BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018J09

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001078387.1|  adenosylhomocysteinase 1                           275   6e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                279   2e-88   Brassica rapa
emb|CDY01177.1|  BnaA04g06420D                                          279   2e-88   
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            279   2e-88   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            279   2e-88   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            279   2e-88   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62888.1|  adenosylhomocysteinase                                  279   2e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193130.1|  adenosylhomocysteinase 1                              279   2e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             279   3e-88   Capsella rubella
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    279   3e-88   Arabis alpina [alpine rockcress]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             278   4e-88   Arabidopsis lyrata subsp. lyrata
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      278   4e-88   Brassica oleracea var. alboglabra [Chinese broccoli]
emb|CDY47309.1|  BnaAnng08830D                                          278   7e-88   Brassica napus [oilseed rape]
gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              272   8e-88   Allium cepa
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  277   9e-88   Nelumbo nucifera [Indian lotus]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             277   1e-87   Nelumbo nucifera [Indian lotus]
emb|CDY50423.1|  BnaCnng19320D                                          277   1e-87   Brassica napus [oilseed rape]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       276   2e-87   Gentiana triflora
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       276   2e-87   Nicotiana benthamiana
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             279   2e-87   
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     276   2e-87   Nicotiana tabacum [American tobacco]
ref|NP_001289538.1|  adenosylhomocysteinase                             276   2e-87   Nicotiana sylvestris
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           276   2e-87   Brassica rapa
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                276   3e-87   Tarenaya hassleriana [spider flower]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             276   3e-87   Populus euphratica
emb|CDY58805.1|  BnaC08g46780D                                          276   3e-87   Brassica napus [oilseed rape]
ref|XP_010097949.1|  hypothetical protein L484_026840                   276   3e-87   Morus notabilis
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             276   3e-87   Glycine max [soybeans]
gb|AEI54335.1|  adenosylhomocysteinase                                  276   3e-87   Glycine max [soybeans]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             276   3e-87   
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             276   3e-87   Solanum lycopersicum
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               276   3e-87   Capsicum annuum
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                276   3e-87   Erythranthe guttata [common monkey flower]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             276   3e-87   
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                276   3e-87   Tarenaya hassleriana [spider flower]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     275   3e-87   Eucalyptus grandis [rose gum]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                276   4e-87   Cucumis melo [Oriental melon]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             276   4e-87   Nicotiana sylvestris
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      276   4e-87   Petunia x hybrida [garden petunia]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             276   4e-87   Nicotiana tomentosiformis
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          276   4e-87   Amborella trichopoda
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             276   4e-87   Solanum tuberosum [potatoes]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           276   4e-87   Tarenaya hassleriana [spider flower]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      276   4e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   275   5e-87   Ricinus communis
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             275   5e-87   Vitis vinifera
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             275   5e-87   Phaseolus vulgaris [French bean]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                276   5e-87   
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    275   5e-87   Arabis alpina [alpine rockcress]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  275   6e-87   Eucalyptus grandis [rose gum]
emb|CDP11183.1|  unnamed protein product                                275   7e-87   Coffea canephora [robusta coffee]
emb|CDX85127.1|  BnaC07g07790D                                          275   7e-87   
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             275   8e-87   Pyrus x bretschneideri [bai li]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     275   9e-87   Phaseolus vulgaris [French bean]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              275   9e-87   Populus tomentosa [Chinese white poplar]
dbj|BAH19670.1|  AT4G13940                                              270   9e-87   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  275   1e-86   Malus domestica [apple tree]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  275   1e-86   Solanum lycopersicum
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   273   1e-86   Citrus sinensis [apfelsine]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             275   1e-86   Phoenix dactylifera
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   275   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   274   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   274   1e-86   Populus tomentosa [Chinese white poplar]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             274   1e-86   Prunus persica
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                276   1e-86   Erythranthe guttata [common monkey flower]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   274   1e-86   Populus tomentosa [Chinese white poplar]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  274   1e-86   Sesamum indicum [beniseed]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   274   1e-86   Populus tomentosa [Chinese white poplar]
