BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018K13

Length=226
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFW60834.1|  adenosyl homocysteine hydrolase1                      91.3    3e-20   
ref|NP_001078387.1|  adenosylhomocysteinase 1                         91.3    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg           93.2    4e-20   
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2           92.0    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001031628.1|  adenosylhomocysteinase 1                         91.7    7e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15078.1|  unnamed protein product                              92.0    7e-20   Coffea canephora [robusta coffee]
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                    91.7    8e-20   Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like         91.7    8e-20   Brassica rapa
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1              91.7    9e-20   Tarenaya hassleriana [spider flower]
gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase            90.1    9e-20   Allium cepa
emb|CDY58805.1|  BnaC08g46780D                                        91.7    1e-19   Brassica napus [oilseed rape]
emb|CDY50423.1|  BnaCnng19320D                                        91.7    1e-19   Brassica napus [oilseed rape]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg           91.7    1e-19   Capsella rubella
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                  91.7    1e-19   Arabis alpina [alpine rockcress]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1              91.7    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1              91.7    1e-19   Brassica rapa
emb|CDY01177.1|  BnaA04g06420D                                        91.7    1e-19   
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62888.1|  adenosylhomocysteinase                                91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                  91.7    1e-19   Arabis alpina [alpine rockcress]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like           91.7    1e-19   Oryza brachyantha
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193130.1|  adenosylhomocysteinase 1                            91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47309.1|  BnaAnng08830D                                        91.7    1e-19   Brassica napus [oilseed rape]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ACN34730.1|  unknown                                               91.7    1e-19   Zea mays [maize]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516           91.7    1e-19   Arabidopsis lyrata subsp. lyrata
gb|KJB72024.1|  hypothetical protein B456_011G154000                  91.3    1e-19   Gossypium raimondii
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like         91.3    1e-19   Tarenaya hassleriana [spider flower]
gb|AGT16642.1|  Adenosylhomocysteinase                                91.3    1e-19   Saccharum hybrid cultivar R570
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein             91.3    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148534.1|  adenosylhomocysteinase                           91.3    1e-19   
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like           91.3    1e-19   Setaria italica
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...  91.3    1e-19   Catharanthus roseus [chatas]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                    91.3    1e-19   Gossypium hirsutum [American cotton]
gb|KHG17040.1|  Adenosylhomocysteinase                                91.3    1e-19   Gossypium arboreum [tree cotton]
gb|KJB72028.1|  hypothetical protein B456_011G154000                  91.3    1e-19   Gossypium raimondii
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like           90.9    2e-19   Phoenix dactylifera
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                90.9    2e-19   
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like           90.9    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                90.9    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase              90.9    2e-19   
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...  90.9    2e-19   Mesembryanthemum crystallinum
gb|EMS57067.1|  Adenosylhomocysteinase                                90.1    2e-19   Triticum urartu
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...  90.5    2e-19   
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                     90.5    2e-19   Nicotiana benthamiana
ref|NP_001289538.1|  adenosylhomocysteinase                           90.5    2e-19   Nicotiana sylvestris
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                   90.5    2e-19   Nicotiana tabacum [American tobacco]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like           90.5    3e-19   Populus euphratica
emb|CDP11183.1|  unnamed protein product                              90.1    3e-19   Coffea canephora [robusta coffee]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                90.1    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like           90.1    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like           90.1    4e-19   Solanum tuberosum [potatoes]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like           89.7    4e-19   Elaeis guineensis
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like           89.7    4e-19   Nicotiana tomentosiformis
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                    89.7    4e-19   Petunia x hybrida [garden petunia]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like           89.7    4e-19   Nicotiana sylvestris
