSIRKLVSDLNSATLESDVDVVVAPPFVYID  97

Query  393  QVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            QVKN++T+R+EISAQN W+GKGGAFTGEISVEQL D+GCK
Sbjct  98   QVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLKDLGCK  137



>ref|NP_001241611.1| uncharacterized protein LOC100798459 [Glycine max]
 gb|ACU23273.1| unknown [Glycine max]
Length=304

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  213  SGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYID  392
            S K  R VVAMAGSGKFFVGGNWKCNGTK+SI KLVS+LNS+ LE DVDVVVAPPF+YID
Sbjct  39   SSKPSRGVVAMAGSGKFFVGGNWKCNGTKDSIRKLVSDLNSATLESDVDVVVAPPFVYID  98

Query  393  QVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            QVKN++T+R+EISAQN W+GKGGAFTGEISVEQL D+GCK
Sbjct  99   QVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLKDLGCK  138



>gb|ACF79785.1| unknown [Zea mays]
 tpg|DAA62484.1| TPA: LOW QUALITY PROTEIN: triosephosphate isomerase [Zea mays]
Length=284

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V  +LRV  S +  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVSELN++ LE DVDVV
Sbjct  30   VPQQLRVGFSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVV  89

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  90   VAPPFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  138



>ref|NP_001152578.1| triosephosphate isomerase [Zea mays]
 gb|ACG48313.1| triosephosphate isomerase [Zea mays]
Length=304

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V  +LRV  S +  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVSELN++ LE DVDVV
Sbjct  30   VPQQLRVGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVV  89

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  90   VAPPFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  138



>ref|XP_006661479.1| PREDICTED: triosephosphate isomerase, chloroplastic-like, partial 
[Oryza brachyantha]
Length=288

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            +LR+  S +  + VVAMAGSGKFFVGGNWKCNGTK+S++KLV+ELN++ LEPDVDVVVAP
Sbjct  17   QLRIGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVTELNAATLEPDVDVVVAP  76

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PF+YIDQVK++LT+R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  77   PFIYIDQVKSSLTDRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  122



>gb|AFK45656.1| unknown [Lotus japonicus]
Length=307

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            RL +SSS K  R+V+AMAGSGKFFVGGNWKCNGTK+SI+KLV++LNS+KLEPDVDVVVAP
Sbjct  37   RLPISSS-KPSRSVIAMAGSGKFFVGGNWKCNGTKDSISKLVADLNSAKLEPDVDVVVAP  95

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PF+YIDQVKN++T+R+E+SAQN W+ KGGAFTGEISVEQL D G K
Sbjct  96   PFVYIDQVKNSITDRIEVSAQNSWVSKGGAFTGEISVEQLKDHGVK  141



>ref|XP_002312980.1| triosephosphate isomerase family protein [Populus trichocarpa]
 gb|EEE86935.1| triosephosphate isomerase family protein [Populus trichocarpa]
Length=315

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P FS LRR  P S   ++           LR  S  K  ++VVAMAG+G FFVGGNWKCN
Sbjct  20   PEFSGLRRLCPNSNNNNSNSHSQSF----LRFCSPRKPLKSVVAMAGTGTFFVGGNWKCN  75

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTKESI KLVS+LNS+KLE DVDVVVAPPF+YIDQVK++LT+R+EI+AQN W+ KGGAFT
Sbjct  76   GTKESITKLVSDLNSTKLESDVDVVVAPPFVYIDQVKSSLTDRIEIAAQNSWVSKGGAFT  135

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  136  GEISVEQLKDIGCK  149



>gb|ACF85433.1| unknown [Zea mays]
 gb|ACR37699.1| unknown [Zea mays]
 tpg|DAA62483.1| TPA: triosephosphate isomerase [Zea mays]
Length=304

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V  +LRV  S +  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVSELN++ LE DVDVV
Sbjct  30   VPQQLRVGFSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVV  89

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  90   VAPPFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  138



>ref|NP_001130128.1| uncharacterized protein LOC100191222 [Zea mays]
 gb|ACF78263.1| unknown [Zea mays]
Length=304

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V  +LRV  S +  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVSELN++ LE DVDVV
Sbjct  30   VPQQLRVGFSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVV  89

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  90   VAPPFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  138



>ref|XP_011046787.1| PREDICTED: triosephosphate isomerase, chloroplastic [Populus 
euphratica]
Length=317

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P FS LRR  P S + + + +      S LR  S  K  ++VVAMAG+G FFVGGNWKCN
Sbjct  20   PEFSGLRRLCPNSSSSNNSSNSHSQ--SFLRFCSPRKPLKSVVAMAGTGTFFVGGNWKCN  77

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTKESI KLVS+LNS+KLE DVDVVVAPPF+YIDQVK++LT+R+EI+AQN W+ KGGAFT
Sbjct  78   GTKESITKLVSDLNSTKLESDVDVVVAPPFVYIDQVKSSLTDRIEIAAQNSWVSKGGAFT  137

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  138  GEISVEQLKDIGCK  151



>ref|XP_006423593.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
 gb|ESR36833.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
Length=304

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 103/134 (77%), Gaps = 9/134 (7%)
 Frame = +3

Query  117  FSALRRSIPtsltlsttqsffqtVDSRLRV--SSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            FS LRRS PT             V+S LR+  S   +   +VVAMA S KFFVGGNWKCN
Sbjct  12   FSGLRRSSPTQSFSQH-------VNSHLRLFSSRRPRRGSSVVAMASSNKFFVGGNWKCN  64

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTKESI KLVS+LN +KLE DVDVVVAPPF+YIDQVKN+LT+R+EI+AQN W+GKGGAFT
Sbjct  65   GTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQNSWVGKGGAFT  124

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  125  GEISVEQLKDIGCK  138



>ref|XP_008236196.1| PREDICTED: triosephosphate isomerase, chloroplastic [Prunus mume]
Length=318

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNG  293
            ++S LRRS        +   F          SSS K  R +VAMAG+GKFFVGGNWKCNG
Sbjct  20   SYSGLRRSCSKLDHTQSLSLFQHLHSQLRLSSSSRKASRGIVAMAGTGKFFVGGNWKCNG  79

Query  294  TKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTG  473
            TK+SI+KLVS+LNS+KLE DVDVVVAPPFLYIDQVKN+LT+R+EIS QN W+GKGGAFTG
Sbjct  80   TKDSISKLVSDLNSAKLEADVDVVVAPPFLYIDQVKNSLTDRIEISGQNSWVGKGGAFTG  139

Query  474  EISVEQLNDIGC  509
            EISVEQL DIG 
Sbjct  140  EISVEQLKDIGA  151



>sp|Q9M4S8.1|TPIC_FRAAN RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Fragaria 
x ananassa]
 gb|AAF66071.1|AF257322_1 triosephosphate isomerase [Fragaria x ananassa]
Length=314

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 103/132 (78%), Gaps = 5/132 (4%)
 Frame = +3

Query  117  FSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGT  296
            +S LRRS P      ++     ++ S  R     K  RAVVAMAG+GKFFVGGNWKCNGT
Sbjct  22   YSGLRRSCPKLDQSHSSLFQHLSLSSSSR-----KASRAVVAMAGTGKFFVGGNWKCNGT  76

Query  297  KESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGE  476
            K+ I+KLVS+LNS+KLEPDVDVVVAPPFLY+DQVK++LT+R+EIS QN W+ KGGAFTGE
Sbjct  77   KDLISKLVSDLNSAKLEPDVDVVVAPPFLYLDQVKSSLTDRIEISGQNSWVAKGGAFTGE  136

Query  477  ISVEQLNDIGCK  512
            ISVEQL DIG K
Sbjct  137  ISVEQLKDIGRK  148



>ref|XP_003578514.1| PREDICTED: triosephosphate isomerase, chloroplastic [Brachypodium 
distachyon]
Length=302

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            +LR+  S +  + +VAMAGSGKFFVGGNWKCNGTKESI+KL+S+LN++ LE DVDVVVAP
Sbjct  31   QLRLGCSRRRAQRLVAMAGSGKFFVGGNWKCNGTKESISKLISDLNAATLENDVDVVVAP  90

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PF+YIDQVKN+LT+R+E+SAQN WIGKGGAFTGEIS EQL DIGC+
Sbjct  91   PFIYIDQVKNSLTDRIEVSAQNTWIGKGGAFTGEISAEQLVDIGCQ  136



>ref|XP_007201375.1| hypothetical protein PRUPE_ppa007813mg [Prunus persica]
 gb|EMJ02574.1| hypothetical protein PRUPE_ppa007813mg [Prunus persica]
Length=354

 Score =   172 bits (437),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNG  293
            ++S LRRS        +   F          SSS K  R +VAMAG+GKFFVGGNWKCNG
Sbjct  56   SYSGLRRSCSKLDHTQSLSLFQHLHSQLRLSSSSRKASRGIVAMAGTGKFFVGGNWKCNG  115

Query  294  TKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTG  473
            TK+SI+KLVS+LNS+KLE DVDV+VAPPFLYIDQVKN+LT+R+EIS QN W+GKGGAFTG
Sbjct  116  TKDSISKLVSDLNSAKLEADVDVIVAPPFLYIDQVKNSLTDRIEISGQNSWVGKGGAFTG  175

Query  474  EISVEQLNDIGC  509
            EISVEQL DIG 
Sbjct  176  EISVEQLKDIGA  187



>dbj|BAJ98333.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  189  DSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVV  368
            + +LR+  S +  + +VAMAGSGKFFVGGNWKCNGTKESI+KLVS+LN++ LE DVDVVV
Sbjct  29   NHQLRLGCSRRRAQRLVAMAGSGKFFVGGNWKCNGTKESISKLVSDLNAATLESDVDVVV  88

Query  369  APPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            APPF+YIDQVK++LT+R+E+SAQN WIGKGGAFTGEIS EQL DIGC+
Sbjct  89   APPFIYIDQVKSSLTDRIEVSAQNTWIGKGGAFTGEISAEQLVDIGCQ  136



>ref|NP_001131642.1| uncharacterized protein LOC100193000 [Zea mays]
 gb|ACF80147.1| unknown [Zea mays]
Length=298

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V  +LR+  S +    +VAMAGSGKFFVGGNWKCNGTK+SI+KLVSELN++ LE DVDVV
Sbjct  24   VPHQLRIGCSRRRAGRIVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLETDVDVV  83

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  84   VAPPFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  132



>tpg|DAA40632.1| TPA: triosephosphate isomerase [Zea mays]
Length=298

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V  +LR+  S +    +VAMAGSGKFFVGGNWKCNGTK+SI+KLVSELN++ LE DVDVV
Sbjct  24   VPHQLRIGCSRRRAGRIVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLETDVDVV  83

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIGC+
Sbjct  84   VAPPFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQ  132



>ref|XP_009346630.1| PREDICTED: triosephosphate isomerase, chloroplastic [Pyrus x 
bretschneideri]
Length=322

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  KGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQV  398
            K  R VVAMAG+GKFFVGGNWKCNGTK+SI+KLV++LNS+KLEPDVDVVVAPPFLY+DQV
Sbjct  59   KASRGVVAMAGTGKFFVGGNWKCNGTKDSISKLVADLNSAKLEPDVDVVVAPPFLYLDQV  118

Query  399  KNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGC  509
            K++LT+R+E+S QN W+GKGGAFTGEISVEQL DIG 
Sbjct  119  KSSLTDRIELSGQNSWVGKGGAFTGEISVEQLKDIGA  155



>ref|XP_009369018.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=322

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +3

Query  186  VDSRLRVS-SSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDV  362
            + S LR+S SS K  R VVAMAG+GKFFVGGNWKCNGTK+SI KLV++LNS+KLE DVDV
Sbjct  47   LHSHLRLSFSSRKASRGVVAMAGTGKFFVGGNWKCNGTKDSIRKLVADLNSAKLEADVDV  106

Query  363  VVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGC  509
            VVAPPFLY+DQVK++LT+R+E+S QN W+GKGGAFTGEISVEQL DIG 
Sbjct  107  VVAPPFLYLDQVKSSLTDRIELSGQNSWVGKGGAFTGEISVEQLKDIGA  155