gb|AGV54286.1|  adenosylhomocysteinase                                  274   1e-86   Phaseolus vulgaris [French bean]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   274   1e-86   Populus tomentosa [Chinese white poplar]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       274   1e-86   Prunus mume [ume]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           274   1e-86   Brassica rapa
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  274   1e-86   Pyrus x bretschneideri [bai li]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    274   1e-86   
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   274   2e-86   Populus tomentosa [Chinese white poplar]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                276   2e-86   Erythranthe guttata [common monkey flower]
gb|ABK25129.1|  unknown                                                 274   2e-86   Picea sitchensis
gb|ABK24229.1|  unknown                                                 274   2e-86   Picea sitchensis
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   274   2e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   274   2e-86   Populus tomentosa [Chinese white poplar]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     274   2e-86   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                274   2e-86   Eucalyptus grandis [rose gum]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    274   2e-86   Mesembryanthemum crystallinum
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  274   2e-86   Vitis vinifera
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  274   3e-86   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB37872.1|  hypothetical protein B456_006G223900                    272   3e-86   Gossypium raimondii
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    273   3e-86   Catharanthus roseus [chatas]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   273   3e-86   Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              273   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             273   3e-86   Citrus sinensis [apfelsine]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     274   3e-86   Eucalyptus grandis [rose gum]
ref|XP_003629610.1|  Adenosylhomocysteinase                             273   3e-86   Medicago truncatula
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     273   3e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     273   4e-86   Populus tomentosa [Chinese white poplar]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   273   4e-86   Citrus sinensis [apfelsine]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  273   4e-86   
gb|KHG17040.1|  Adenosylhomocysteinase                                  273   4e-86   Gossypium arboreum [tree cotton]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     273   4e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     273   4e-86   Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        273   4e-86   Trifolium pratense [peavine clover]
gb|ACN40278.1|  unknown                                                 273   4e-86   Picea sitchensis
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   273   4e-86   Populus tomentosa [Chinese white poplar]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    273   5e-86   Gossypium raimondii
gb|ABR16547.1|  unknown                                                 273   5e-86   Picea sitchensis
gb|ABR16573.1|  unknown                                                 273   5e-86   Picea sitchensis
gb|ABR17322.1|  unknown                                                 273   5e-86   Picea sitchensis
emb|CDX77483.1|  BnaA07g06210D                                          272   5e-86   
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                273   5e-86   Solanum tuberosum [potatoes]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   273   5e-86   Populus tomentosa [Chinese white poplar]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    273   5e-86   Gossypium raimondii
ref|XP_006373090.1|  adenosylhomocysteinase family protein              273   6e-86   Populus trichocarpa [western balsam poplar]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  273   6e-86   Nelumbo nucifera [Indian lotus]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   273   6e-86   Populus tomentosa [Chinese white poplar]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             273   7e-86   Eutrema salsugineum [saltwater cress]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         273   7e-86   Jatropha curcas
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   272   7e-86   Populus tomentosa [Chinese white poplar]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     272   7e-86   Cucumis sativus [cucumbers]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     272   8e-86   Populus tomentosa [Chinese white poplar]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                272   8e-86   Brassica rapa
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        272   8e-86   
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     272   8e-86   Nicotiana tabacum [American tobacco]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             272   9e-86   Citrus clementina [clementine]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   272   9e-86   Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  272   9e-86   Populus euphratica
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  272   9e-86   Malus domestica [apple tree]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   272   9e-86   Populus tomentosa [Chinese white poplar]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       274   9e-86   
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     272   9e-86   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    272   1e-85   Pinus pinaster [cluster pine]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             273   1e-85   
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             272   1e-85   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             272   1e-85   Elaeis guineensis
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     272   1e-85   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   271   1e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     271   1e-85   Populus tomentosa [Chinese white poplar]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    271   1e-85   Lupinus luteus
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   271   2e-85   Populus tomentosa [Chinese white poplar]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    271   2e-85   Lupinus luteus
gb|ABR16138.1|  unknown                                                 271   2e-85   Picea sitchensis
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   271   2e-85   Populus tomentosa [Chinese white poplar]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             271   2e-85   Glycine max [soybeans]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    271   2e-85   Gossypium raimondii
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    271   2e-85   Medicago sativa [alfalfa]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  271   2e-85   Fragaria vesca subsp. vesca