gb|EMS57266.1|  Adenosylhomocysteinase                                90.9    4e-19   Triticum urartu
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein             89.7    4e-19   Capsicum annuum
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like           89.7    5e-19   Setaria italica
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like           89.7    5e-19   Solanum lycopersicum
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...  89.7    5e-19   Phalaenopsis sp.
ref|XP_002522805.1|  adenosylhomocysteinase, putative                 89.7    5e-19   Ricinus communis
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like           89.7    5e-19   Vitis vinifera
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                   89.7    5e-19   Populus tomentosa [Chinese white poplar]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                    89.7    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KHN12344.1|  Adenosylhomocysteinase                                89.0    5e-19   Glycine soja [wild soybean]
gb|EMT01272.1|  Adenosylhomocysteinase                                89.7    6e-19   
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                89.7    6e-19   Vitis vinifera
ref|XP_010097949.1|  hypothetical protein L484_026840                 89.4    6e-19   Morus notabilis
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                89.4    6e-19   Phoenix dactylifera
gb|KJB37872.1|  hypothetical protein B456_006G223900                  89.0    6e-19   Gossypium raimondii
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg              89.4    7e-19   Erythranthe guttata [common monkey flower]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                      89.4    7e-19   Kalanchoe daigremontiana
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886           89.0    9e-19   Selaginella moellendorffii
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                     89.0    1e-18   Gentiana triflora
gb|KJB37873.1|  hypothetical protein B456_006G223900                  89.0    1e-18   Gossypium raimondii
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like           89.0    1e-18   Elaeis guineensis
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg              89.4    1e-18   Erythranthe guttata [common monkey flower]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                89.0    1e-18   Gossypium arboreum [tree cotton]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A            89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                89.0    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like           89.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                   89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                   89.0    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg           89.0    1e-18   
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                 88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein            88.6    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                88.6    1e-18   Populus euphratica
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like           88.6    1e-18   Glycine max [soybeans]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like           88.6    1e-18   
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AEI54335.1|  adenosylhomocysteinase                                88.6    1e-18   Glycine max [soybeans]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                   88.6    1e-18   Populus tomentosa [Chinese white poplar]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120        88.6    1e-18   Amborella trichopoda
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                   88.6    1e-18   Eucalyptus grandis [rose gum]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                88.6    1e-18   Sesamum indicum [beniseed]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                88.6    1e-18   Eucalyptus grandis [rose gum]
gb|ABR16138.1|  unknown                                               88.6    1e-18   Picea sitchensis
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1              88.6    1e-18   Cucumis melo [Oriental melon]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like           88.6    1e-18   
gb|ABR16573.1|  unknown                                               88.6    1e-18   Picea sitchensis
gb|ABR17322.1|  unknown                                               88.6    1e-18   Picea sitchensis
gb|ABR16547.1|  unknown                                               88.6    2e-18   Picea sitchensis
gb|ACN40278.1|  unknown                                               88.6    2e-18   Picea sitchensis
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                   88.2    2e-18   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g           88.2    2e-18   Phaseolus vulgaris [French bean]
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                   88.6    2e-18   Eucalyptus grandis [rose gum]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                   88.2    2e-18   Populus tomentosa [Chinese white poplar]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg              88.6    2e-18   Erythranthe guttata [common monkey flower]
emb|CDX85127.1|  BnaC07g07790D                                        88.2    2e-18   
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...  88.2    2e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1              88.2    2e-18   Eucalyptus grandis [rose gum]