>ref|XP_010416860.1| PREDICTED: triosephosphate isomerase, chloroplastic [Camelina 
sativa]
Length=312

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R VVAMAGSGKFFVGGNWKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++
Sbjct  52   RGVVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSS  111

Query  408  LTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            LT+R+EIS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  112  LTDRIEISGQNSWVGKGGAFTGEISVEQLKDLGCK  146



>ref|XP_002462733.1| hypothetical protein SORBIDRAFT_02g031030 [Sorghum bicolor]
 gb|EER99254.1| hypothetical protein SORBIDRAFT_02g031030 [Sorghum bicolor]
Length=304

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            +LR+  S +  + VVAMAGSGKFFVGGNWKCNGTK+SI+KLVSELN++ LE DVDVVVAP
Sbjct  33   QLRIGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLETDVDVVVAP  92

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PF+YIDQVKN+LT R+E+SAQN WIGKGGA+TGEIS EQL DIG +
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGVQ  138



>ref|XP_008799414.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Phoenix 
dactylifera]
Length=309

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  192  SRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVA  371
            S+ R+ S+ +  R VVAMAG+GKFFVGGNWKCNGTK+SI+KLV++LN +K+E DVDVVVA
Sbjct  37   SQRRLFSTRRSPRGVVAMAGTGKFFVGGNWKCNGTKDSISKLVADLNGAKMENDVDVVVA  96

Query  372  PPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PPF+YIDQVKN+LT+ +EISAQNCW+GKGGAFTGEIS EQL D+GC+
Sbjct  97   PPFIYIDQVKNSLTDCIEISAQNCWVGKGGAFTGEISAEQLIDMGCQ  143



>ref|XP_006404556.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
 gb|ESQ46009.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
Length=321

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R VVAMAGSGKFFVGGNWKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++
Sbjct  61   RGVVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSS  120

Query  408  LTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            LT+R+EIS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  121  LTDRIEISGQNSWVGKGGAFTGEISVEQLKDLGCK  155



>ref|XP_006294633.1| hypothetical protein CARUB_v10023671mg [Capsella rubella]
 gb|EOA27531.1| hypothetical protein CARUB_v10023671mg [Capsella rubella]
Length=315

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            VVAMAGSGKFFVGGNWKCNGTK+SIAKL+S+LNS+ LE DVDVVVAPPF+YIDQVK++LT
Sbjct  57   VVAMAGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADVDVVVAPPFVYIDQVKSSLT  116

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +R+EIS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  117  DRIEISGQNSWVGKGGAFTGEISVEQLKDLGCK  149



>ref|XP_010555242.1| PREDICTED: triosephosphate isomerase, chloroplastic [Tarenaya 
hassleriana]
Length=343

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 106/135 (79%), Gaps = 9/135 (7%)
 Frame = +3

Query  114  NFSALRRSIPtsltlsttqsffqtVDSRLRVSSSG--KGCRAVVAMAGSGKFFVGGNWKC  287
             FS LRRS           SF    +S LR+ SS   +  R VVAMAG+GKFFVGGNWKC
Sbjct  50   TFSGLRRS-------DAVVSFVHHSNSSLRLVSSPCRQPPRGVVAMAGTGKFFVGGNWKC  102

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTK+SI KLVS+LN++KLE +VDVVVAPPF+YIDQVK++LT+R+EISAQN W+GKGGAF
Sbjct  103  NGTKDSITKLVSDLNNAKLETNVDVVVAPPFVYIDQVKSSLTDRIEISAQNSWVGKGGAF  162

Query  468  TGEISVEQLNDIGCK  512
            TGEISVEQL D+GCK
Sbjct  163  TGEISVEQLKDMGCK  177



>ref|XP_010526563.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Tarenaya 
hassleriana]
Length=310

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R VVAMAGSGKFFVGGNWKCNGTK+SI KLV++LN++ LE DVDVVVAPPF+YIDQVK++
Sbjct  50   RGVVAMAGSGKFFVGGNWKCNGTKDSITKLVTDLNNATLETDVDVVVAPPFVYIDQVKSS  109

Query  408  LTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            LT+R+EISAQN W+GKGGAFTGEISVEQL DIGC+
Sbjct  110  LTDRIEISAQNSWVGKGGAFTGEISVEQLKDIGCR  144



>emb|CBI37923.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            MAGSGKFFVGGNWKCNGTK+SI+KLVS+LNS+KLE DVDVVVAPPF+Y+DQVKN+LT+R+
Sbjct  1    MAGSGKFFVGGNWKCNGTKDSISKLVSDLNSAKLEADVDVVVAPPFVYLDQVKNSLTDRI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGC  509
            EISAQN W+GKGGAFTGEISVEQL DIGC
Sbjct  61   EISAQNSWVGKGGAFTGEISVEQLKDIGC  89



>ref|XP_010941282.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Elaeis 
guineensis]
Length=307

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = +3

Query  108  TPNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKC  287
             P FS LR +   + +LS+     +    R R+ S+ +    VVAMAG+GKFFVGGNWKC
Sbjct  8    APRFSGLRLACERAPSLSSVLFLHRACFQR-RLFSTPRAPGRVVAMAGTGKFFVGGNWKC  66

Query  288  NGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAF  467
            NGTK+SI+KLV++LN  K+E DVDVVVAPPF+YIDQVKN+LT+R+EISAQNCW+GKGGAF
Sbjct  67   NGTKDSISKLVADLNGGKMESDVDVVVAPPFVYIDQVKNSLTDRIEISAQNCWVGKGGAF  126

Query  468  TGEISVEQLNDIGCK  512
            TGEIS EQL D+GC+
Sbjct  127  TGEISAEQLIDMGCQ  141



>ref|XP_010429012.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Camelina 
sativa]
Length=316

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            VVAMAGSGKFFVGGNWKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++LT
Sbjct  58   VVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLT  117

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +R+E+S QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  118  DRIEVSGQNSWVGKGGAFTGEISVEQLKDLGCK  150



>ref|XP_008788636.1| PREDICTED: triosephosphate isomerase, chloroplastic [Phoenix 
dactylifera]
Length=307

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  186  VDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVV  365
            V S+ R  S+ +  R VVAMAG+GKFFVGGNWKCNGTK+S++KLV++LN +K+E +VDVV
Sbjct  33   VGSQRRFFSTRRAPRGVVAMAGTGKFFVGGNWKCNGTKDSVSKLVADLNDAKMENNVDVV  92

Query  366  VAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            VAPPF+YIDQV N+LT+ ++ISAQNCW+GKGGAFTGEIS EQL D+GCK
Sbjct  93   VAPPFIYIDQVNNSLTDHIDISAQNCWVGKGGAFTGEISAEQLIDMGCK  141



>ref|XP_010935053.1| PREDICTED: triosephosphate isomerase, chloroplastic [Elaeis guineensis]
Length=307

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  192  SRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVA  371
            S+ R  S+ +  R VVAMAG+GKFFVGGNWKCNG K+SI+KLV++LN +K+E DVDV VA
Sbjct  35   SQRRPFSTRRAPRGVVAMAGTGKFFVGGNWKCNGMKDSISKLVADLNDAKMENDVDVAVA  94

Query  372  PPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            PPF+YIDQV N+LT+R++ISAQNCW+GKGGAFTGEIS EQL D+GCK
Sbjct  95   PPFIYIDQVNNSLTDRIDISAQNCWVGKGGAFTGEISAEQLIDMGCK  141



>sp|P46225.1|TPIC_SECCE RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Secale 
cereale]
 emb|CAA83533.1| triosephosphate isomerase [Secale cereale]
 prf||2109226B triosephosphate isomerase
Length=298

 Score =   166 bits (419),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            +VAMAGSGKFFVGGNWKCNGTKESI+KLVS+LN++ LE DVDVVVAPPF+YIDQVK++LT
Sbjct  40   LVAMAGSGKFFVGGNWKCNGTKESISKLVSDLNAATLESDVDVVVAPPFIYIDQVKSSLT  99

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +R+E+SAQN WIGKGGAFTGEIS EQL DIGC+
Sbjct  100  DRIEVSAQNTWIGKGGAFTGEISAEQLVDIGCQ  132



>ref|XP_002880361.1| hypothetical protein ARALYDRAFT_900526 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56620.1| hypothetical protein ARALYDRAFT_900526 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            VVAMAGSGKFFVGGNWKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++LT
Sbjct  56   VVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLT  115

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +R++IS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  116  DRIDISGQNSWVGKGGAFTGEISVEQLKDLGCK  148



>ref|NP_179713.1| triosephosphate isomerase [Arabidopsis thaliana]
 sp|Q9SKP6.1|TPIC_ARATH RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF70259.1|AF247559_1 triosephosphate isomerase [Arabidopsis thaliana]
 gb|AAK55701.1|AF378898_1 At2g21170/F26H11.7 [Arabidopsis thaliana]
 gb|AAD29799.1| putative triosephosphate isomerase [Arabidopsis thaliana]
 gb|AAK96462.1| At2g21170/F26H11.7 [Arabidopsis thaliana]
 gb|AAM65444.1| putative triosephosphate isomerase [Arabidopsis thaliana]
 gb|AEC07131.1| triosephosphate isomerase [Arabidopsis thaliana]
Length=315

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            VVAMAGSGKFFVGGNWKCNGTK+SIAKL+S+LNS+ LE DVDVVV+PPF+YIDQVK++LT
Sbjct  57   VVAMAGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLT  116

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +R++IS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  117  DRIDISGQNSWVGKGGAFTGEISVEQLKDLGCK  149



>ref|XP_009337933.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009337934.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=322

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  KGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQV  398
            K  R VVAMAG+GKFFVGGNWKCNGTK+SI KLV++LNS+KLE DVDVVVAPPFLY+DQV
Sbjct  59   KASRGVVAMAGTGKFFVGGNWKCNGTKDSIRKLVADLNSAKLEADVDVVVAPPFLYLDQV  118

Query  399  KNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGC  509
            K++LT+R+E+S QN W+GKGGAFTGEISVEQL DIG 
Sbjct  119  KSSLTDRIELSGQNSWVGKGGAFTGEISVEQLKDIGA  155



>gb|EMT18057.1| Triosephosphate isomerase, chloroplastic [Aegilops tauschii]
Length=256

 Score =   162 bits (409),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            MAGSGKFFVGGNWKCNGTKESI+KLVS+LN++ LE DVDVVVAPPF+YIDQVK++LT+R+
Sbjct  1    MAGSGKFFVGGNWKCNGTKESISKLVSDLNAATLESDVDVVVAPPFIYIDQVKSSLTDRI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            E+SAQN WIGKGGAFTGEIS EQL DIGC+
Sbjct  61   EVSAQNTWIGKGGAFTGEISAEQLVDIGCQ  90



>pdb|4OHQ|A Chain A, Crystal Structure Of Chloroplast Triose Phosphate Isomerase 
From Arabidopsis Thaliana
 pdb|4OHQ|B Chain B, Crystal Structure Of Chloroplast Triose Phosphate Isomerase 
From Arabidopsis Thaliana
Length=256

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            MAGSGKFFVGGNWKCNGTK+SIAKL+S+LNS+ LE DVDVVV+PPF+YIDQVK++LT+R+
Sbjct  1    MAGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +IS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  61   DISGQNSWVGKGGAFTGEISVEQLKDLGCK  90



>ref|XP_007041929.1| Triosephosphate isomerase isoform 1 [Theobroma cacao]
 gb|EOX97760.1| Triosephosphate isomerase isoform 1 [Theobroma cacao]
Length=395

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 100/134 (75%), Gaps = 10/134 (7%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P FS LRRS P      +       ++S+LR+SSS K CRAV+AMAGSGK         N
Sbjct  9    PQFSGLRRSCPKLDNSQSQSFVQH-INSQLRLSSSPKPCRAVLAMAGSGK---------N  58

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GT ESI KLVS+LNSS LE DVDVVVAPPF+Y+DQVK +LT+R+E+SAQN WIGKGGAFT
Sbjct  59   GTNESITKLVSDLNSSTLESDVDVVVAPPFVYLDQVKASLTDRIEVSAQNSWIGKGGAFT  118