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  271   2e-85   Gossypium arboreum [tree cotton]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     271   3e-85   Populus tomentosa [Chinese white poplar]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             271   3e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     271   3e-85   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-85   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   271   3e-85   Populus tomentosa [Chinese white poplar]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             271   3e-85   Selaginella moellendorffii
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               271   3e-85   Oryza sativa Japonica Group [Japonica rice]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   271   4e-85   Populus tomentosa [Chinese white poplar]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    270   5e-85   Petroselinum crispum
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   270   5e-85   Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     270   5e-85   Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   270   5e-85   Populus tomentosa [Chinese white poplar]
gb|AFW60834.1|  adenosyl homocysteine hydrolase1                        263   6e-85   
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  270   6e-85   Phoenix dactylifera
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     270   7e-85   Populus tomentosa [Chinese white poplar]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    272   8e-85   Linum usitatissimum
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     270   8e-85   Populus tomentosa [Chinese white poplar]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                270   1e-84   Camelina sativa [gold-of-pleasure]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     270   1e-84   Populus tomentosa [Chinese white poplar]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           269   1e-84   Camelina sativa [gold-of-pleasure]
ref|NP_189023.1|  adenosylhomocysteinase 2                              269   1e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       269   1e-84   Arabidopsis thaliana [mouse-ear cress]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    269   1e-84   Phalaenopsis sp.
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             269   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    269   1e-84   Camelina sativa [gold-of-pleasure]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    269   1e-84   Arabis alpina [alpine rockcress]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     269   2e-84   Populus tomentosa [Chinese white poplar]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             269   2e-84   Phoenix dactylifera
gb|EMT01272.1|  Adenosylhomocysteinase                                  269   2e-84   
gb|KJB28098.1|  hypothetical protein B456_005G027700                    268   2e-84   Gossypium raimondii
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             268   3e-84   Sesamum indicum [beniseed]
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             268   3e-84   Sesamum indicum [beniseed]
emb|CDP15078.1|  unnamed protein product                                268   3e-84   Coffea canephora [robusta coffee]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             268   3e-84   Cicer arietinum [garbanzo]
emb|CDY53211.1|  BnaC03g74050D                                          268   4e-84   Brassica napus [oilseed rape]
gb|EPS72602.1|  adenosylhomocysteinase                                  270   5e-84   Genlisea aurea
ref|XP_003601687.1|  Adenosylhomocysteinase                             268   5e-84   Medicago truncatula
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     268   5e-84   Populus tomentosa [Chinese white poplar]
emb|CDY50106.1|  BnaC01g43540D                                          268   7e-84   Brassica napus [oilseed rape]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        267   8e-84   Kalanchoe daigremontiana
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             267   8e-84   Cucumis melo [Oriental melon]
gb|AGT16642.1|  Adenosylhomocysteinase                                  267   1e-83   Saccharum hybrid cultivar R570
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      267   1e-83   Gossypium hirsutum [American cotton]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             267   1e-83   Setaria italica
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             266   1e-83   Setaria italica
ref|NP_001265954.1|  adenosylhomocysteinase-like                        266   1e-83   Cicer arietinum [garbanzo]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             266   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    266   2e-83   
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                266   2e-83   Brassica rapa
ref|XP_001755926.1|  predicted protein                                  266   2e-83   
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       266   2e-83   Gentiana triflora
ref|NP_001234012.1|  adenosylhomocysteinase                             266   2e-83   
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    266   2e-83   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001755906.1|  predicted protein                                  266   2e-83   
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             266   2e-83   Oryza brachyantha
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     266   3e-83   Populus tomentosa [Chinese white poplar]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     265   5e-83   Populus tomentosa [Chinese white poplar]
ref|NP_001148534.1|  adenosylhomocysteinase                             265   5e-83   
gb|ACN34730.1|  unknown                                                 265   6e-83   Zea mays [maize]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       265   6e-83   Nicotiana suaveolens
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  265   8e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             265   9e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             264   2e-82   Elaeis guineensis
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             263   2e-82   Phaseolus vulgaris [French bean]
ref|XP_001755929.1|  predicted protein                                  263   4e-82   
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                262   9e-82   
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             261   2e-81   Cucumis sativus [cucumbers]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    261   2e-81   
gb|KJB19538.1|  hypothetical protein B456_003G108500                    261   2e-81   Gossypium raimondii
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  261   3e-81   Gossypium arboreum [tree cotton]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    252   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001067845.2|  Os11g0455500                                       253   6e-78   