gb|AGV54286.1|  adenosylhomocysteinase                                88.2    2e-18   Phaseolus vulgaris [French bean]
emb|CDX77483.1|  BnaA07g06210D                                        87.8    2e-18   
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg           87.8    2e-18   Eutrema salsugineum [saltwater cress]
gb|KJB28098.1|  hypothetical protein B456_005G027700                  87.8    2e-18   Gossypium raimondii
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2              87.8    2e-18   Brassica rapa
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                 87.4    2e-18   Citrus sinensis [apfelsine]
dbj|BAH19670.1|  AT4G13940                                            86.3    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    2e-18   Phaseolus vulgaris [French bean]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                       87.8    2e-18   Jatropha curcas
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2      87.8    2e-18   
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like         87.8    3e-18   Brassica rapa
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                87.8    3e-18   Solanum lycopersicum
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...  87.4    3e-18   
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like           87.4    3e-18   Citrus sinensis [apfelsine]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                 87.4    3e-18   Citrus sinensis [apfelsine]
ref|NP_001234012.1|  adenosylhomocysteinase                           87.4    3e-18   
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                 87.4    3e-18   Populus tomentosa [Chinese white poplar]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like           87.4    4e-18   Cicer arietinum [garbanzo]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like           87.4    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                87.4    4e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like           87.4    4e-18   Phoenix dactylifera
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                 87.0    4e-18   Populus tomentosa [Chinese white poplar]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                87.0    4e-18   Malus domestica [apple tree]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg           87.0    4e-18   Prunus persica
gb|ABK25129.1|  unknown                                               87.0    4e-18   Picea sitchensis
gb|ABK24229.1|  unknown                                               87.0    4e-18   Picea sitchensis
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1     87.0    4e-18   Prunus mume [ume]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                87.0    5e-18   Pyrus x bretschneideri [bai li]
ref|XP_003601687.1|  Adenosylhomocysteinase                           87.0    5e-18   Medicago truncatula
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                87.0    5e-18   Malus domestica [apple tree]
ref|XP_006373090.1|  adenosylhomocysteinase family protein            87.0    5e-18   Populus trichocarpa [western balsam poplar]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...  87.0    5e-18   Lupinus luteus
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                   87.0    5e-18   Populus tomentosa [Chinese white poplar]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2     87.0    5e-18   
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...  87.0    5e-18   Medicago sativa [alfalfa]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                     87.0    5e-18   Nicotiana suaveolens
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                   86.7    6e-18   Populus tomentosa [Chinese white poplar]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                  87.0    6e-18   Linum usitatissimum
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg           86.7    7e-18   Citrus clementina [clementine]
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                   86.7    7e-18   Nicotiana tabacum [American tobacco]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...  86.7    7e-18   Lupinus luteus
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                           86.7    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase              86.7    7e-18   
dbj|BAE71233.1|  putative adenosylhomocysteinase                      86.3    9e-18   Trifolium pratense [peavine clover]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like              86.3    9e-18   Solanum tuberosum [potatoes]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                 86.3    1e-17   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                 85.9    1e-17   Populus tomentosa [Chinese white poplar]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like           85.9    1e-17   Cucumis sativus [cucumbers]
ref|XP_003629610.1|  Adenosylhomocysteinase                           85.9    1e-17   Medicago truncatula
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like           85.9    1e-17   Cucumis melo [Oriental melon]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...  85.9    1e-17   
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                  85.9    1e-17   Pinus pinaster [cluster pine]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                 85.9    1e-17   Populus tomentosa [Chinese white poplar]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like           85.5    1e-17   Sesamum indicum [beniseed]
gb|AAM19782.1|  AT3g23810/MYM9_15                                     85.5    2e-17   Arabidopsis thaliana [mouse-ear cress]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...  85.5    2e-17   Petroselinum crispum