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  119  GEISVEQLKDIGCK  132



>ref|XP_002986327.1| hypothetical protein SELMODRAFT_157971 [Selaginella moellendorffii]
 gb|EFJ12536.1| hypothetical protein SELMODRAFT_157971 [Selaginella moellendorffii]
Length=256

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            MAGSGKFFVGGNWKCNGTKESIAKLVSELNS+KLE DVDVVV+PPF+Y+DQV  +++N +
Sbjct  1    MAGSGKFFVGGNWKCNGTKESIAKLVSELNSAKLESDVDVVVSPPFVYLDQVIGSISNGI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            E+S QN WIGKGGAFTGEIS EQL+DIGCK
Sbjct  61   EVSGQNSWIGKGGAFTGEISAEQLSDIGCK  90



>ref|XP_001763435.1| predicted protein [Physcomitrella patens]
 gb|EDQ71624.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  204  VSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFL  383
            + S GKG R VV M G+GKFFVGGNWKCNGT ESI KLV +LNS+++E DVDVVVAPPFL
Sbjct  1    MQSEGKGHRGVVTMTGAGKFFVGGNWKCNGTTESIKKLVEDLNSAQIEDDVDVVVAPPFL  60

Query  384  YIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            YI QV  +LT+R+E+SAQN W+GKGGAFTGEIS +QL D+G K
Sbjct  61   YISQVVGSLTDRIEVSAQNSWVGKGGAFTGEISADQLVDVGVK  103



>gb|KHG23864.1| Triosephosphate isomerase, chloroplastic [Gossypium arboreum]
Length=298

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 10/134 (7%)
 Frame = +3

Query  111  PNFSALRRSIPtsltlsttqsffqtVDSRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCN  290
            P+F+ LRRS P   +  +       ++S+LR++SS K CRAV AMAGSGK         N
Sbjct  9    PHFNGLRRSSPKLDSSQSQSFLQH-INSQLRLASSRKPCRAVTAMAGSGK---------N  58

Query  291  GTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFT  470
            GTK+SI KLVS+LNS+KLE DVDVVV+PPF+Y+DQV  +LT+R+E+SAQN WIGKGGAFT
Sbjct  59   GTKDSITKLVSDLNSAKLETDVDVVVSPPFVYLDQVTASLTSRIEVSAQNSWIGKGGAFT  118

Query  471  GEISVEQLNDIGCK  512
            GEISVEQL DIGCK
Sbjct  119  GEISVEQLKDIGCK  132



>gb|KDO44199.1| hypothetical protein CISIN_1g024925mg [Citrus sinensis]
Length=260

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            KFFVGGNWKCNGTKESI KLVS+LN +KLE DVDVVVAPPF+YIDQVKN+LT+R+EI+AQ
Sbjct  54   KFFVGGNWKCNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQ  113

Query  438  NCWIGKGGAFTGEISVEQLNDIGCK  512
            N W+GKGGAFTGEISVEQL DIGCK
Sbjct  114  NSWVGKGGAFTGEISVEQLKDIGCK  138



>ref|XP_006487404.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Citrus 
sinensis]
Length=304

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            KFFVGGNWKCNGTKESI KLVS+LN +KLE DVDVVVAPPF+YIDQVKN+LT+R+EI+AQ
Sbjct  54   KFFVGGNWKCNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQ  113

Query  438  NCWIGKGGAFTGEISVEQLNDIGCK  512
            N W+GKGGAFTGEISVEQL DIGCK
Sbjct  114  NSWVGKGGAFTGEISVEQLKDIGCK  138



>ref|XP_001782032.1| predicted protein [Physcomitrella patens]
 gb|EDQ53175.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  204  VSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFL  383
            V S+G G R VV+MAG+GKFFVGGNWKCNGT ESI KLV ELNS  LE  V+VVV+PP+L
Sbjct  6    VQSAGTGSRGVVSMAGTGKFFVGGNWKCNGTTESIKKLVDELNSVMLEEGVEVVVSPPYL  65

Query  384  YIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            YI QV  +L+NR+E++AQN W+GKGGAFTGEIS EQL D G K
Sbjct  66   YISQVLGSLSNRIEVAAQNSWVGKGGAFTGEISAEQLADAGVK  108



>gb|EMS46255.1| Triosephosphate isomerase, chloroplastic [Triticum urartu]
Length=277

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQN  440
            FFVGGNWKCNGTKESI+KLVS+LN++ LE DVDVVVAPPF+YIDQVK++LT R+E+SAQN
Sbjct  28   FFVGGNWKCNGTKESISKLVSDLNAATLESDVDVVVAPPFIYIDQVKSSLTGRIEVSAQN  87

Query  441  CWIGKGGAFTGEISVEQLNDIGCK  512
             WIGKGGAFTGEIS EQL DIGC+
Sbjct  88   TWIGKGGAFTGEISAEQLVDIGCQ  111



>ref|XP_001759539.1| predicted protein [Physcomitrella patens]
 gb|EDQ75451.1| predicted protein [Physcomitrella patens]
Length=256

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            M GSG+FFVGGNWKCNG+  SI +LV+ELNS+ +E DVDVVVAPPFLYI QV  +LT+R+
Sbjct  1    MTGSGRFFVGGNWKCNGSTASIKQLVNELNSASIENDVDVVVAPPFLYIGQVIGSLTDRI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            E+SAQNCW+GKGGAFTGEIS +QL D+G K
Sbjct  61   EVSAQNCWVGKGGAFTGEISADQLVDVGVK  90



>ref|XP_001768780.1| predicted protein [Physcomitrella patens]
 gb|EDQ66333.1| predicted protein [Physcomitrella patens]
Length=257

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            MAG+G+FFVGGNWKCNGT ES+ KLV ELNS+KLE DVD+VV+PP+LYI QV  +LT R+
Sbjct  1    MAGTGRFFVGGNWKCNGTVESLKKLVDELNSAKLEEDVDIVVSPPYLYISQVLGSLTKRI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            E++AQNCW GKGGAFTGEIS +QL D G K
Sbjct  61   EVAAQNCWTGKGGAFTGEISADQLVDGGVK  90



>ref|XP_006404555.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
 gb|ESQ46008.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
Length=319

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R VVAMAGSGKFFVGGNWKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++
Sbjct  61   RGVVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSS  120

Query  408  LTNRVEISAQNCWIGKGGAFT  470
            LT+R+EIS QN W+GKGGAFT
Sbjct  121  LTDRIEISGQNSWVGKGGAFT  141



>ref|XP_010472095.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Camelina 
sativa]
Length=314

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            VVAMAGSGKFFVGGNWKCNGTK+SIAKLVS+LNS+ LE DVDVVV+PPF+YIDQVK++LT
Sbjct  56   VVAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLT  115

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +R+EIS QN W           SVEQL D+GCK
Sbjct  116  DRIEISGQNSWXXXXXXXVSPYSVEQLKDLGCK  148



>ref|XP_002988724.1| hypothetical protein SELMODRAFT_447410 [Selaginella moellendorffii]
 gb|EFJ10235.1| hypothetical protein SELMODRAFT_447410 [Selaginella moellendorffii]
Length=261

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 8/92 (9%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKLEPDV--------DVVVAPPFLYIDQVKNNLTN  416
            FFVGGNWKCNGTKESIAKLVSELNS+KLE DV        DVVV+PPF+Y+DQV  +++N
Sbjct  4    FFVGGNWKCNGTKESIAKLVSELNSAKLESDVGCNSIYFLDVVVSPPFVYLDQVIGSISN  63

Query  417  RVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
             +E+S QN WIGKGGAFTGEIS EQL+DIGCK
Sbjct  64   GIEVSGQNSWIGKGGAFTGEISAEQLSDIGCK  95



>ref|XP_001751243.1| predicted protein [Physcomitrella patens]
 gb|EDQ83560.1| predicted protein [Physcomitrella patens]
Length=256

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            M G+GKFFVGGNWKCNGT ESI KLV ELN  K E  V+VVVAPPFLYI QV  +LT+R+
Sbjct  1    MTGTGKFFVGGNWKCNGTTESIKKLVGELNDGKFEESVEVVVAPPFLYIGQVIGSLTDRI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
             +SAQN W+GKGGAFTGEIS +QL D G K
Sbjct  61   AVSAQNSWVGKGGAFTGEISADQLVDAGVK  90



>ref|XP_006423592.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
 gb|ESR36832.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
Length=246

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  276  NWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQNCWIGK  455
            +++ NGTKESI KLVS+LN +KLE DVDVVVAPPF+YIDQVKN+LT+R+EI+AQN W+GK
Sbjct  2    HFQTNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQNSWVGK  61

Query  456  GGAFTGEISVEQLNDIGCK  512
            GGAFTGEISVEQL DIGCK
Sbjct  62   GGAFTGEISVEQLKDIGCK  80



>ref|NP_001077931.1| triosephosphate isomerase [Arabidopsis thaliana]
 gb|AEC07132.1| triosephosphate isomerase [Arabidopsis thaliana]
Length=306

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 9/93 (10%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            VVAMAGSGK         NGTK+SIAKL+S+LNS+ LE DVDVVV+PPF+YIDQVK++LT
Sbjct  57   VVAMAGSGK---------NGTKDSIAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLT  107

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            +R++IS QN W+GKGGAFTGEISVEQL D+GCK
Sbjct  108  DRIDISGQNSWVGKGGAFTGEISVEQLKDLGCK  140



>dbj|BAE48229.1| triosephosphate isomerase chloroplast type [Chlorella pyrenoidosa]
Length=286

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  198  LRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPP  377
            +R SS  +  R  V M GSG+FF+GGNWKCNGT +S+ +LV ELN+  +   V++VVAP 
Sbjct  17   VRRSSCHRASRCAVVMRGSGRFFIGGNWKCNGTLQSVTQLVDELNAGSVPDSVEIVVAPT  76

Query  378  FLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            F+++D+V+ +L +  +I+AQ+CW+ KGGA+TGE+S E L+D+G
Sbjct  77   FVHLDRVQRSLKSPFQIAAQDCWVSKGGAYTGEVSAEMLHDMG  119



>ref|XP_003056637.1| triosephosphate isomerase [Micromonas pusilla CCMP1545]
 gb|EEH58282.1| triosephosphate isomerase [Micromonas pusilla CCMP1545]
Length=318

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  207  SSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLY  386
            +S G   R V  MAG+GKF VGGNWKCNG   SI +LV +LN  +++ DVDV+VAPP LY
Sbjct  52   ASRGASSRCVATMAGTGKFVVGGNWKCNGNTASITQLVKDLNKGEIDADVDVIVAPPMLY  111

Query  387  IDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLND  500
            + +V++ +  + ++SAQNCW+ +GGAFTGE+S E L D
Sbjct  112  LPKVQSTIDRQFKLSAQNCWVSEGGAFTGEVSAEMLAD  149



>ref|XP_005650184.1| Triosephosphate isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE25640.1| Triosephosphate isomerase [Coccomyxa subellipsoidea C-169]
Length=254

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            M  SG FFVGGNWK NG+K+S++KLV +LNSSK   DVDV+VAP FL++  V +N+  R 
Sbjct  1    MGSSGNFFVGGNWKSNGSKDSVSKLVKDLNSSKFPSDVDVIVAPTFLHLPYVVDNIDPRY  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
            ++SAQNCW+GK GA+TGEI+ EQL D+G +
Sbjct  61   QVSAQNCWVGKAGAYTGEIAPEQLLDLGLQ  90



>gb|AAV65344.1| triosephosphate isomerase plastid isozyme [Prototheca wickerhamii]
Length=209

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  LRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPP  377
            LRV  S    R V   AG+G FFVGGNWK NG+   + KLV ELN+  L  DV+VVVAP 
Sbjct  7    LRVRPSPSAGRRVATAAGTGTFFVGGNWKANGSTAVVEKLVQELNAGILPKDVEVVVAPS  66

Query  378  FLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLND  500
            FLY+DQV+ +L +  +++AQNCW GK GAFTGE++ E L D
Sbjct  67   FLYLDQVQGSLKSSYQVAAQNCWKGKSGAFTGEVTAEMLAD  107