gb|AAL33588.1|  S-adenosyl-L-homocysteine hydrolase                     243   2e-77   Zea mays [maize]
gb|AFY99087.1|  S-adenosyl-l-homocysteine hydrolase                     241   3e-77   Campanula persicifolia [peach-bells]
gb|AFY99082.1|  S-adenosyl-l-homocysteine hydrolase                     239   1e-76   Clermontia kakeana
ref|XP_001756025.1|  predicted protein                                  240   2e-76   
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     245   1e-75   Eucalyptus grandis [rose gum]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                245   3e-75   Chlorella variabilis
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     242   2e-74   Eucalyptus grandis [rose gum]
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                      234   8e-74   Chlamydomonas incerta
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       240   3e-73   Chlamydomonas sp. ICE-L
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       239   3e-73   Dunaliella salina
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      239   6e-73   Polytomella sp. Pringsheim 198.80
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              239   7e-73   Volvox carteri f. nagariensis
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  239   8e-73   Chlamydomonas reinhardtii
ref|XP_011397211.1|  Adenosylhomocysteinase                             237   1e-71   Auxenochlorella protothecoides
gb|ABR16332.1|  unknown                                                 234   4e-71   Picea sitchensis
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  234   5e-71   Coccomyxa subellipsoidea C-169
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     233   2e-70   Helicosporidium sp. ATCC 50920
gb|KIZ05177.1|  adenosylhomocysteinase                                  239   5e-70   Monoraphidium neglectum
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     229   3e-69   Eucalyptus grandis [rose gum]
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     228   6e-69   Eucalyptus grandis [rose gum]
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    227   2e-68   Eucalyptus grandis [rose gum]
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    227   3e-68   Ostreococcus tauri
ref|XP_001419579.1|  predicted protein                                  226   6e-68   Ostreococcus lucimarinus CCE9901
gb|AFY99086.1|  S-adenosyl-l-homocysteine hydrolase                     213   1e-66   Lobelia erinus
dbj|BAA03710.1|  cytokinin binding protein CBP57                        220   6e-66   Nicotiana sylvestris
gb|KJB72029.1|  hypothetical protein B456_011G154000                    219   1e-65   Gossypium raimondii
ref|XP_002505983.1|  adenosylhomocysteinase                             219   2e-65   Micromonas commoda
gb|ABR16616.1|  unknown                                                 218   4e-65   Picea sitchensis
ref|XP_005708566.1|  adenosylhomocysteinase                             218   1e-64   Galdieria sulphuraria
ref|XP_003057172.1|  adenosylhomocysteinase                             217   1e-64   Micromonas pusilla CCMP1545
ref|XP_002776364.1|  adenosylhomocysteinase, putative                   209   5e-64   Perkinsus marinus ATCC 50983
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             212   1e-63   
ref|XP_002784976.1|  adenosylhomocysteinase, putative                   203   3e-63   
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             213   4e-63   
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    211   1e-62   
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   211   2e-62   
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase                211   3e-62   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   211   3e-62   
gb|EKD42945.1|  hypothetical protein ACD_72C00527G0002                  211   3e-62   
ref|XP_002788757.1|  conserved hypothetical protein                     210   7e-62   
ref|WP_027357796.1|  adenosylhomocysteinase                             209   9e-62   
ref|WP_027472887.1|  adenosylhomocysteinase                             209   1e-61   
gb|EPT27008.1|  adenosylhomocysteinase, putative                        212   1e-61   
gb|EPR62066.1|  putative adenosylhomocysteinase                         211   1e-61   
gb|KFH13893.1|  putative adenosylhomocysteinase                         211   1e-61   
gb|ESS32583.1|  putative adenosylhomocysteinase                         211   2e-61   
gb|KFG42936.1|  putative adenosylhomocysteinase                         211   2e-61   
gb|KFG55060.1|  putative adenosylhomocysteinase                         211   2e-61   
emb|CDI83949.1|  adenosylhomocysteinase, putative                       202   2e-61   
ref|WP_027585853.1|  adenosylhomocysteinase                             208   2e-61   
ref|WP_010527565.1|  S-adenosyl-L-homocysteine hydrolase                208   2e-61   
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                208   3e-61   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                209   3e-61   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                210   3e-61   
ref|XP_009493630.1|  adenosylhomocysteinase 1                           208   4e-61   
ref|WP_005221374.1|  S-adenosyl-L-homocysteine hydrolase                207   5e-61   
ref|WP_044107885.1|  adenosylhomocysteinase                             207   9e-61   
ref|WP_007192127.1|  S-adenosyl-L-homocysteine hydrolase                206   1e-60   
ref|XP_002765933.1|  conserved hypothetical protein                     206   2e-60   
ref|WP_010662080.1|  S-adenosyl-L-homocysteine hydrolase                204   7e-60   
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  204   9e-60   
ref|WP_037787267.1|  hypothetical protein                               198   9e-60   
ref|WP_009148000.1|  S-adenosyl-L-homocysteine hydrolase                204   1e-59   
ref|WP_010420190.1|  S-adenosyl-L-homocysteine hydrolase                203   2e-59   
ref|WP_044657025.1|  adenosylhomocysteinase                             198   2e-59   
ref|WP_028062632.1|  hypothetical protein                               204   2e-59   
ref|WP_031147752.1|  adenosylhomocysteinase                             197   2e-59   
ref|WP_014779838.1|  S-adenosyl-L-homocysteine hydrolase                203   2e-59   
ref|WP_044347377.1|  adenosylhomocysteinase                             204   2e-59   
ref|WP_015947272.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    203   2e-59   
ref|WP_030724358.1|  adenosylhomocysteinase                             196   2e-59   
ref|WP_020885533.1|  Adenosylhomocysteinase                             203   3e-59   
ref|WP_028061676.1|  hypothetical protein                               202   4e-59   
ref|WP_030625507.1|  adenosylhomocysteinase                             196   5e-59   
ref|WP_040623224.1|  adenosylhomocysteinase                             196   5e-59   
ref|WP_029018156.1|  hypothetical protein                               201   1e-58   