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like           85.5    2e-17   Sesamum indicum [beniseed]
ref|NP_189023.1|  adenosylhomocysteinase 2                            85.5    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19538.1|  hypothetical protein B456_003G108500                  85.1    2e-17   Gossypium raimondii
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                85.1    3e-17   Fragaria vesca subsp. vesca
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                   85.1    3e-17   Cucumis sativus [cucumbers]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein           84.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2              84.7    3e-17   Brassica rapa
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                  84.7    3e-17   Arabis alpina [alpine rockcress]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like         84.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2              84.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...  84.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like           84.7    3e-17   Glycine max [soybeans]
emb|CDY50106.1|  BnaC01g43540D                                        84.7    4e-17   Brassica napus [oilseed rape]
emb|CDY53211.1|  BnaC03g74050D                                        84.3    4e-17   Brassica napus [oilseed rape]
ref|XP_001755929.1|  predicted protein                                84.3    4e-17   
ref|XP_001755906.1|  predicted protein                                84.3    4e-17   
ref|XP_001755926.1|  predicted protein                                84.3    4e-17   
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase              84.3    5e-17   Chlorella variabilis
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                     83.2    1e-16   Gentiana triflora
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                83.2    1e-16   Gossypium arboreum [tree cotton]
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                    82.0    3e-16   Polytomella sp. Pringsheim 198.80
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g           82.0    3e-16   Phaseolus vulgaris [French bean]
gb|EPS72602.1|  adenosylhomocysteinase                                82.0    3e-16   Genlisea aurea
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                     81.6    4e-16   Chlamydomonas sp. ICE-L
ref|NP_001265954.1|  adenosylhomocysteinase-like                      80.9    7e-16   Cicer arietinum [garbanzo]
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site  80.5    9e-16   Ostreococcus tauri
ref|XP_010024046.1|  PREDICTED: adenosylhomocysteinase 1-like iso...  80.1    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010024045.1|  PREDICTED: adenosylhomocysteinase 1-like iso...  79.7    2e-15   
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                     79.7    2e-15   Dunaliella salina
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                   79.7    2e-15   Eucalyptus grandis [rose gum]
ref|XP_001419579.1|  predicted protein                                79.7    2e-15   Ostreococcus lucimarinus CCE9901
ref|WP_041515210.1|  hypothetical protein                             73.9    3e-15   
ref|XP_010024042.1|  PREDICTED: adenosylhomocysteinase-like           77.4    1e-14   Eucalyptus grandis [rose gum]
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                   77.0    1e-14   Eucalyptus grandis [rose gum]
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                   75.1    8e-14   Helicosporidium sp. ATCC 50920
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                75.1    8e-14   Coccomyxa subellipsoidea C-169
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                75.1    8e-14   Chlamydomonas reinhardtii
gb|KIZ05177.1|  adenosylhomocysteinase                                75.9    1e-13   Monoraphidium neglectum
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602            74.3    2e-13   Volvox carteri f. nagariensis
ref|NP_001067845.2|  Os11g0455500                                     74.3    2e-13   
ref|XP_011397211.1|  Adenosylhomocysteinase                           73.6    3e-13   Auxenochlorella protothecoides
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                    70.9    5e-13   Chlamydomonas incerta
ref|XP_010024052.1|  PREDICTED: adenosylhomocysteinase 1-like iso...  70.5    3e-12   Eucalyptus grandis [rose gum]
ref|XP_010024051.1|  PREDICTED: adenosylhomocysteinase 1-like iso...  70.1    4e-12   Eucalyptus grandis [rose gum]
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...  70.1    4e-12   Eucalyptus grandis [rose gum]
ref|XP_002505983.1|  adenosylhomocysteinase                           70.1    5e-12   Micromonas commoda
ref|XP_010024044.1|  PREDICTED: adenosylhomocysteinase 1-like iso...  68.6    1e-11   
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                   68.2    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010024043.1|  PREDICTED: adenosylhomocysteinase 1-like iso...  67.8    3e-11   
ref|XP_003057172.1|  adenosylhomocysteinase                           68.2    3e-11   Micromonas pusilla CCMP1545
gb|ABR16332.1|  unknown                                               66.2    1e-10   Picea sitchensis
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                  64.7    4e-10   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase              64.3    7e-10   
ref|XP_005708566.1|  adenosylhomocysteinase                           63.2    1e-09   