>ref|XP_001422959.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01318.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=266

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R+VV  AG+GKF VGGNWKCNGT ES+  LV ELNS K++ DVDV VAPPF++I +V+  
Sbjct  6    RSVVVNAGTGKFIVGGNWKCNGTAESVKSLVKELNSGKIDADVDVYVAPPFVFIPRVQKE  65

Query  408  LTNR-VEISAQNCWIGKGGAFTGEISVEQLND  500
            L N+   ++AQNCW+  GGAFTGE+S + L D
Sbjct  66   LNNKNYAVAAQNCWVSAGGAFTGEVSADMLAD  97



>ref|XP_001419463.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97756.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=279

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R+VV  AG+GKF VGGNWKCNGT ES+  LV ELNS K++ DVDV VAPPF++I +V+  
Sbjct  19   RSVVVNAGTGKFIVGGNWKCNGTAESVKSLVKELNSGKIDADVDVYVAPPFVFIPRVQKE  78

Query  408  LTNR-VEISAQNCWIGKGGAFTGEISVEQLND  500
            L N+   ++AQNCW+  GGAFTGE+S + L D
Sbjct  79   LNNKNYAVAAQNCWVSAGGAFTGEVSADMLAD  110



>gb|AAU93945.1| triose phosphate isomerase [Helicosporidium sp. ex Simulium jonesi]
Length=252

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGTKES++ LV  L+++KL     VDVVVAP FL++ Q  ++L +RVE+S
Sbjct  4    KFFVGGNWKCNGTKESVSALVKALSAAKLPSADKVDVVVAPTFLHLSQALSSLPSRVEVS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIGCK  512
            AQNCWI  GGAFTGEIS EQ+ D+G K
Sbjct  64   AQNCWIKGGGAFTGEISAEQIVDLGAK  90



>ref|XP_002506262.1| triosephosphate isomerase [Micromonas sp. RCC299]
 gb|ACO67520.1| triosephosphate isomerase [Micromonas sp. RCC299]
Length=315

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R V  MAG+G+F VGGNWKCNG   SI KLV +LN+ ++  DV+V+ APP +Y+ +V++ 
Sbjct  56   RCVATMAGTGRFVVGGNWKCNGNTASIQKLVQDLNAGEITADVEVICAPPMIYLPRVQST  115

Query  408  LTNRVEISAQNCWIGKGGAFTGEISVEQLND  500
            L  + ++SAQNCW+G+GGAFTGE++ E L D
Sbjct  116  LDRKYQLSAQNCWVGEGGAFTGEVAAEMLAD  146



>ref|XP_007510733.1| triosephosphate isomerase [Bathycoccus prasinos]
 emb|CCO18266.1| triosephosphate isomerase [Bathycoccus prasinos]
Length=308

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  213  SGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYID  392
            +G+   ++V   G+GKF VGGNWKCNGT +SI KL + LNS K+  DV+V+ APP +YID
Sbjct  44   NGRRASSLVVCDGTGKFVVGGNWKCNGTIDSIDKLCASLNSGKITADVEVICAPPMVYID  103

Query  393  QVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLND  500
            +V++ L    +I+AQNCW+ KGGAFTGE+S E L D
Sbjct  104  RVQSKLKAPYQIAAQNCWVSKGGAFTGEVSAEMLKD  139



>gb|KIZ03638.1| triosephosphate isomerase (TIM) [Monoraphidium neglectum]
Length=267

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  246  AGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVE  425
            A S KFFVGGNWKCNGT  S+ KLV++LN+ ++  D+DVVVAPPF+YID V+ N+ +  +
Sbjct  13   ASSAKFFVGGNWKCNGTHASVEKLVADLNAGEVPSDIDVVVAPPFIYIDWVRANIKSAYK  72

Query  426  ISAQNCWIGKGGAFTGEISVEQLNDIG  506
            ++AQNCW    GA+TGEIS E L D G
Sbjct  73   VAAQNCWSKPDGAYTGEISAEMLKDAG  99



>gb|KIZ02768.1| triosephosphate isomerase (TIM) [Monoraphidium neglectum]
Length=263

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  246  AGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVE  425
            A S KFFVGGNWKCNGT  S+ KLV++LN+ ++  D+D+VVAPPF+YID V+ N+ +  E
Sbjct  8    ASSAKFFVGGNWKCNGTHASVEKLVADLNAGEVPSDIDIVVAPPFIYIDWVRANIKSAYE  67

Query  426  ISAQNCWIGKGGAFTGEISVEQLND  500
            ++AQNCW    GAFTGEIS E + D
Sbjct  68   VAAQNCWTKPDGAFTGEISAEMIKD  92



>pdb|4MKN|A Chain A, Crystal Structure Of Chloroplastic Triosephosphate Isomerase 
From Chlamydomonas Reinhardtii At 1.1 A Of Resolution
Length=270

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +3

Query  237  VAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT-  413
            V  A S KFFVGGNWKCNG+  ++AKLV ELN+  +   VDVVVAPPF+YID V  +L  
Sbjct  13   VVCASSAKFFVGGNWKCNGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDR  72

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            ++ ++SAQN WIG  GAFTGE+S EQL D G
Sbjct  73   DKYQLSAQNAWIGGNGAFTGEVSAEQLTDFG  103



>ref|XP_001690035.1| triose phosphate isomerase [Chlamydomonas reinhardtii]
 gb|AAV65490.1| chloroplast triosephosphate isomerase [Chlamydomonas reinhardtii]
 gb|EDP09773.1| triose phosphate isomerase [Chlamydomonas reinhardtii]
Length=282

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +3

Query  237  VAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT-  413
            V  A S KFFVGGNWKCNG+  ++AKLV ELN+  +   VDVVVAPPF+YID V  +L  
Sbjct  25   VVCASSAKFFVGGNWKCNGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDR  84

Query  414  NRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            ++ ++SAQN WIG  GAFTGE+S EQL D G
Sbjct  85   DKYQLSAQNAWIGGNGAFTGEVSAEQLTDFG  115



>ref|XP_005846199.1| triosephosphate isomerase chloroplast type [Chlorella variabilis]
 gb|EFN54097.1| triosephosphate isomerase chloroplast type [Chlorella variabilis]
Length=289

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 2/104 (2%)
 Frame = +3

Query  201  RVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEP--DVDVVVAP  374
            R S   +  R  V     G+FF+GGNWKCNGT ES+ +LV +LN+  + P   V++VVAP
Sbjct  19   RCSPGSRSARLNVISRAHGRFFIGGNWKCNGTVESVTQLVKDLNAGSVPPADKVEIVVAP  78

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
             F+++D VK  L    EI AQ+CW+GKGGAFTGE+S E L+D G
Sbjct  79   TFVHLDMVKKTLNPPFEIGAQDCWVGKGGAFTGEVSAEMLHDFG  122



>gb|KDO44198.1| hypothetical protein CISIN_1g024925mg [Citrus sinensis]
Length=241

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 61/85 (72%), Gaps = 19/85 (22%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            KFFVGGNWKCNGTKESI KLVS+LN +KLE DVD                   R+EI+AQ
Sbjct  54   KFFVGGNWKCNGTKESITKLVSDLNDAKLEADVD-------------------RIEIAAQ  94

Query  438  NCWIGKGGAFTGEISVEQLNDIGCK  512
            N W+GKGGAFTGEISVEQL DIGCK
Sbjct  95   NSWVGKGGAFTGEISVEQLKDIGCK  119



>gb|ABE11555.1| cytosolic triosephosphate isomerase [Euglena deses var. intermedia]
Length=255

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDV--VVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT+ESIA L+ + N +  EPD+DV  VVAPPF++ D  K  L    E+S
Sbjct  4    KFFVGGNWKCNGTRESIASLLKDFNGAVGEPDLDVQIVVAPPFVHCDFTKEKLPKGWELS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
             QNCWIGKGGAFTGE+S E + D G
Sbjct  64   VQNCWIGKGGAFTGEVSAEMIKDAG  88



>ref|XP_002955427.1| hypothetical protein VOLCADRAFT_109969 [Volvox carteri f. nagariensis]
 tpg|DAA06180.1| TPA_inf: chloroplast triosephosphate isomerase [Volvox carteri]
 gb|EFJ43498.1| hypothetical protein VOLCADRAFT_109969 [Volvox carteri f. nagariensis]
Length=287

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  216  GKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQ  395
            G+G R  +  A + KFFVGGNWKCNG+  S+ KLV ELNS  +   VD+V APPF+YID 
Sbjct  25   GRG-RLEIVCASNAKFFVGGNWKCNGSVASVRKLVDELNSGSVPRGVDIVCAPPFIYIDY  83

Query  396  VKNNL-TNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            V  +L  ++ +++AQNCWIG  GA+TGE+S EQL D G
Sbjct  84   VMQHLDKDKYQLAAQNCWIGGNGAYTGEVSAEQLQDFG  121



>emb|CEF98905.1| Triosephosphate isomerase [Ostreococcus tauri]
Length=295

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R V   AG+GKF VGGNWKCNGT  S+  LV  LN+ K++ DVDV VAPPF++I +V+  
Sbjct  35   RCVAVNAGTGKFIVGGNWKCNGTAASVKDLVKALNAGKIDADVDVYVAPPFVFIPRVQAE  94

Query  408  L-TNRVEISAQNCWIGKGGAFTGEISVEQLND  500
            L + +  I+AQNCW+ +GGAFTGE+S E L D
Sbjct  95   LNSEKYAIAAQNCWVSEGGAFTGEVSAEMLVD  126



>ref|XP_003080998.1| triose-phosphate isomerase (ISS), partial [Ostreococcus tauri]
Length=313

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R V   AG+GKF VGGNWKCNGT  S+  LV  LN+ K++ DVDV VAPPF++I +V+  
Sbjct  53   RCVAVNAGTGKFIVGGNWKCNGTAASVKDLVKALNAGKIDADVDVYVAPPFVFIPRVQAE  112

Query  408  L-TNRVEISAQNCWIGKGGAFTGEISVEQLND  500
            L + +  I+AQNCW+ +GGAFTGE+S E L D
Sbjct  113  LNSEKYAIAAQNCWVSEGGAFTGEVSAEMLVD  144



>gb|ABH10995.1| plastid triose phosphate isomerase [Polytomella parva]
Length=226

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +3

Query  228  RAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNN  407
            R V A A   KFFVGGNWKCNG   ++  LV +LN  K+  DVDVV APPFL++D V  N
Sbjct  28   RIVSANASKAKFFVGGNWKCNGDSAAVKTLVEDLNKGKVPSDVDVVCAPPFLFLDYVNKN  87

Query  408  L-TNRVEISAQNCWIGKGGAFTGEISVEQL  494
            L  ++  +SAQNCW+GK GA+TGE+S + L
Sbjct  88   LDKSKYAVSAQNCWVGKNGAYTGEVSADML  117



>gb|EYU38446.1| hypothetical protein MIMGU_mgv1a012264mg [Erythranthe guttata]
Length=256

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  E DV+VVV+PPF+++  VK  L +   I+
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAEVPSEDDVEVVVSPPFVFLPIVKTLLRSDFSIA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGEISVE L ++G
Sbjct  64   AQNCWVRKGGAFTGEISVEMLLNLG  88



>gb|AAR04016.1| cytosolic triosephosphate isomerase [Euglena gracilis]
Length=255

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNS--SKLEPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT+ESI+K++ E N   S  + DV+VV+  PF+Y D  +  L     +S
Sbjct  4    KFFVGGNWKCNGTRESISKIIEEFNKGPSVADADVEVVIGCPFVYADYTREKLRQDWALS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
             QNCWIGKGGAFTGEIS E + D G
Sbjct  64   VQNCWIGKGGAFTGEISAEMIKDAG  88



>ref|XP_010685754.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +3

Query  252  SGKFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVE  425
            S +FFVGGNWKCNGT E + KL++ LN +++  E DV+VVV+PPF+++  VKN L     
Sbjct  2    SRRFFVGGNWKCNGTTEEVRKLLTTLNEAEVPSEEDVEVVVSPPFVFLTLVKNLLRTDFH  61