gb|EST38030.1|  hypothetical protein N566_09650                         192   1e-58   
ref|WP_042432571.1|  adenosylhomocysteinase                             201   2e-58   
ref|WP_030266050.1|  adenosylhomocysteinase                             194   2e-58   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             201   2e-58   
ref|WP_035863223.1|  S-adenosyl-L-homocysteine hydrolase                201   2e-58   
ref|WP_025073697.1|  adenosylhomocysteinase                             201   2e-58   
ref|WP_043914237.1|  S-adenosyl-L-homocysteine hydrolase                201   2e-58   
ref|XP_001423621.1|  hypothetical protein                               201   3e-58   
ref|WP_031065684.1|  adenosylhomocysteinase                             194   3e-58   
ref|WP_028072995.1|  hypothetical protein                               196   3e-58   
ref|WP_006801116.1|  S-adenosyl-L-homocysteine hydrolase                200   4e-58   
ref|WP_030265792.1|  adenosylhomocysteinase                             193   4e-58   
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 200   4e-58   
ref|WP_033354750.1|  hypothetical protein                               200   4e-58   
ref|WP_026387155.1|  S-adenosyl-L-homocysteine hydrolase                200   4e-58   
ref|WP_013257760.1|  S-adenosyl-L-homocysteine hydrolase                200   6e-58   
ref|WP_031067797.1|  adenosylhomocysteinase                             193   6e-58   
ref|WP_020963739.1|  hypothetical protein                               191   6e-58   
ref|WP_026625964.1|  adenosylhomocysteinase                             199   6e-58   
ref|WP_044546567.1|  adenosylhomocysteinase                             197   6e-58   
ref|WP_043962062.1|  adenosylhomocysteinase                             200   7e-58   
ref|WP_007277276.1|  S-adenosyl-L-homocysteine hydrolase                199   7e-58   
ref|WP_020880885.1|  Adenosylhomocysteinase                             199   8e-58   
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             199   9e-58   
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 199   9e-58   
ref|WP_039960509.1|  adenosylhomocysteinase                             194   1e-57   
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                199   1e-57   
ref|WP_031077053.1|  hypothetical protein                               199   1e-57   
ref|XP_002177758.1|  adenosylhomocysteinase                             199   1e-57   
ref|WP_005928473.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    199   1e-57   
ref|WP_007074914.1|  S-adenosyl-L-homocysteine hydrolase                199   1e-57   
ref|WP_030082756.1|  adenosylhomocysteinase                             192   1e-57   
ref|WP_030634534.1|  adenosylhomocysteinase                             191   1e-57   
ref|WP_002558259.1|  adenosylhomocysteinase                             199   1e-57   
ref|XP_008611237.1|  adenosylhomocysteinase                             199   1e-57   
ref|XP_008893590.1|  adenosylhomocysteinase                             199   2e-57   
ref|WP_015531741.1|  adenosylhomocysteinase                             199   2e-57   
ref|WP_007761981.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-57   
gb|EEZ06043.1|  adenosylhomocysteinase                                  198   2e-57   
ref|WP_014440987.1|  S-adenosyl-L-homocysteine hydrolase                199   2e-57   
ref|WP_014136057.1|  S-adenosyl-L-homocysteine hydrolase                199   2e-57   
ref|WP_004317528.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    198   2e-57   
ref|WP_008023149.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-57   
ref|WP_031015910.1|  adenosylhomocysteinase                             195   2e-57   
ref|WP_032839083.1|  adenosylhomocysteinase                             198   2e-57   
ref|WP_022275430.1|  adenosylhomocysteinase                             198   2e-57   
ref|WP_008642653.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-57   
gb|EEX47469.1|  adenosylhomocysteinase                                  198   2e-57   
ref|WP_021645958.1|  adenosylhomocysteinase                             198   2e-57   
ref|WP_037837039.1|  adenosylhomocysteinase                             192   2e-57   
ref|WP_020087971.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-57   
ref|WP_024987950.1|  adenosylhomocysteinase                             198   2e-57   
ref|WP_005781763.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    198   2e-57   
ref|WP_027325990.1|  adenosylhomocysteinase                             198   2e-57   
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase               198   2e-57   
ref|WP_033255593.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-57   
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                198   2e-57   
ref|WP_030623890.1|  adenosylhomocysteinase                             193   2e-57   
ref|WP_030461911.1|  S-adenosyl-L-homocysteine hydrolase                198   3e-57   
ref|WP_041744815.1|  S-adenosyl-L-homocysteine hydrolase                198   3e-57   
ref|WP_030759761.1|  adenosylhomocysteinase                             192   3e-57   
ref|WP_008770078.1|  S-adenosyl-L-homocysteine hydrolase                198   3e-57   
ref|WP_030634444.1|  adenosylhomocysteinase                             191   3e-57   
ref|WP_030119663.1|  adenosylhomocysteinase                             191   3e-57   
gb|ADE53810.1|  adenosylhomocysteinase                                  198   3e-57   
ref|WP_030920540.1|  S-adenosyl-L-homocysteine hydrolase                198   3e-57   
ref|WP_010535621.1|  S-adenosyl-L-homocysteine hydrolase                197   3e-57   
ref|WP_015281066.1|  adenosylhomocysteinase                             197   3e-57   
ref|WP_030310801.1|  hypothetical protein                               198   3e-57   
ref|WP_030998790.1|  adenosylhomocysteinase                             198   3e-57   
ref|WP_029350387.1|  S-adenosyl-L-homocysteine hydrolase                197   3e-57   
ref|WP_007041769.1|  S-adenosyl-L-homocysteine hydrolase                197   3e-57   
gb|EDM21735.1|  adenosylhomocysteinase                                  197   3e-57   
ref|WP_037910293.1|  adenosylhomocysteinase                             198   3e-57   
ref|WP_004296427.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_009000954.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_004302401.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   4e-57   
ref|WP_010801378.1|  MULTISPECIES: adenosylhomocysteinase               197   4e-57   
ref|WP_005681774.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_009860736.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_034469479.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           197   4e-57   
ref|WP_008774364.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
gb|ACJ22539.1|  S-adenosylhomocysteinase                                191   4e-57   
ref|WP_022041363.1|  adenosylhomocysteinase                             197   4e-57   