ref|WP_026986030.1|  hypothetical protein                             61.2    2e-09   
ref|XP_010024040.1|  PREDICTED: adenosylhomocysteinase-like           62.4    2e-09   
ref|WP_029057724.1|  S-adenosyl-L-homocysteine hydrolase              62.0    3e-09   
ref|XP_001023087.1|  adenosylhomocysteinase family protein            62.0    3e-09   
gb|AAL33588.1|  S-adenosyl-L-homocysteine hydrolase                   60.1    3e-09   
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                   62.0    3e-09   
ref|XP_001423621.1|  hypothetical protein                             62.0    3e-09   
ref|WP_024847056.1|  S-adenosyl-L-homocysteine hydrolase              61.6    4e-09   
ref|WP_008887166.1|  S-adenosyl-L-homocysteine hydrolase              61.6    4e-09   
ref|XP_002177758.1|  adenosylhomocysteinase                           61.6    5e-09   
ref|XP_001756025.1|  predicted protein                                59.7    5e-09   
ref|WP_044229607.1|  adenosylhomocysteinase                           61.6    5e-09   
ref|WP_039843422.1|  S-adenosyl-L-homocysteine hydrolase              60.8    7e-09   
ref|WP_028480610.1|  S-adenosyl-L-homocysteine hydrolase              60.8    7e-09   
ref|XP_009493630.1|  adenosylhomocysteinase 1                         60.8    8e-09   
ref|WP_036635601.1|  S-adenosyl-L-homocysteine hydrolase              60.5    1e-08   
ref|WP_022729531.1|  S-adenosyl-L-homocysteine hydrolase              60.5    1e-08   
ref|WP_009284482.1|  S-adenosyl-L-homocysteine hydrolase              60.5    1e-08   
ref|XP_002784976.1|  adenosylhomocysteinase, putative                 57.8    1e-08   
gb|EJL28004.1|  adenosylhomocysteinase                                60.5    1e-08   
ref|WP_029350387.1|  S-adenosyl-L-homocysteine hydrolase              60.1    1e-08   
ref|XP_004025117.1|  hypothetical protein IMG5_191490                 60.1    1e-08   
ref|WP_034469479.1|  S-adenosyl-L-homocysteine hydrolase              60.1    2e-08   
ref|WP_022728103.1|  S-adenosyl-L-homocysteine hydrolase              59.7    2e-08   
ref|WP_027357796.1|  adenosylhomocysteinase                           59.7    2e-08   
ref|WP_022718432.1|  S-adenosyl-L-homocysteine hydrolase              59.7    2e-08   
ref|WP_044347377.1|  adenosylhomocysteinase                           59.7    2e-08   
ref|WP_027513444.1|  S-adenosyl-L-homocysteine hydrolase              59.3    3e-08   
ref|WP_036503718.1|  S-adenosyl-L-homocysteine hydrolase              59.3    3e-08   
ref|WP_044211631.1|  adenosylhomocysteinase                           58.9    3e-08   
ref|WP_026988234.1|  hypothetical protein                             57.8    3e-08   
ref|WP_018620959.1|  S-adenosyl-L-homocysteine hydrolase              58.9    4e-08   
ref|WP_020087971.1|  S-adenosyl-L-homocysteine hydrolase              58.5    5e-08   
ref|WP_010599929.1|  S-adenosyl-L-homocysteine hydrolase              58.5    5e-08   
ref|XP_002776364.1|  adenosylhomocysteinase, putative                 57.0    5e-08   
gb|AFY99082.1|  S-adenosyl-l-homocysteine hydrolase                   56.2    5e-08   
ref|WP_013654916.1|  S-adenosyl-L-homocysteine hydrolase              58.5    5e-08   
ref|WP_010140568.1|  S-adenosyl-L-homocysteine hydrolase              58.5    5e-08   
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                     58.9    5e-08   
ref|WP_020606693.1|  S-adenosyl-L-homocysteine hydrolase              58.5    6e-08   
ref|XP_002765933.1|  conserved hypothetical protein                   58.5    6e-08   
ref|WP_028980447.1|  adenosylhomocysteinase                           58.2    6e-08   
ref|WP_015028557.1|  S-adenosyl-L-homocysteine hydrolase              58.2    6e-08   
gb|AFY99087.1|  S-adenosyl-l-homocysteine hydrolase                   56.2    6e-08   
gb|KJC50829.1|  S-adenosyl-L-homocysteine hydrolase                   58.5    6e-08   
gb|KJC34300.1|  S-adenosyl-L-homocysteine hydrolase                   58.5    6e-08   
ref|WP_038064175.1|  S-adenosyl-L-homocysteine hydrolase              58.2    6e-08   
ref|WP_026387155.1|  S-adenosyl-L-homocysteine hydrolase              58.5    6e-08   
ref|WP_011995864.1|  S-adenosyl-L-homocysteine hydrolase              58.2    6e-08   
ref|WP_041495401.1|  adenosylhomocysteinase                           58.2    7e-08   
ref|WP_039352085.1|  adenosylhomocysteinase                           58.2    7e-08   
ref|WP_014493887.1|  S-adenosyl-L-homocysteine hydrolase              58.2    7e-08   
ref|WP_012288617.1|  S-adenosyl-L-homocysteine hydrolase              58.2    7e-08   
ref|WP_035707996.1|  S-adenosyl-L-homocysteine hydrolase              58.2    7e-08   
ref|WP_011088685.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  58.2    7e-08   
ref|WP_029909318.1|  S-adenosyl-L-homocysteine hydrolase              58.2    7e-08   
ref|WP_028151995.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
ref|WP_038957545.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
ref|WP_037501611.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
ref|WP_037036486.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
ref|WP_023924304.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
ref|WP_007795805.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
ref|WP_009490432.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
ref|WP_013065796.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
gb|AAA26094.1|  adenosylhomocysteine hydrolase                        58.2    8e-08   
ref|WP_041768851.1|  S-adenosyl-L-homocysteine hydrolase              58.2    8e-08   
gb|EEA95364.1|  adenosylhomocysteinase                                58.2    9e-08   
gb|AEV35160.1|  Adenosylhomocysteinase                                58.2    9e-08   