Query  426  ISAQNCWIGKGGAFTGEISVEQLNDIG  506
            ++AQNCW+ KGGAFTGEIS + L ++G
Sbjct  62   VAAQNCWVRKGGAFTGEISADMLVNLG  88



>ref|XP_004144643.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
2 [Cucumis sativus]
 ref|XP_004170198.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
2 [Cucumis sativus]
 gb|KGN54918.1| hypothetical protein Csa_4G598000 [Cucumis sativus]
Length=254

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN +++  E  V+VVV+PPF+++  VK+ L + ++++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_004144642.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
1 [Cucumis sativus]
Length=256

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN +++  E  V+VVV+PPF+++  VK+ L + ++++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_004170197.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
1 [Cucumis sativus]
Length=256

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN +++  E  V+VVV+PPF+++  VK+ L + ++++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_008442057.1| PREDICTED: triosephosphate isomerase, cytosolic [Cucumis melo]
Length=254

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN +++  E  V+VVV+PPF+++  VK+ L + ++++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_001422591.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00908.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=338

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 66/102 (65%), Gaps = 13/102 (13%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLT  413
            V   AG+G+F VGGNWKCNGT+ S+  L+ ELN+ +L  DVDVVVAPPFL++D+    L 
Sbjct  39   VATNAGNGRFIVGGNWKCNGTRASVKTLIEELNAGELR-DVDVVVAPPFLFLDEATETLK  97

Query  414  NRVEISAQNCWIGKG------------GAFTGEISVEQLNDI  503
               E++AQNCW+  G            GAFTGE+S E L D+
Sbjct  98   APYEVAAQNCWVEPGLVDPTHHYDSDTGAFTGEVSAEMLEDL  139



>emb|CDP09059.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+VS LN +++  E DVDVVV+PPF+++  VK+ L     I+
Sbjct  4    KFFVGGNWKCNGTTDEVKKIVSMLNEAEVPSEDDVDVVVSPPFVFLPIVKSLLRPDFSIA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>gb|AIN39806.1| hypothetical protein [Zoysia matrella]
Length=253

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL-EPDV-DVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN +++  PDV +VVV+PP+++I  VK+ L   ++++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKTLNEAQIASPDVVEVVVSPPYVFIPMVKSKLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>gb|ACU17423.1| unknown [Glycine max]
Length=180

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVLGEDVVEVVVSPPFVFLPVVKSLLRPDFHVS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>gb|KCW50197.1| hypothetical protein EUGRSUZ_J00008 [Eucalyptus grandis]
Length=247

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++ P   V+VVV+PPF+++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVATLNDAQVPPQDVVEVVVSPPFIFLPLVKSTLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_011400938.1| Triosephosphate isomerase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM27931.1| Triosephosphate isomerase, chloroplastic [Auxenochlorella protothecoides]
Length=2123

 Score =   107 bits (266),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +3

Query  234   VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSS-KLEPDVDVVVAPPFLYIDQVKNNL  410
             V   AG G FFVGGNWK NG+  S+  LV ELN +  L  +V+VVVAPPF+++DQV+ +L
Sbjct  1273  VATAAGHGTFFVGGNWKANGSTASVNTLVKELNEAGSLPKNVEVVVAPPFIFLDQVQQSL  1332

Query  411   TNRVEISAQNCWIGKGGAFTGEISVEQLND  500
                 +++AQNCW GK GAFTGEI+ E L D
Sbjct  1333  QAPFQLAAQNCWKGKNGAFTGEITAEMLVD  1362



>ref|XP_009587903.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X2 [Nicotiana 
tomentosiformis]
Length=253

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKL-EPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            FFVGGNWKCNGT E + K+VS LN+ ++   DV+VVV+PPF+++  VKN L     ++AQ
Sbjct  5    FFVGGNWKCNGTSEEVKKIVSTLNAGQVPSQDVEVVVSPPFVFLPLVKNELRPDFHVAAQ  64

Query  438  NCWIGKGGAFTGEISVEQLNDI  503
            NCW+ KGGAFTGE+S E L ++
Sbjct  65   NCWVKKGGAFTGEVSAEMLVNL  86



>ref|XP_009793253.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X2 [Nicotiana 
sylvestris]
 gb|AIE16184.1| triosephosphate isomerase [Nicotiana tabacum]
Length=253

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKL-EPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            FFVGGNWKCNGT E + K+VS LN+ ++   DV+VVV+PPF+++  VKN L     ++AQ
Sbjct  5    FFVGGNWKCNGTSEEVKKIVSTLNAGQVPSQDVEVVVSPPFVFLPLVKNELRPDFHVAAQ  64

Query  438  NCWIGKGGAFTGEISVEQLNDI  503
            NCW+ KGGAFTGE+S E L ++
Sbjct  65   NCWVKKGGAFTGEVSAEMLVNL  86



>gb|KCW50198.1| hypothetical protein EUGRSUZ_J00008 [Eucalyptus grandis]
Length=245

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++ P   V+VVV+PPF+++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVATLNDAQVPPQDVVEVVVSPPFIFLPLVKSTLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_010030961.1| PREDICTED: triosephosphate isomerase, cytosolic [Eucalyptus grandis]
 gb|KCW50199.1| hypothetical protein EUGRSUZ_J00008 [Eucalyptus grandis]
Length=254

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++ P   V+VVV+PPF+++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVATLNDAQVPPQDVVEVVVSPPFIFLPLVKSTLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>tpg|DAA53469.1| TPA: triosephosphate isomerase, cytosolic [Zea mays]
Length=309

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++ P   V+VVV+PP++++  VK+ L     ++
Sbjct  60   KFFVGGNWKCNGTTDQVEKIVKTLNEGQVPPSDVVEVVVSPPYVFLPVVKSQLRQEFHVA  119

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  120  AQNCWVKKGGAFTGEVSAEMLVNLG  144



>ref|XP_007150325.1| hypothetical protein PHAVU_005G144100g [Phaseolus vulgaris]
 gb|ESW22319.1| hypothetical protein PHAVU_005G144100g [Phaseolus vulgaris]
Length=253

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF++I  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFIPTVKTLLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>gb|AHA84226.1| triose-phosphate isomerase [Phaseolus vulgaris]
Length=253

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF++I  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFIPTVKTLLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>emb|CAI43251.1| triose-phosphate isomerase [Phaseolus vulgaris var. nanus]
Length=254

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF++I  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFIPTVKTLLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>ref|NP_001132639.1| uncharacterized protein LOC100194114 [Zea mays]
 gb|ACF81567.1| unknown [Zea mays]
Length=250

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN   + P   V+VVV+PP++++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTTDQVEKIVKTLNEGNVPPSDVVEVVVSPPYVFLPVVKSQLRQEFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGEIS E L ++G
Sbjct  64   AQNCWVKKGGAFTGEISAEMLVNLG  88



>gb|ACG24648.1| triosephosphate isomerase, cytosolic [Zea mays]
 gb|ACG48730.1| triosephosphate isomerase, cytosolic [Zea mays]
Length=253

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++ P   V+VVV+PP++++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTTDQVEKIVKTLNEGQVPPSDVVEVVVSPPYVFLPVVKSQLRQEFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>ref|XP_010651015.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X2 [Vitis 
vinifera]
Length=212

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFF+GGNWKCNGT E + K+V+ LN +++  E  V+VVV+PPF+++  VK+ L +  +++
Sbjct  4    KFFIGGNWKCNGTVEEVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRSDFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCWI +GGAFTGEIS E L ++G
Sbjct  64   AQNCWIRRGGAFTGEISAEMLVNLG  88



>ref|NP_001140424.1| triosephosphate isomerase, cytosolic [Zea mays]
 sp|P12863.3|TPIS_MAIZE RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; 
Short=Triose-phosphate isomerase [Zea mays]
 gb|AAB81110.1| triosephosphate isomerase 1 [Zea mays]
 dbj|BAA00009.1| triosephosphate isomerase [Zea mays]
 gb|ACF83804.1| unknown [Zea mays]
 gb|ACG24743.1| triosephosphate isomerase, cytosolic [Zea mays]
 gb|ACG48813.1| triosephosphate isomerase, cytosolic [Zea mays]
 tpg|DAA53470.1| TPA: triosephosphate isomerase, cytosolic [Zea mays]
Length=253

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++ P   V+VVV+PP++++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTTDQVEKIVKTLNEGQVPPSDVVEVVVSPPYVFLPVVKSQLRQEFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>ref|XP_002531441.1| triosephosphate isomerase, putative [Ricinus communis]
 gb|EEF30953.1| triosephosphate isomerase, putative [Ricinus communis]
Length=118

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  D  V+VV++PPF+++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAEVPSDDVVEVVLSPPFVFLPLVKSLLRPDFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLLNL  87



>ref|XP_008810613.1| PREDICTED: triosephosphate isomerase, cytosolic [Phoenix dactylifera]
Length=254

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN  ++     V+VV++PP++++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNDGQVPSSDVVEVVISPPYVFLPLVKSSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGEIS E L ++G
Sbjct  64   AQNCWVKKGGAFTGEISAEMLKNLG  88



>ref|XP_003547334.1| PREDICTED: triosephosphate isomerase, cytosolic [Glycine max]
 gb|KHN33382.1| Triosephosphate isomerase, cytosolic [Glycine soja]
Length=253

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPVVKSLLRPDFHVS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>emb|CAN67342.1| hypothetical protein VITISV_033715 [Vitis vinifera]
Length=250

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  E  V+VVV+PPF+++  VK+ L +  +++
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRSDFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCWI +GGAFTGEIS E L ++G
Sbjct  64   AQNCWIRRGGAFTGEISAEMLVNLG  88



>gb|ABB02628.1| triose phosphate isomerase cytosolic isoform-like [Solanum tuberosum]
Length=254

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEISA  434
            FFVGGNWKCNGT E I K+V+ LN+ ++  +  V+VVV+PPF+++  VKN L +   ++A
Sbjct  5    FFVGGNWKCNGTSEEIKKIVATLNAGQVPSQDVVEVVVSPPFVFLPLVKNELRSDFHVAA  64

Query  435  QNCWIGKGGAFTGEISVEQLNDIG  506
            QNCW+ KGGAFTGE+S + L ++G
Sbjct  65   QNCWVKKGGAFTGEVSADMLVNLG  88



>ref|XP_008784587.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Phoenix 
dactylifera]
Length=254

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K++S LN  ++     V+VV++PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTSEEVKKIISTLNDGQVPASDVVEVVISPPFVFLPLVKSSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGEIS E L +I
Sbjct  64   AQNCWVKKGGAFTGEISAEMLKNI  87



>gb|KHG17172.1| Triosephosphate isomerase, cytosolic [Gossypium arboreum]
Length=254

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL-EPDV-DVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN+ ++  PDV +VVV+PPF+++  VK +L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVNKIVSTLNAGEVPSPDVVEVVVSPPFVFLPLVKTSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_002283671.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X1 [Vitis 
vinifera]
 emb|CBI16125.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFF+GGNWKCNGT E + K+V+ LN +++  E  V+VVV+PPF+++  VK+ L +  +++
Sbjct  4    KFFIGGNWKCNGTVEEVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRSDFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCWI +GGAFTGEIS E L ++G
Sbjct  64   AQNCWIRRGGAFTGEISAEMLVNLG  88



>gb|EMS61639.1| Triosephosphate isomerase, cytosolic [Triticum urartu]
Length=165

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E +  +V+ LN+ ++     V+VVV+PP++++  VK  L   ++++
Sbjct  4    KFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIGC  509
            AQNCW+ KGGAFTGE+S E L ++G 
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGV  89



>gb|ABA86966.1| triosephosphate isomerase [Glycine max]
 gb|ACU23019.1| unknown [Glycine max]
 gb|KHN30170.1| Triosephosphate isomerase, cytosolic [Glycine soja]
Length=253

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPFVKSLLRPDFHVS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>ref|NP_001237472.1| triosephosphate isomerase [Glycine max]
 gb|AAT46998.1| triosephosphate isomerase [Glycine max]
Length=253

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPFVKSLLRPDFHVS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>ref|XP_006593480.1| PREDICTED: triosephosphate isomerase isoform X1 [Glycine max]
Length=248