ref|WP_008765354.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_020506665.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_011108485.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_005860790.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   4e-57   
ref|WP_011966979.1|  S-adenosyl-L-homocysteine hydrolase                197   4e-57   
ref|WP_016268876.1|  adenosylhomocysteinase                             197   5e-57   
ref|WP_009018691.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   5e-57   
ref|WP_031509769.1|  adenosylhomocysteinase                             197   5e-57   
ref|WP_030398087.1|  MULTISPECIES: hypothetical protein                 197   5e-57   
ref|WP_020252885.1|  hypothetical protein                               197   5e-57   
gb|EFI04196.1|  adenosylhomocysteinase                                  197   5e-57   
ref|WP_020275611.1|  putative Adenosylhomocysteinase                    197   5e-57   
ref|WP_032850487.1|  adenosylhomocysteinase                             197   5e-57   
ref|WP_008746056.1|  S-adenosyl-L-homocysteine hydrolase                197   5e-57   
ref|WP_007822968.1|  S-adenosyl-L-homocysteine hydrolase                197   5e-57   
ref|WP_008778787.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   5e-57   
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   5e-57   
ref|WP_009068214.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   5e-57   
ref|WP_030979035.1|  adenosylhomocysteinase                             191   5e-57   
ref|WP_030245490.1|  hypothetical protein                               197   5e-57   
ref|WP_031063941.1|  adenosylhomocysteinase                             190   6e-57   
ref|WP_030572588.1|  adenosylhomocysteinase                             197   6e-57   
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-57   
ref|WP_006134655.1|  S-adenosyl-L-homocysteine hydrolase                190   6e-57   
ref|WP_029904915.1|  adenosylhomocysteinase                             197   6e-57   
ref|WP_007487570.1|  S-adenosyl-L-homocysteine hydrolase                197   6e-57   
ref|WP_013731725.1|  S-adenosyl-L-homocysteine hydrolase                197   7e-57   
ref|WP_024996051.1|  adenosylhomocysteinase                             197   7e-57   
ref|WP_013010732.1|  S-adenosyl-L-homocysteine hydrolase                197   7e-57   
ref|WP_033824956.1|  hypothetical protein                               197   8e-57   
ref|WP_008147078.1|  S-adenosyl-L-homocysteine hydrolase                197   8e-57   
ref|WP_014776017.1|  S-adenosyl-L-homocysteine hydrolase                196   8e-57   
ref|WP_027734715.1|  adenosylhomocysteinase                             197   8e-57   
ref|WP_036658146.1|  adenosylhomocysteinase                             196   8e-57   
ref|WP_005635546.1|  S-adenosyl-L-homocysteine hydrolase                196   8e-57   
ref|WP_017945881.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    197   8e-57   
ref|WP_009717416.1|  S-adenosyl-L-homocysteine hydrolase                197   9e-57   
ref|WP_013445893.1|  S-adenosyl-L-homocysteine hydrolase                196   9e-57   
emb|CDJ69092.1|  adenosylhomocysteinase, putative                       197   9e-57   
gb|KJF43081.1|  adenosylhomocysteinase                                  196   1e-56   
ref|WP_032576381.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_030735559.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_044300351.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-56   
ref|WP_007219288.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-56   
ref|WP_009598720.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    196   1e-56   
ref|WP_025831901.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_026367128.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_022209421.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_043108500.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_037797604.1|  adenosylhomocysteinase                             190   1e-56   
ref|WP_027721098.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_038380756.1|  S-adenosyl-L-homocysteine hydrolase                189   1e-56   
ref|WP_019435388.1|  S-adenosyl-L-homocysteine hydrolase                196   1e-56   
ref|WP_044117871.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_027290196.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_044263997.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_026206556.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_031147523.1|  adenosylhomocysteinase                             190   1e-56   
ref|WP_030221563.1|  adenosylhomocysteinase                             196   1e-56   
ref|WP_022391602.1|  adenosylhomocysteinase                             196   2e-56   
ref|WP_007661865.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
ref|WP_031519542.1|  adenosylhomocysteinase                             196   2e-56   
ref|WP_027177579.1|  adenosylhomocysteinase                             196   2e-56   
ref|WP_023785461.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
ref|WP_009132416.1|  adenosylhomocysteinase                             196   2e-56   
ref|WP_035257890.1|  adenosylhomocysteinase                             196   2e-56   
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
gb|EEF89974.1|  adenosylhomocysteinase                                  196   2e-56   
ref|WP_023549838.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
ref|WP_030572247.1|  adenosylhomocysteinase                             189   2e-56   
ref|WP_016910634.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           196   2e-56   
ref|WP_019546896.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
emb|CAL34094.1|  putative adenosylhomocysteinase                        196   2e-56   
ref|WP_043752821.1|  adenosylhomocysteinase                             196   2e-56   
ref|WP_028429456.1|  adenosylhomocysteinase                             196   2e-56   
ref|WP_030583134.1|  adenosylhomocysteinase                             189   2e-56   
ref|WP_015852945.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
ref|WP_035848617.1|  hypothetical protein                               196   2e-56   
ref|WP_013169144.1|  S-adenosyl-L-homocysteine hydrolase                195   2e-56   
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                196   2e-56   
ref|WP_022658989.1|  S-adenosyl-L-homocysteine hydrolase                195   2e-56   
ref|WP_006841877.1|  S-adenosyl-L-homocysteine hydrolase                195   2e-56   
ref|WP_037840693.1|  adenosylhomocysteinase                             189   2e-56   
ref|WP_028436987.1|  adenosylhomocysteinase                             196   3e-56   
ref|WP_030716579.1|  adenosylhomocysteinase                             189   3e-56   
ref|WP_014259438.1|  S-adenosyl-L-homocysteine hydrolase                195   3e-56   
ref|WP_011995864.1|  S-adenosyl-L-homocysteine hydrolase                195   3e-56   
gb|EDY66712.2|  adenosylhomocysteinase                                  195   3e-56   