ref|WP_018643274.1|  S-adenosyl-L-homocysteine hydrolase              57.8    9e-08   
ref|WP_035615531.1|  S-adenosyl-L-homocysteine hydrolase              57.8    9e-08   
ref|XP_001617956.1|  hypothetical protein NEMVEDRAFT_v1g176873        56.6    9e-08   
ref|WP_027564898.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  57.8    9e-08   
ref|WP_019995978.1|  S-adenosyl-L-homocysteine hydrolase              57.8    9e-08   
ref|WP_038034910.1|  S-adenosyl-L-homocysteine hydrolase              57.8    9e-08   
ref|WP_028031618.1|  S-adenosyl-L-homocysteine hydrolase              57.8    9e-08   
ref|WP_004127529.1|  Hypothetical protein                             57.8    1e-07   
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase              57.8    1e-07   
ref|XP_002788757.1|  conserved hypothetical protein                   57.8    1e-07   
ref|WP_015947272.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  57.8    1e-07   
gb|EJY87176.1|  Adenosylhomocysteinase                                57.8    1e-07   
gb|KFB42063.1|  S-adenosyl-L-homocysteine hydrolase                   57.4    1e-07   
ref|WP_023848615.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_025502770.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
gb|KIX21766.1|  adenosylhomocysteinase                                57.4    1e-07   
ref|XP_001849848.1|  adenosyl homocysteinase                          57.4    1e-07   
ref|WP_025583078.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_022998977.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  57.4    1e-07   
ref|WP_006935537.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_014166747.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_029064235.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_013528332.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  57.4    1e-07   
ref|WP_039152387.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_023810629.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_012928825.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_041252454.1|  adenosylhomocysteinase                           57.4    1e-07   
ref|XP_001452222.1|  hypothetical protein                             57.0    1e-07   
ref|XP_008893590.1|  adenosylhomocysteinase                           57.4    1e-07   
ref|WP_037195540.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_037131525.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_027528572.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|XP_001659155.1|  AAEL008341-PA                                    57.4    1e-07   
ref|WP_034481371.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|XP_002669817.1|  predicted protein                                57.4    1e-07   
ref|WP_016556880.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
gb|ACU07022.1|  Adenosylhomocysteinase                                57.4    1e-07   
ref|XP_006676577.1|  hypothetical protein BATDEDRAFT_18898            57.4    1e-07   
ref|WP_019170924.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase              57.4    1e-07   
ref|WP_027377561.1|  adenosylhomocysteinase                           57.0    2e-07   
ref|WP_026869144.1|  adenosylhomocysteinase                           57.0    2e-07   
ref|WP_034510780.1|  S-adenosyl-L-homocysteine hydrolase              57.4    2e-07   
ref|WP_007528758.1|  S-adenosyl-L-homocysteine hydrolase              57.4    2e-07   
ref|WP_035077823.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_028038997.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_007666559.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_023914316.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_020595155.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_028737896.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
emb|CCA20123.1|  unnamed protein product                              57.0    2e-07   
ref|WP_015334371.1|  adenosylhomocysteinase                           57.0    2e-07   
ref|WP_018859427.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_025657914.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_027532053.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_028753826.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_010918146.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_035024933.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  57.0    2e-07   
ref|WP_038380756.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-07   
ref|WP_039343835.1|  adenosylhomocysteinase                           57.0    2e-07   
gb|ETZ21451.1|  S-adenosyl-L-homocysteine hydrolase                   57.0    2e-07   
ref|WP_034852586.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_025145589.1|  adenosylhomocysteinase                           57.0    2e-07   
ref|WP_025609025.1|  adenosylhomocysteinase                           57.0    2e-07   
ref|WP_027566812.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_028137566.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_007601979.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  57.0    2e-07   
ref|WP_028164938.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_027540320.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_038302894.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_004621815.1|  adenosylhomocysteinase                           57.0    2e-07   
gb|EJZ31426.1|  S-adenosyl-L-homocysteine hydrolase                   57.0    2e-07   
ref|WP_015684842.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_028143344.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  57.0    2e-07   
ref|WP_042186348.1|  adenosylhomocysteinase                           57.0    2e-07   