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPFVKSLLRPDFHVS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L ++G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLG  88



>ref|XP_002283693.1| PREDICTED: triosephosphate isomerase, cytosolic [Vitis vinifera]
 emb|CBI31684.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN+ ++     V+VVV+PPF+++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTGEEVKKIVSTLNAGEVPSGDVVEVVVSPPFVFLPLVKSTLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGEIS E L ++G
Sbjct  64   AQNCWVKKGGAFTGEISAEMLVNLG  88



>emb|CAN70587.1| hypothetical protein VITISV_041523 [Vitis vinifera]
Length=254

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN+ ++     V+VVV+PPF+++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTGEEVKKIVSTLNAGEVPSGDVVEVVVSPPFVFLPLVKSTLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGEIS E L ++G
Sbjct  64   AQNCWVKKGGAFTGEISAEMLVNLG  88



>sp|P46226.3|TPIS_SECCE RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; 
Short=Triose-phosphate isomerase [Secale cereale]
 emb|CAA81487.1| triosephosphate isomerase [Secale cereale]
 prf||2109226A triosephosphate isomerase
Length=253

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL-EPDV-DVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT   +  +V+ LN+ ++  PDV +VVV+PP++++  VK+ L   ++++
Sbjct  4    KFFVGGNWKCNGTVSQVETIVNTLNAGQIASPDVVEVVVSPPYVFLPTVKDKLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>ref|XP_006644990.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Oryza brachyantha]
Length=255

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  E  V+VVV+PPF+++ QVK  L     ++
Sbjct  5    KFFVGGNWKCNGTGEDVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLSQVKGLLRPDFSVA  64

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGEIS E L ++
Sbjct  65   AQNCWVRKGGAFTGEISAEMLVNL  88



>ref|XP_006365701.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Solanum 
tuberosum]
Length=254

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEISA  434
            FFVGGNWKCNGT E I K+V+ LN+ ++  +  V+VVV+PP++++  VKN L +   ++A
Sbjct  5    FFVGGNWKCNGTSEEIKKIVATLNAGQVPSQDVVEVVVSPPYVFLPLVKNELRSDFHVAA  64

Query  435  QNCWIGKGGAFTGEISVEQLNDIG  506
            QNCW+ KGGAFTGE+S + L ++G
Sbjct  65   QNCWVKKGGAFTGEVSADMLVNLG  88



>gb|AAR11379.1| triose phosphate isomerase cytosolic isoform [Solanum chacoense]
Length=254

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEISA  434
            FFVGGNWKCNGT E I K+V+ LN+ ++  +  V+VVV+PP++++  VKN L +   ++A
Sbjct  5    FFVGGNWKCNGTSEEIKKIVATLNAGQVPSQDVVEVVVSPPYVFLPLVKNELRSDFHVAA  64

Query  435  QNCWIGKGGAFTGEISVEQLNDIG  506
            QNCW+ KGGAFTGE+S + L ++G
Sbjct  65   QNCWVKKGGAFTGEVSADMLVNLG  88



>gb|AFL48185.1| triose phosphate isomerase cytosolic isoform-like protein [Capsicum 
annuum]
Length=254

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + I K++S LN+ ++  +  V+VVV+PPF+++  VKN L     ++
Sbjct  4    KFFVGGNWKCNGTSDEIKKIISTLNAGQVPSQDVVEVVVSPPFVFLPLVKNELRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>gb|KJB20069.1| hypothetical protein B456_003G131500 [Gossypium raimondii]
Length=253

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++     V+VVV+PPF+++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAEVPSHDVVEVVVSPPFVFLTLVKSLLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_006846201.1| hypothetical protein AMTR_s00012p00219470 [Amborella trichopoda]
 gb|ERN07876.1| hypothetical protein AMTR_s00012p00219470 [Amborella trichopoda]
Length=254

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN +++  E  V+VVV+PPF+++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVSMLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRPDFLVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGEIS E L ++G
Sbjct  64   AQNCWVRKGGAFTGEISAEMLVNLG  88



>ref|XP_006643754.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Oryza brachyantha]
Length=253

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL-EPDV-DVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++  PDV +VVV+PP++++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTADQVDKIVKTLNEGQVPSPDVVEVVVSPPYVFLPVVKSQLRPEFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIGC  509
            AQNCW+ KGGAFTGE+S E L ++G 
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGV  89



>emb|CAC14917.1| triosephosphat-isomerase [Triticum aestivum]
Length=253

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E +  +V+ LN+ ++     V+VVV+PP++++  VK  L   ++++
Sbjct  4    KFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>ref|XP_009174523.1| hypothetical protein T265_10014 [Opisthorchis viverrini]
 gb|KER21739.1| hypothetical protein T265_10014 [Opisthorchis viverrini]
Length=245

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +3

Query  240  AMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNR  419
            +M  + KFFVGGNWK NG +  I KL+  L+ + L+P+ DV+VAPP LY+  V+  L  R
Sbjct  38   SMENNRKFFVGGNWKMNGNQSEIDKLIKMLSKAHLDPNTDVLVAPPVLYLQSVREKLPRR  97

Query  420  VEISAQNCWIGKGGAFTGEISVEQLNDIGC  509
              ++AQNC+    GAFTGE S   L D+GC
Sbjct  98   FLVAAQNCYKASSGAFTGEHSPAMLKDVGC  127



>ref|XP_009353661.1| PREDICTED: triosephosphate isomerase, cytosolic [Pyrus x bretschneideri]
Length=254

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT   + K+V+ LN +++  E  V+VVV+PPF+++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTTAEVKKIVTTLNEAEVPSEDIVEVVVSPPFVFLSLVKSLLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>gb|ACN33440.1| unknown [Zea mays]
Length=253

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNG  + + K+V  LN  ++ P   V+VVV+PP++++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGITDQVEKIVKTLNEGQVPPSDVVEVVVSPPYVFLPVVKSQLRQEFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>ref|XP_003568647.1| PREDICTED: triosephosphate isomerase, cytosolic [Brachypodium 
distachyon]
Length=253

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++     V+VVV+PP++++  VK+ L   ++++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKVLNEGQIASTDVVEVVVSPPYVFLPIVKSQLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLANLG  88



>ref|XP_002455200.1| hypothetical protein SORBIDRAFT_03g006130 [Sorghum bicolor]
 gb|EES00320.1| hypothetical protein SORBIDRAFT_03g006130 [Sorghum bicolor]
Length=253

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++ P   V+VVV+PP++++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTTDQVEKIVKTLNEGQVPPADVVEVVVSPPYVFLTVVKSLLRPEFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>gb|KDD74205.1| triosephosphate isomerase [Helicosporidium sp. ATCC 50920]
Length=267

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +3

Query  219  KGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQV  398
            +  R +   AG G FFVGGNWK NGT ES+  LV  LN+  +   V+VVVAPP  Y+D+V
Sbjct  5    RASRGMACKAGKGTFFVGGNWKANGTLESVTDLVKGLNAGSIPSTVEVVVAPPAPYLDRV  64

Query  399  KNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDI  503
            + ++   ++++AQNCW    GAFTGE+  E L D+
Sbjct  65   RTSIKAPIQVAAQNCWKQGPGAFTGEVPAEMLADM  99



>emb|CDM81250.1| unnamed protein product [Triticum aestivum]
Length=253

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E +  +V+ LN+ ++     V+VVV+PP++++  VK  L   ++++
Sbjct  4    KFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKAKLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLG  88



>ref|XP_009587902.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X1 [Nicotiana 
tomentosiformis]
Length=254

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEISA  434
            FFVGGNWKCNGT E + K+VS LN+ ++  +  V+VVV+PPF+++  VKN L     ++A
Sbjct  5    FFVGGNWKCNGTSEEVKKIVSTLNAGQVPSQDVVEVVVSPPFVFLPLVKNELRPDFHVAA  64

Query  435  QNCWIGKGGAFTGEISVEQLNDI  503
            QNCW+ KGGAFTGE+S E L ++
Sbjct  65   QNCWVKKGGAFTGEVSAEMLVNL  87



>gb|KHG21991.1| Triosephosphate isomerase, cytosolic [Gossypium arboreum]
Length=253

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++     V+VVV+PPF+++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAEVPSHDVVEVVVSPPFVFLTLVKSLLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            +QNCW+ KGGAFTGE+S E L ++G
Sbjct  64   SQNCWVSKGGAFTGEVSAEMLVNLG  88



>gb|ACU23435.1| unknown [Glycine max]
Length=252

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +K+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPVVKSLLRPDFHVS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGA+TGE+S E L + G
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNSG  88



>gb|AAV65491.1| cytosolic triosephosphate isomerase [Euglena longa]
Length=255

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 2/86 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNS--SKLEPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWK NGT+++I+K+V E N   S  + DV+VV+  PF+Y D  +  L    ++S
Sbjct  4    KFFVGGNWKRNGTRDTISKIVEEFNKGPSVADADVEVVIGVPFVYADFTQEKLRKDWKLS  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIGC  509
             QNCWIGKGGAFTGE+S E + D G 
Sbjct  64   VQNCWIGKGGAFTGEVSAEMIKDAGI  89



>gb|KJB73932.1| hypothetical protein B456_011G261700 [Gossypium raimondii]
Length=254

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN+ ++  +  V+VVV+PPF+++  VK +L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVNKIVSTLNAGEVPSQDVVEVVVSPPFVFLPLVKTSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>sp|P48497.1|TPIS_STELP RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; 
Short=Triose-phosphate isomerase [Stellaria longipes]
 gb|AAB30759.1| triose phosphate isomerase [Stellaria longipes]
Length=257

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT+ES++K+V  LN   +  +  V VVV+PP++++      L + ++++
Sbjct  4    KFFVGGNWKCNGTQESVSKIVDTLNEPTIAANDVVTVVVSPPYVFLPDENAELKHEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S + L ++G
Sbjct  64   AQNCWVKKGGAFTGEVSAQMLANLG  88



>ref|XP_010535492.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Tarenaya 
hassleriana]
Length=253

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  E  V+VVV+PPF+++  VK  L +  +++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAEVPSEDIVEVVVSPPFVFLPLVKGLLRSDFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ +GGAFTGEIS E L ++
Sbjct  64   AQNCWVRRGGAFTGEISAEMLLNL  87



>gb|ACJ11723.1| triosephosphate isomerase [Gossypium hirsutum]
Length=254

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN+ ++  +  V+VVV+PPF+++  VK +L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVNKIVSTLNAGEVPSQDVVEVVVSPPFVFLPLVKTSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|NP_001275435.1| triosphosphate isomerase-like protein [Solanum tuberosum]
 gb|ABA46792.1| triosphosphate isomerase-like protein [Solanum tuberosum]
Length=257

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ L+ +++  E  V+VV++PPF+++  VK  L     I+
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVTTLSEAEVPSEDVVEVVISPPFVFLPLVKTLLRRDFSIA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_009622343.1| PREDICTED: triosephosphate isomerase, cytosolic [Nicotiana tomentosiformis]
Length=254

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ L+ +++  E  V+VV++PPFL++  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVTTLSEAEVPSEDVVEVVISPPFLFLPLVKTLLRPDFSVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_010256927.1| PREDICTED: triosephosphate isomerase, cytosolic [Nelumbo nucifera]
Length=253

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN ++      V+VVV+PPF+++  VK++L +   ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVSTLNEAEAPSGDVVEVVVSPPFVFLPLVKSSLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>dbj|GAA50994.1| triosephosphate isomerase (TIM) [Clonorchis sinensis]
Length=253

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            M  + KFFVGGNWK NG++  I KL+  L+ ++L+P+ DV+VAPP LY+  V+  L  R 
Sbjct  1    MEHNRKFFVGGNWKMNGSQSEIDKLIKMLSKAQLDPNTDVLVAPPVLYLQSVREKLPRRF  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGC  509
             ++AQNC+    GAFTGE S   L D+GC
Sbjct  61   LVAAQNCYKAPSGAFTGEHSPAMLKDVGC  89



>ref|XP_004240361.1| PREDICTED: triosephosphate isomerase, cytosolic [Solanum lycopersicum]
Length=257