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   275 bits (704),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/151 (97%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/151 (97%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/150 (98%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   278 bits (710),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   272 bits (695),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEV+MPGLMACR EFGPSQPFKGARITGSL MT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGPSQPFKGARITGSLLMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   277 bits (709),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/151 (97%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPG GPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGAGPDLIVDDGGDATLLIHEGVKAE  154



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  108  VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  167

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  168  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  227

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  228  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  257



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/151 (96%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTS GREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP QPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPQQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGTGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   275 bits (703),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   275 bits (703),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPTQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   275 bits (703),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   275 bits (703),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRL LELAEVEMPGLMACR  FGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLGLELAEVEMPGLMACRTGFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 150/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDM+QADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  67   VEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  126

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  127  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  186

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  187  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  216



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGV54286.1| adenosylhomocysteinase [Phaseolus vulgaris]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  94   VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  153

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  154  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  213

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  214  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  243



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAE  154



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/149 (95%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAE  154



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLL+H GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLVHEGVKAE  154



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            TVEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAE+GP+QPFKGARITGSLHMT
Sbjct  5    VEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGPAQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGAGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP QPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPQQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGA+ITGSLHM
Sbjct  6    SVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGAKITGSLHM  65

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  66   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  125

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  126  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  156



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQ+HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GV+AE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVRAE  154



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 150/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            TVEKT +GREYKV+D+SQADFGRLE+ELAE+EMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 150/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            TVEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQA+FGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/149 (96%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAW+GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWEGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGR YKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V+KTSSGREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAALIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKT+ GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAE+GPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGPSQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDW PGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWSPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   272 bits (696),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT++GRE KVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPF GARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFTGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  98   KTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ  277
            KT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQ
Sbjct  1    KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQ  60

Query  278  TAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALD  457
            TAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALD
Sbjct  61   TAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALD  120

Query  458  WGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            WGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  121  WGPGGGPDLIVDDGGDATLLIHEGVKAE  148



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 150/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPLKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPG M+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/149 (95%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  27   VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  86

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  87   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  146

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  147  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  176



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPFKGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDAT LIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATPLIHEGVKAE  154



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKV+DMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  8    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  67

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  68   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  127

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  128  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAE  157



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGR YKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAE  154



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/149 (95%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  274
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  275  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  454
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  455  DWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            DWGPGGGPDLIV+DGGDATLLIH GVKAE
Sbjct  126  DWGPGGGPDLIVNDGGDATLLIHEGVKAE  154



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQ HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQGHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDM+QADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAE  154



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAE  154



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEK SSGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDTTLLIHEGVKAE  154



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDL VDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLTVDDGGDATLLIHEGVKAE  154



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C AEFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPAQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWW TERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWSTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LD GPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDRGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGE LQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGENLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGVGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGLSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGS HMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSFHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEV WCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVPWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDA LLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDAALLIHEGVKAE  154



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVD GGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDGGGDATLLIHEGVKAE  154



>gb|AFW60834.1| adenosyl homocysteine hydrolase1 [Zea mays]
Length=259

 Score =   263 bits (671),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG  GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR+E+GPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGPSQPFKGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            L+WGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LEWGPAGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVL ETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLTETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   272 bits (695),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V+KT++GREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  81   VDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  140

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  141  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  200

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  201  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  230