gb|KFB41122.1|  S-adenosyl-L-homocysteine hydrolase                   56.6    2e-07   
ref|WP_015338200.1|  adenosylhomocysteinase                           57.0    2e-07   
ref|WP_027545108.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_009466648.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_027527274.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_008144164.1|  S-adenosyl-L-homocysteine hydrolase              57.0    2e-07   
ref|WP_039480820.1|  adenosylhomocysteinase                           56.6    2e-07   
ref|WP_034716837.1|  adenosylhomocysteinase                           56.6    2e-07   
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                  57.0    2e-07   
ref|WP_008243328.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_021271961.1|  adenosylhomocysteinase                           56.6    2e-07   
ref|WP_016199592.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_009084409.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  56.6    2e-07   
ref|WP_020039523.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
gb|ADX67468.1|  Adenosylhomocysteinase                                56.6    2e-07   
gb|EUA19457.1|  S-adenosyl-L-homocysteine hydrolase family protein    54.3    2e-07   
ref|WP_027576756.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_027554742.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
emb|CCI50303.1|  unnamed protein product                              56.6    2e-07   
ref|WP_008596453.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_027579906.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_017184412.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_021346826.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_036015760.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_009505589.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_025037486.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_029012526.1|  adenosylhomocysteinase                           56.6    2e-07   
gb|EUA07237.1|  S-adenosyl-L-homocysteine hydrolase family protein    53.9    2e-07   
ref|WP_035046017.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_013992718.1|  S-adenosyl-L-homocysteine hydrolase              56.6    2e-07   
ref|WP_028981527.1|  adenosylhomocysteinase                           56.6    3e-07   
ref|WP_038148717.1|  S-adenosyl-L-homocysteine hydrolase              55.8    3e-07   
ref|WP_032130687.1|  adenosylhomocysteinase                           56.6    3e-07   
ref|WP_038237478.1|  adenosylhomocysteinase                           56.6    3e-07   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013           56.6    3e-07   
ref|WP_014245567.1|  S-adenosyl-L-homocysteine hydrolase              56.6    3e-07   
ref|XP_658867.1|  hypothetical protein AN1263.2                       56.6    3e-07   
ref|WP_018182288.1|  S-adenosyl-L-homocysteine hydrolase              56.6    3e-07   
ref|WP_019988939.1|  S-adenosyl-L-homocysteine hydrolase              56.6    3e-07   
ref|WP_022734627.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase              56.6    3e-07   
ref|WP_031528589.1|  adenosylhomocysteinase                           56.2    3e-07   
ref|WP_008834401.1|  S-adenosyl-L-homocysteine hydrolase              56.6    3e-07   
ref|WP_018317406.1|  S-adenosyl-L-homocysteine hydrolase              56.6    3e-07   
ref|WP_026951335.1|  adenosylhomocysteinase                           56.2    3e-07   
emb|CEK09763.1|  Adenosylhomocysteinase                               56.2    3e-07   
ref|WP_027380615.1|  adenosylhomocysteinase                           56.2    3e-07   
ref|WP_015665584.1|  S-adenosyl-L-homocysteine hydrolase              56.6    3e-07   
ref|WP_029282660.1|  adenosylhomocysteinase                           56.2    3e-07   
ref|WP_039685058.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_004672622.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  56.2    3e-07   
ref|WP_034844132.1|  adenosylhomocysteinase                           56.2    3e-07   
ref|WP_039617076.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_007009098.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_041942262.1|  adenosylhomocysteinase                           56.2    3e-07   
ref|WP_016736183.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_027039962.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_012482107.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_011423435.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_021273157.1|  adenosylhomocysteinase                           56.2    3e-07   
gb|KFE33445.1|  S-adenosyl-L-homocysteine hydrolase                   55.8    3e-07   
ref|WP_037102260.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_024271286.1|  S-adenosylhomocysteine hydrolase                 56.2    3e-07   
gb|EEG40705.1|  Adenosylhomocysteinase                                55.5    3e-07   
ref|WP_007813750.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_029556181.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_010542950.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_014682650.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_038685902.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_008972535.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_016843652.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
gb|ETN67623.1|  adenosyl homocysteinase                               53.9    3e-07   
ref|WP_019864392.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_037064537.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   
ref|WP_007798039.1|  S-adenosyl-L-homocysteine hydrolase              56.2    3e-07   