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ L+ +++  E  V+VV++PPF+++  VK  L     I+
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVTTLSKAEVPSEDVVEVVISPPFVFLPLVKTLLRRDFSIA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>gb|KDP44954.1| hypothetical protein JCGZ_01454 [Jatropha curcas]
Length=254

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN  ++     V+VV++PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTTEDVKKIVSTLNEGQVPSSDVVEVVISPPFVFLPLVKSSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++ 
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLA  88



>ref|XP_002533147.1| triosephosphate isomerase, putative [Ricinus communis]
 gb|EEF29228.1| triosephosphate isomerase, putative [Ricinus communis]
Length=254

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN   +     V+VV++PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTSEEVKKIVSTLNEGHVPSSDVVEVVISPPFVFLPLVKDSLKPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>gb|AFK44027.1| unknown [Lotus japonicus]
Length=252

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V  LN +K+  E  V+VVV+PPF+++  VK  L +   ++
Sbjct  4    KFFVGGNWKCNGTTEQVKKIVGTLNEAKVPGEDIVEVVVSPPFVFLSFVKALLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGA+TGE+S E L ++
Sbjct  64   AQNCWVHKGGAYTGEVSAEMLVNL  87



>ref|XP_010554607.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Tarenaya 
hassleriana]
Length=254

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PPF+++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVNTLNEAQVPSQDVVEVVVSPPFVFLPAVKSILRPDFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLKNL  87



>ref|XP_008223629.1| PREDICTED: triosephosphate isomerase, cytosolic [Prunus mume]
Length=254

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT   + K+V+ LN +++  E  V+VVV+PPF+++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTTAEVKKIVTTLNEAEVPSEDIVEVVVSPPFVFLAFVKSLLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_007205760.1| hypothetical protein PRUPE_ppa010312mg [Prunus persica]
 gb|EMJ06959.1| hypothetical protein PRUPE_ppa010312mg [Prunus persica]
Length=254

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT   + K+V+ LN +++  E  V+VVV+PPF+++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTTAEVKKIVTTLNEAEVPSEDIVEVVVSPPFVFLAFVKSLLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_010920579.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Elaeis 
guineensis]
Length=254

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            +FFVGGNWKCNGT E + K+VS LN  ++     V+VV++PP++++  VK++L     ++
Sbjct  4    RFFVGGNWKCNGTSEEVKKIVSTLNDGQVPSSDVVEVVISPPYVFLPLVKSSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L +I
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLKNI  87



>gb|ABU96664.1| mitochondrial triosephosphate isomerase/glyceraldehyde-3-phosphate 
dehydrogenase precursor [Dictyota dichotoma]
Length=613

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  192  SRLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVA  371
            +R RV    +G  +  A +   KFFVGGNWKCNG+   + +LV  LN S L    +VVVA
Sbjct  9    TRSRVPGVARGFASSAARSADRKFFVGGNWKCNGSLSKVDELVGVLNGSHLTSKTEVVVA  68

Query  372  PPFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            PP +Y+  V +N+   V+++AQ+CW+   GAFTGE S + L D+G
Sbjct  69   PPSVYLQGVSSNMRGDVKVAAQDCWLKGNGAFTGETSADMLKDMG  113



>ref|XP_011077218.1| PREDICTED: triosephosphate isomerase, cytosolic [Sesamum indicum]
Length=254

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+VS LN++++  +  V+VVV+PPF+++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTTDEVKKIVSMLNAAEVPSQDVVEVVVSPPFVFLPLVKSTLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGA+TGE+S E L ++
Sbjct  64   AQNCWVKKGGAYTGEVSAEMLVNL  87



>gb|AEK69741.1| (S)-tetrahydroprotoberberine oxidase [Corydalis saxicola]
Length=232

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E I K+V+ LN +++     VDVV++PP++++  VK++L     ++
Sbjct  39   KFFVGGNWKCNGTGEEIKKIVATLNQAEVPSADIVDVVLSPPYVFLPLVKSSLRPDFHVA  98

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  99   AQNCWVKKGGAFTGEVSAEMLVNL  122



>emb|CCJ30729.1| unnamed protein product [Pneumocystis jirovecii]
Length=241

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  252  SGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            S +FFVGGN+K NGT ESI +++  LNSS+L+P+VD+V++PP LY+  V+  L + + +S
Sbjct  2    SRRFFVGGNFKANGTIESITRIIEFLNSSELDPNVDIVISPPELYLSYVRKYLRHDIGVS  61

Query  432  AQNCWIGKGGAFTGEISVEQLND  500
            AQN + G  G +TGEISVEQL D
Sbjct  62   AQNVYKGPPGPYTGEISVEQLKD  84



>dbj|GAA50993.1| triosephosphate isomerase (TIM) [Clonorchis sinensis]
Length=229

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            M    KFFVGGNWK NG+K+   KL+  L  +K++P+ +V+VAPP LY+  V+  L  R 
Sbjct  1    MPTDRKFFVGGNWKMNGSKKENDKLIEMLTHAKIDPNTEVLVAPPALYLPSVREKLDKRF  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGC  509
             ++AQNC+    GAFTGE+S   L D+GC
Sbjct  61   HVAAQNCYKVPSGAFTGEVSPAMLKDVGC  89



>ref|XP_010516113.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Camelina 
sativa]
Length=254

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L N   ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRNDFFVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>emb|CDY02937.1| BnaC04g25490D [Brassica napus]
Length=254

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>sp|P48495.1|TPIS_PETHY RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; 
Short=Triose-phosphate isomerase [Petunia x hybrida]
 emb|CAA58230.1| triosephosphate isomerase [Petunia x hybrida]
Length=254

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+++ LN++ +  +  V+VVV+PP++++  VKN L     ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKILATLNAADVPSQDVVEVVVSPPYVFLPLVKNELRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_004307511.1| PREDICTED: triosephosphate isomerase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=253

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL-EPD-VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V+ LN  K+  PD V+VVV+PP++++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTIDEVKKIVNLLNDGKVPSPDCVEVVVSPPYVFLPLVKSTLRPDFQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLKNL  87



>gb|KFH49076.1| Triosephosphate isomerase-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=247

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            KFFVGGN+K NGT  SI ++V+ LN++ L+P+V+VVV+PP +Y+  V++NLT  +E++AQ
Sbjct  4    KFFVGGNFKMNGTVSSIKEIVNNLNNASLDPEVEVVVSPPSIYLHLVRDNLTKNIEVAAQ  63

Query  438  NCWIGKGGAFTGEISVEQLND  500
            N +    GA+TGEISVEQL D
Sbjct  64   NVFYKGNGAYTGEISVEQLKD  84



>ref|XP_009793252.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X1 [Nicotiana 
sylvestris]
Length=254

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +3

Query  261  FFVGGNWKCNGTKESIAKLVSELNSSKL-EPDV-DVVVAPPFLYIDQVKNNLTNRVEISA  434
            FFVGGNWKCNGT E + K+VS LN+ ++   DV +VVV+PPF+++  VKN L     ++A
Sbjct  5    FFVGGNWKCNGTSEEVKKIVSTLNAGQVPSQDVAEVVVSPPFVFLPLVKNELRPDFHVAA  64

Query  435  QNCWIGKGGAFTGEISVEQLNDI  503
            QNCW+ KGGAFTGE+S E L ++
Sbjct  65   QNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_006403458.1| hypothetical protein EUTSA_v10010654mg [Eutrema salsugineum]
 gb|ESQ44911.1| hypothetical protein EUTSA_v10010654mg [Eutrema salsugineum]
Length=254

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>gb|ELT97198.1| hypothetical protein CAPTEDRAFT_172464 [Capitella teleta]
Length=249

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            MA   KFFVGGNWK NG K S+  +VS LN     P+ +VVV+PP  Y+D V+  L  R+
Sbjct  1    MADQRKFFVGGNWKMNGNKASMDVIVSTLNEGGCNPNTEVVVSPPAPYLDYVRQKLDKRI  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGCK  512
             ++AQNC+  + GAFTG+IS + + D+GC+
Sbjct  61   GVAAQNCYKAEKGAFTGDISPQMIKDVGCE  90



>ref|XP_004487007.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Cicer arietinum]
Length=252

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V+ LN +K+  E  V+VVV+PP++++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTTDEVKKIVTTLNEAKVPGEDVVEVVVSPPYVFLPVVKSLLRSDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQL  494
            AQNCW+ KGGA+TGEIS E L
Sbjct  64   AQNCWVRKGGAYTGEISAEML  84



>gb|EMS58952.1| Elicitor-responsive protein 1 [Triticum urartu]
Length=269

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V+ LN +++  E  V+VVV+PPF+++ Q K  L     ++
Sbjct  5    KFFVGGNWKCNGTGDDVKKIVTFLNEAEVPSEDAVEVVVSPPFVFLQQAKGLLRPDFAVA  64

Query  432  AQNCWIGKGGAFTGEISVEQL  494
            AQNCW+ KGGAFTGEIS E L
Sbjct  65   AQNCWVRKGGAFTGEISAEML  85



>ref|XP_002117956.1| hypothetical protein TRIADDRAFT_38509 [Trichoplax adhaerens]
 gb|EDV19524.1| hypothetical protein TRIADDRAFT_38509 [Trichoplax adhaerens]
Length=248

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            KF VGGNWK NG++ESI  ++  L    L    +VVV PPF+Y+  VK NL ++V I+AQ
Sbjct  5    KFIVGGNWKMNGSRESIDGIIQFLKQGPLNESTEVVVGPPFVYLSYVKENLPDKVSIAAQ  64

Query  438  NCWIGKGGAFTGEISVEQLNDIGCK  512
            NC+    GAFTGEIS E   DIGC+
Sbjct  65   NCYYASKGAFTGEISAEMAVDIGCE  89



>ref|XP_007009326.1| Triosephosphate isomerase isoform 2 [Theobroma cacao]
 gb|EOY18136.1| Triosephosphate isomerase isoform 2 [Theobroma cacao]
Length=257

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN  ++  +  V+VV++PPF+++  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEQVKKIVSTLNGGEVPSQDVVEVVISPPFVFLPLVKEALRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_007537109.1| PREDICTED: triosephosphate isomerase isoform X1 [Erinaceus europaeus]
Length=286

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            RLR  +  + C    AMA S KFFVGGNWK NG K ++ +L++ LN++KL  D +VV AP
Sbjct  23   RLRAPADLQ-CAGTTAMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKLPADTEVVCAP  81

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            P  YID  +  L  ++ ++AQNC+    GAFTGEIS   + D G
Sbjct  82   PTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCG  125



>ref|XP_002508897.1| triosephosphate isomerase [Micromonas sp. RCC299]
 gb|ACO70155.1| triosephosphate isomerase [Micromonas sp. RCC299]
Length=317

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 13/103 (13%)
 Frame = +3

Query  234  VVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNL-  410
            VV   G+G+F VGGNWKCNGT  S+A+L   LN+ ++  +VD+VVAPPFLYIDQ    L 
Sbjct  37   VVRNEGTGRFIVGGNWKCNGTIASVAELCEGLNAGEIADNVDIVVAPPFLYIDQAVEALD  96

Query  411  TNRVEISAQNCWI------------GKGGAFTGEISVEQLNDI  503
              R +++AQN W+               GAFTGE+S E L D+
Sbjct  97   AKRFKVAAQNAWVEYTLQDPTHHYDSDTGAFTGEVSAEMLEDL  139



>ref|XP_009774716.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Nicotiana 
sylvestris]
Length=254

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ L+ +++  E  V+VV++PPF+++  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVTTLSEAEVPSEDVVEVVISPPFVFLPLVKTLLRPDFSVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDIG  506
            AQNCW+ KGGAFTGE+S E L ++G
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLG  88



>ref|XP_007009325.1| Triosephosphate isomerase isoform 1 [Theobroma cacao]
 gb|EOY18135.1| Triosephosphate isomerase isoform 1 [Theobroma cacao]
Length=296