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (689),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITDSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLH T
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHTT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            L+WG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LEWGAGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAGVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V KTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQP KGARI+GSLHMT
Sbjct  5    VGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPLKGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSVAVFAWKGETLQEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLEL+LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +V+KTS GREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSASVFAWKGETLQEYWWCTEK  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            +LDWG GGGPDLIVDDGGD T+LIH GVKAE
Sbjct  124  SLDWGAGGGPDLIVDDGGDVTMLIHEGVKAE  154



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQP KGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPLKGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGASVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWG  GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGSEGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPTGGPDLIVDDGGDVTLLIHEGVKAE  154



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT++GRE+KVKDMSQADFGRLE+ELAEVEMPGLM+ R+EFGPSQPFKGARITGSLHMT
Sbjct  87   VEKTTAGREFKVKDMSQADFGRLEIELAEVEMPGLMSSRSEFGPSQPFKGARITGSLHMT  146

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  147  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  206

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  207  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  236



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWG GGGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGTGGGPDLIVDDGGDVTLLIHEGVKAE  154



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCS NIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSRNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR+EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLI DDGGDA++LIH GVKAE
Sbjct  125  LDWGPSGGPDLIFDDGGDASMLIHEGVKAE  154



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPEGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+A DSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIAHDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFAGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTNTGREYKVKDLSQADFGRLEIELAEIEMPGLISSRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAE  154



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
             VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPF GARITGSLHM
Sbjct  4    VVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFAGARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGPTGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSC IFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCXIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLI DDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIGDDGGDATLLIHEGVKAE  154



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V+KT++GREYKVKDMSQADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARD AAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAATIARDCAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAE  154



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQP KGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+ QADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWW TER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWGTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG GGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFGRLE+ELAE EMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG  GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
             LDWG  GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAE  154



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKT+SGREYKVKDMSQADFG LE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF  +GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFRVEGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGPGGGPDLIVDDGGDATLLI+ GVKAE
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIYEGVKAE  154



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP++PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAKPFAGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPNGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIE+LTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65   IQTAVLIESLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+E+GPSQP KGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGPSQPLKGARISGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTE+ 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTEQC  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWG  GGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LDWGAAGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            VEKTSSGREYKVKDMS ADFGR+E+ELAEVEMPGL++CR EFG SQPFKG RITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFGSSQPFKGTRITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAE  154



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLI+TLT LGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIDTLTDLGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGP GGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            T+ +T +GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGA+VRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAQVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLEEYWWCTEK  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            AL+WGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  124  ALEWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAE  154



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            LDWGP GGPDLIVDDGGD TLLIH GVKAE
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAE  154



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  89   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  268
            TV +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  269  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  448
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTEK  123

Query  449  ALDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            ALDWGPGGGPDLIVDDGGDATLLIH G KAE
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGAKAE  154



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  92   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  271
            V +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHMT
Sbjct  5    VSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKEARITGSLHMT  64

Query  272  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  451
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETL+EYWWCTE+A
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLEEYWWCTEKA  124

Query  452  LDWGPGGGPDLIVDDGGDATLLIHXGVKAE  541
            L+WGPGGGPDLIVDDGGDATLLIH GVKAE
Sbjct  125  LEWGPGGGPDLIVDDGGDATLLIHEGVKAE  154



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  134  MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  313
            MSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMTIQTAVLIETLTALG
Sbjct  1    MSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  60

Query  314  AEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVD  493
            A+VRWCSCNIFSTQDHA AA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AQVRWCSCNIFSTQDHARAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  494  DGGDATLLIHXGVKAE  541
            DGGDATLLIH GVKAE
Sbjct  121  DGGDATLLIHEGVKAE  136



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +2

Query  110  GREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL  289
            G  +KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMTIQTAVL
Sbjct  41   GGSFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVL  100

Query  290  IETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPG  469
            IETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG G
Sbjct  101  IETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVG  160

Query  470  GGPDLIVDDGGDATLLIHXGVKAE  541
            GGPDLIVDDGGDATLLIH GVKAE
Sbjct  161  GGPDLIVDDGGDATLLIHEGVKAE  184



>gb|AAL33588.1| S-adenosyl-L-homocysteine hydrolase [Zea mays]
Length=232

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  140  QADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAE  319
            QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAE
Sbjct  1    QADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAE  60

Query  320  VRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDG  499
            VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDG
Sbjct  61   VRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDG  120

Query  500  GDATLLIHXGVKAE  541
            GDATLLIH GVKAE
Sbjct  121  GDATLLIHEGVKAE  134



>gb|AFY99087.1| S-adenosyl-l-homocysteine hydrolase, partial [Campanula persicifolia]
Length=202

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +2

Query  134  MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  313
            MS ADFGRLELELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMTIQT VLIETLTALG
Sbjct  1    MSLADFGRLELELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALG  60

Query  314  AEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVD  493
            AEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  494  DGGDATLLIHXGVKAE  541
            DGGDATLLIH GVKAE
Sbjct  121  DGGDATLLIHEGVKAE  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645