>gb|AFW60834.1| adenosyl homocysteine hydrolase1 [Zea mays]
Length=259

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  108  VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  151



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGP  48



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEV+MPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGP  48



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGP  48



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  5    VEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLEL+LAEVEMPGLMACR EFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGP  48



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGP  48



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGP  48



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGP
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGP  48



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT+SGREYKVKD+SQADFGRLELELAEVEMPGLMACRAEFGP
Sbjct  313  SVEKTASGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGP  357



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTS GREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP
Sbjct  5    VEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGP  48



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLEL+LAEVEMPGLMACR EFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGP  48



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR+E+GP
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGP  48



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
             VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGP
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGP  48



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR+EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGP  48



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  4    SVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+E+GP
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGP  48



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGP
Sbjct  94   VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGP  137



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V+KTSSGREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGP
Sbjct  5    VDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGP  48



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
             VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGP
Sbjct  4    VVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGP  48



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  27   VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  70



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            TVEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGP
Sbjct  4    TVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGP  48



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGP  48



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDM+QADFGRLELELAEVEMPGLM+CR EFGP
Sbjct  67   VEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGP  110



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKTSSGREYKVKD+ QADFGRLELELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGP  48



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAE+GP
Sbjct  5    VEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGP  48



>gb|AGV54286.1| adenosylhomocysteinase [Phaseolus vulgaris]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +V+KTS GREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGP
Sbjct  4    SVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGP  48



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRL LELAEVEMPGLMACR  FGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLGLELAEVEMPGLMACRTGFGP  48



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+ GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAE+GP
Sbjct  5    VEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGP  48



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGP  48



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGP  48



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGP  48



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGP  48



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGP  48



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  6    SVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  50



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V KTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGP
Sbjct  5    VGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGP  48



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQA+FGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGP  48



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGP  48



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGP  48



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGP  48



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGP  48



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGP  48



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGR YKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGP
Sbjct  5    VEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGP  48



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGP
Sbjct  8    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGP  51



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAE EMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGP  48



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGP
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGP  48



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFG LE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGP  48



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKV+DMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V+KT++GREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGP
Sbjct  81   VDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGP  124



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +3

Query  99   KTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            KT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  1    KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  42



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGP  48



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C AEFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGP  48



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            T+ +T +GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    TISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGP  48



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            TVEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++CR EFGP
Sbjct  4    TVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGP  48



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGP  48



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPG M+CR EFGP
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGP  48



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT+SGR YKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP
Sbjct  5    VEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGP  48



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGP  48



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            TVEKT +GREYKV+D+SQADFGRLE+ELAE+EMPGLM+CR EFGP
Sbjct  4    TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGP  48



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGP  48



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGP  48



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  96   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            EKT SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  6    EKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGP  48



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFG  47



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFG  47



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGP  48



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEKT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGP
Sbjct  4    SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGP  48



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFG  47



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGP  48



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            TV +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  4    TVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGP  48



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            +VEK SSGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGP
Sbjct  4    SVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGP  48



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKT++GRE KVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP
Sbjct  5    VEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGP  48



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGP  48



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGP  48



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGP  48



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGP  48



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGP  48



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGP  48



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDM+QADFGRLE+ELAEVEMPGLM+ R EFGP
Sbjct  5    VEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGP  48



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGP  48



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGP
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGP  48



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFG  47



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFG  47



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFG  47



>ref|XP_005843353.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
 gb|EFN51251.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
Length=483

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
             VEK++SGREYKVKDMSQADFGRLE+E+AE EMPGLMACRAEFG
Sbjct  3    VVEKSASGREYKVKDMSQADFGRLEIEMAEAEMPGLMACRAEFG  46



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V+KT++GREYKVKDMSQADFGRLE+ELAEVEMPGLM+ R EFGP
Sbjct  5    VDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGP  48



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            V +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP
Sbjct  5    VSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGP  48



>emb|CBN20774.1| S-Adenosyl homocysteine hydrolase [Polytomella sp. Pringsheim 
198.80]
Length=484

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGP  224
            T+++T+ GREYKVKD+++ADFGRLEL+LAE EMPGLMACR EFGP
Sbjct  4    TIDRTAGGREYKVKDIAEADFGRLELDLAEAEMPGLMACRTEFGP  48



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +3

Query  93   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFG  221
            VEKTSSGREYKVKDMS ADFGR+E+ELAEVEMPGL++CR EFG
Sbjct  5    VEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFG  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570526909590