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+VS LN  ++  +  V+VV++PPF+++  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEQVKKIVSTLNGGEVPSQDVVEVVISPPFVFLPLVKEALRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_009174526.1| hypothetical protein T265_10017 [Opisthorchis viverrini]
 gb|KER21742.1| hypothetical protein T265_10017 [Opisthorchis viverrini]
Length=252

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  243  MAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRV  422
            M    KFFVGGNWK NG+K+   KL+  L  +K++P+ +V+VAPP LY+  V+  L  R 
Sbjct  1    MPTDRKFFVGGNWKMNGSKKENDKLIEMLTHAKIDPNTEVLVAPPSLYLPSVREKLDKRF  60

Query  423  EISAQNCWIGKGGAFTGEISVEQLNDIGC  509
             ++AQNC+    GAFTGE+S   L D+GC
Sbjct  61   HVAAQNCYKVPSGAFTGEVSPAMLKDVGC  89



>ref|XP_004438751.1| PREDICTED: triosephosphate isomerase [Ceratotherium simum simum]
Length=286

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            RLR  +  + C    AMA S KFFVGGNWK NG K+S+ +L+S LN++KL  D +VV A 
Sbjct  23   RLRADTDLQ-CAGPSAMAPSRKFFVGGNWKMNGRKKSLGELISTLNAAKLPADTEVVCAA  81

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            P  YID  +  L  ++ ++AQNC+    GAFTGEIS   + D G
Sbjct  82   PTAYIDFARQKLDQKIAVAAQNCYKVANGAFTGEISPGMIKDCG  125



>ref|XP_004766701.1| PREDICTED: triosephosphate isomerase [Mustela putorius furo]
 ref|XP_004800893.1| PREDICTED: triosephosphate isomerase [Mustela putorius furo]
Length=286

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            RLR +S  +G     AMA S KFFVGGNWK NG K+++ +L++ LN++K+  D +VV AP
Sbjct  23   RLRAASDLQGV-GTSAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAP  81

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            P  YID  +  L  ++ ++AQNC+    GAFTGEIS   + D G
Sbjct  82   PTAYIDFARQKLDAKIAVAAQNCYKVTNGAFTGEISPGMIKDCG  125



>ref|XP_007644948.1| PREDICTED: triosephosphate isomerase isoform X1 [Cricetulus griseus]
Length=295

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  240  AMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNR  419
            AMA S KFFVGGNWK NGTK+ + +L+  LN++K+  D +VV APP  YID V+  L  +
Sbjct  46   AMAPSRKFFVGGNWKMNGTKKCLGELICTLNAAKVPADTEVVCAPPAAYIDFVRQKLDPK  105

Query  420  VEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            + ++AQNC+    GAFTGEIS   + D+G
Sbjct  106  IAVAAQNCYKVNSGAFTGEISPGMIKDLG  134



>ref|XP_007633208.1| PREDICTED: triosephosphate isomerase isoform X2 [Cricetulus griseus]
Length=295

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  240  AMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNR  419
            AMA S KFFVGGNWK NGTK+ + +L+  LN++K+  D +VV APP  YID V+  L  +
Sbjct  46   AMAPSRKFFVGGNWKMNGTKKCLGELICTLNAAKVPADTEVVCAPPAAYIDFVRQKLDPK  105

Query  420  VEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            + ++AQNC+    GAFTGEIS   + D+G
Sbjct  106  IAVAAQNCYKVNSGAFTGEISPGMIKDLG  134



>ref|XP_008565897.1| PREDICTED: triosephosphate isomerase [Galeopterus variegatus]
Length=285

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  CRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKN  404
            C A   MA S KFFVGGNWK NG K S+ +L+S LN++K+  D +VV APP  YID  + 
Sbjct  31   CPARSTMAPSRKFFVGGNWKMNGRKTSLGELISTLNAAKVPADTEVVCAPPTAYIDFARQ  90

Query  405  NLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
             L +++ ++AQNC+    GAFTGEIS   + D G
Sbjct  91   KLDSKIAVAAQNCYKVTNGAFTGEISPGMIKDCG  124



>gb|AAB63603.1| triosephosphate isomerase, partial [Oryza sativa Japonica Group]
Length=254

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++     V+VVV+PP++++  VK+ L   ++++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>gb|KHJ77640.1| triose-phosphate isomerase, partial [Oesophagostomum dentatum]
Length=156

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            KFFVGGNWK NG+K SI  +   LN S   PDV+VVVAPP  Y+  VK+ L N V++SAQ
Sbjct  4    KFFVGGNWKMNGSKSSIDGICVFLNQSAGVPDVEVVVAPPAPYLTYVKDQLKNSVKVSAQ  63

Query  438  NCWIGKGGAFTGEISVEQLNDIG  506
            NC+    GAFTGE+S E L D+G
Sbjct  64   NCYKVAKGAFTGEVSPEMLKDLG  86



>ref|XP_010531561.1| PREDICTED: triosephosphate isomerase, cytosolic [Tarenaya hassleriana]
Length=254

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPVVKSILRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLKNL  87



>ref|XP_003796519.1| PREDICTED: triosephosphate isomerase, partial [Otolemur garnettii]
Length=278

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  CRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKN  404
            C A   MA S KFFVGGNWK NG K+ + +LVS LN++K+  D +VV APP  YID  + 
Sbjct  32   CVATSTMAPSRKFFVGGNWKMNGRKKCLGELVSTLNAAKVPSDTEVVCAPPTAYIDFTRQ  91

Query  405  NLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
             L  ++ +SAQNC+    GAFTGEIS   + D G
Sbjct  92   KLDPKIAVSAQNCYKVTNGAFTGEISPGMIKDCG  125



>ref|XP_002906178.1| triosephosphate isomerase [Phytophthora infestans T30-4]
 gb|EEY65579.1| triosephosphate isomerase [Phytophthora infestans T30-4]
Length=230

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEP-DVDVVVAPPFLYIDQVKNNLTNRVEISA  434
            K+F+GGNWKCNGT+ S+  LV+ LN + ++P  VDV+VAPP L++DQV+  L   + + A
Sbjct  4    KYFIGGNWKCNGTRSSVHALVAILNKTVVDPSQVDVIVAPPSLHLDQVQRLLQRNIAVCA  63

Query  435  QNCWIGKGGAFTGEISVEQLNDIG  506
            QN  +   GAFTGEI+VEQL D G
Sbjct  64   QNVSLTGLGAFTGEIAVEQLVDYG  87



>gb|EPQ63062.1| Triose phosphate isomerase abundant glycolytic enzyme mRNA half-life 
[Blumeria graminis f. sp. tritici 96224]
Length=247

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            +FFVGGN+K NGTKESI K+++ LN +KL+P  +VV+APP L++   + +L   +E+++Q
Sbjct  4    QFFVGGNFKMNGTKESIKKIIAHLNEAKLDPKTEVVIAPPTLHLQLAREHLRPGLEVASQ  63

Query  438  NCWIGKGGAFTGEISVEQLNDIGCK  512
            N +    GAFTGE+SVEQL D G +
Sbjct  64   NVYDKPNGAFTGEVSVEQLLDAGIQ  88



>ref|XP_007170196.1| PREDICTED: triosephosphate isomerase [Balaenoptera acutorostrata 
scammoni]
Length=286

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = +3

Query  195  RLRVSSSGKGCRAVVAMAGSGKFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAP  374
            RLR +   + C   +AMA S KFFVGGNWK NG K ++ +L++ LN++K+  D +VV AP
Sbjct  23   RLRAAPDLQ-CAGFIAMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAP  81

Query  375  PFLYIDQVKNNLTNRVEISAQNCWIGKGGAFTGEISVEQLNDIG  506
            P ++ID  +  L  ++ ++AQNC+    GAFTGEIS   + D G
Sbjct  82   PTVFIDFARQKLDPKIAVAAQNCYKVANGAFTGEISXXMIKDCG  125



>gb|ADM86861.1| triosephosphate isomerase [Oryza sativa Japonica Group]
 gb|AFI71270.1| triosephosphate isomerase [Oryza sativa Japonica Group]
Length=253

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++     V+VVV+PP++++  VK+ L   ++++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>emb|CCU82480.1| triosephosphate isomerase/triosephosphate isomerase TPI [Blumeria 
graminis f. sp. hordei DH14]
Length=247

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            +FFVGGN+K NGTKESI K+++ LN +KL+P  +VV+APP L++   + +L   +E+++Q
Sbjct  4    QFFVGGNFKMNGTKESIKKIIAHLNEAKLDPKTEVVIAPPTLHLQLAREHLRPGLEVASQ  63

Query  438  NCWIGKGGAFTGEISVEQLNDIGCK  512
            N +    GAFTGE+SVEQL D G +
Sbjct  64   NVYDKPNGAFTGEVSVEQLLDAGIQ  88



>gb|AAK27513.1|AF344331_1 triosephosphate isomerase [Oesophagostomum dentatum]
 gb|AAK27515.1|AF344333_1 triosephosphate isomerase [Oesophagostomum dentatum]
Length=173

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPDVDVVVAPPFLYIDQVKNNLTNRVEISAQ  437
            KFFVGGNWK NG+K SI  +   LN S   PDV+VVVAPP  Y+  VK+ L N V++SAQ
Sbjct  4    KFFVGGNWKMNGSKSSIDGICVFLNQSAGVPDVEVVVAPPAPYLTYVKDQLKNSVKVSAQ  63

Query  438  NCWIGKGGAFTGEISVEQLNDIG  506
            NC+    GAFTGEIS E L D+G
Sbjct  64   NCYKVPKGAFTGEISPEMLKDLG  86



>emb|CDX76095.1| BnaA04g03590D [Brassica napus]
Length=254

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPMVKSILRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|NP_001042016.1| Os01g0147900 [Oryza sativa Japonica Group]
 sp|P48494.3|TPIS_ORYSJ RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; 
Short=Triose-phosphate isomerase [Oryza sativa Japonica Group]
 gb|AAA18541.1| triosephosphate isomerase [Oryza sativa]
 dbj|BAB21144.1| putative triosephosphate isomerase [Oryza sativa Japonica Group]
 dbj|BAB43989.1| putative triosephosphate isomerase [Oryza sativa Japonica Group]
 dbj|BAF03930.1| Os01g0147900 [Oryza sativa Japonica Group]
 gb|EAZ10535.1| hypothetical protein OsJ_00367 [Oryza sativa Japonica Group]
 dbj|BAG87619.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69940.1| hypothetical protein OsI_00389 [Oryza sativa Indica Group]
Length=253

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++     V+VVV+PP++++  VK+ L   ++++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEIQVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|NP_191104.1| triosephosphate isomerase [Arabidopsis thaliana]
 sp|P48491.2|TPIS_ARATH RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; 
Short=Triose-phosphate isomerase [Arabidopsis thaliana]
 gb|AAK53010.1|AF375426_1 AT3g55440/T22E16_100 [Arabidopsis thaliana]
 emb|CAB75902.1| cytosolic triosephosphatisomerase [Arabidopsis thaliana]
 gb|AAL69518.1| AT3g55440/T22E16_100 [Arabidopsis thaliana]
 gb|AEE79384.1| triosephosphate isomerase [Arabidopsis thaliana]
Length=254

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDFFVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>gb|AAA03449.1| cytosolic triose phosphate isomerase [Arabidopsis thaliana]
 prf||2009415A triose phosphate isomerase
Length=254

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDFFVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_010427315.1| PREDICTED: triosephosphate isomerase, cytosolic [Camelina sativa]
Length=254

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKL--EPDVDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT E + K+V+ LN +++  +  V+VVV+PP++++  VK+ L +   ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDFFVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



>ref|XP_008233628.1| PREDICTED: triosephosphate isomerase, cytosolic [Prunus mume]
Length=254

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  258  KFFVGGNWKCNGTKESIAKLVSELNSSKLEPD--VDVVVAPPFLYIDQVKNNLTNRVEIS  431
            KFFVGGNWKCNGT + + K+V  LN  ++ P   V+VVV+PP++++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTFDEVKKIVKILNEGQVPPQDVVEVVVSPPYVFLPVVKSSLRPDFHVA  63

Query  432  AQNCWIGKGGAFTGEISVEQLNDI  503
            AQNCW+ KGGAFTGE+S E L ++
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNL  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115