BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018I15

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          212   3e-63   Vitis vinifera
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          210   2e-62   Sesamum indicum [beniseed]
gb|ACU19312.1|  unknown                                                 202   3e-62   Glycine max [soybeans]
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          208   7e-62   Solanum lycopersicum
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog          208   1e-61   Cucumis sativus [cucumbers]
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog          207   1e-61   
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog          207   2e-61   Cucumis melo [Oriental melon]
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          207   2e-61   Solanum tuberosum [potatoes]
gb|KJB41394.1|  hypothetical protein B456_007G102500                    205   2e-61   Gossypium raimondii
ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             207   3e-61   
gb|KJB41393.1|  hypothetical protein B456_007G102500                    205   5e-61   Gossypium raimondii
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                    205   1e-60   Gossypium arboreum [tree cotton]
gb|KDO86290.1|  hypothetical protein CISIN_1g014430mg                   201   1e-60   Citrus sinensis [apfelsine]
gb|KJB41392.1|  hypothetical protein B456_007G102500                    205   1e-60   Gossypium raimondii
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    204   2e-60   Nicotiana sylvestris
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    204   4e-60   Nicotiana sylvestris
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          204   4e-60   Glycine max [soybeans]
gb|KDO86289.1|  hypothetical protein CISIN_1g014430mg                   200   4e-60   Citrus sinensis [apfelsine]
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog          203   6e-60   Phoenix dactylifera
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          203   7e-60   Nicotiana tomentosiformis
ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          203   9e-60   Nicotiana sylvestris
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             203   9e-60   Phaseolus vulgaris [French bean]
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                203   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          202   1e-59   Glycine max [soybeans]
gb|KHM99334.1|  CAAX prenyl protease 1 like                             202   1e-59   Glycine soja [wild soybean]
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          202   2e-59   Nicotiana tomentosiformis
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog          202   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051723.1|  Peptidase family M48 family protein                202   2e-59   
gb|KDO86288.1|  hypothetical protein CISIN_1g014430mg                   201   2e-59   Citrus sinensis [apfelsine]
ref|XP_007218054.1|  hypothetical protein PRUPE_ppa006168mg             200   2e-59   
emb|CDP08773.1|  unnamed protein product                                202   3e-59   Coffea canephora [robusta coffee]
gb|KDO86287.1|  hypothetical protein CISIN_1g014430mg                   201   3e-59   Citrus sinensis [apfelsine]
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg             203   3e-59   
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          201   3e-59   Elaeis guineensis
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          201   6e-59   Prunus mume [ume]
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          201   7e-59   Eucalyptus grandis [rose gum]
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          201   7e-59   Citrus sinensis [apfelsine]
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             200   1e-58   Prunus persica
ref|XP_002511907.1|  caax prenyl protease ste24, putative               200   1e-58   Ricinus communis
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog          199   2e-58   Brassica rapa
ref|XP_002320821.1|  CAAX protease family protein                       199   2e-58   Populus trichocarpa [western balsam poplar]
emb|CDY07191.1|  BnaCnng02060D                                          199   2e-58   
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog          199   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog          199   3e-58   Nelumbo nucifera [Indian lotus]
emb|CDY48517.1|  BnaA09g00060D                                          199   3e-58   Brassica napus [oilseed rape]
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog          199   4e-58   Populus euphratica
emb|CDX74353.1|  BnaA03g26940D                                          198   6e-58   
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    197   1e-57   Brassica rapa
emb|CDX91888.1|  BnaC03g31900D                                          197   1e-57   
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    198   1e-57   Brassica rapa
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          197   2e-57   Phoenix dactylifera
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    197   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_002302601.1|  CAAX protease family protein                       196   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog          196   4e-57   Elaeis guineensis
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          195   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog          195   1e-56   Fragaria vesca subsp. vesca
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein                194   2e-56   
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog          193   5e-56   Fragaria vesca subsp. vesca
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                    193   6e-56   Arabis alpina [alpine rockcress]
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog          193   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog          192   9e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog          192   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog          192   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog          192   1e-55   
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          192   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_003624056.1|  CAAX prenyl protease-like protein                  192   1e-55   Medicago truncatula
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease     191   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                        191   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874990.1|  ATSTE24                                            191   5e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg             191   5e-55   Capsella rubella
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog          188   4e-54   Oryza brachyantha
gb|AAL07084.1|  putative CAAX prenyl protease                           187   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog          187   2e-53   
ref|NP_001047739.1|  Os02g0680400                                       186   3e-53   
gb|EEC73787.1|  hypothetical protein OsI_08473                          186   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850          186   4e-53   Sorghum bicolor [broomcorn]
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700          184   2e-52   Amborella trichopoda
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog          183   5e-52   Setaria italica
ref|NP_001131195.1|  uncharacterized protein LOC100192503               181   2e-51   Zea mays [maize]
gb|AFW63375.1|  CAAX prenyl protease 1                                  183   5e-51   
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2       178   3e-50   
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1       178   5e-50   Zea mays [maize]
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                     176   2e-49   Eucalyptus grandis [rose gum]
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog          175   6e-49   Brachypodium distachyon [annual false brome]
emb|CAB80941.1|  putative CAAX prenyl protease                          175   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog          174   1e-48   Fragaria vesca subsp. vesca
gb|KDP28583.1|  hypothetical protein JCGZ_14354                         173   2e-48   Jatropha curcas
gb|AIC32889.1|  STE24                                                   171   1e-47   Puccinellia tenuiflora
ref|NP_001152504.1|  CAAX prenyl protease 1                             164   5e-45   Zea mays [maize]
emb|CAL26913.1|  CAAX peptidase                                         163   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH18809.1|  CAAX prenyl protease-like protein                       162   5e-44   Medicago truncatula
ref|XP_001780822.1|  predicted protein                                  151   6e-40   
gb|KHN29321.1|  CAAX prenyl protease 1 like                             149   7e-40   Glycine soja [wild soybean]
ref|XP_003622452.1|  CAAX prenyl protease-like protein                  142   1e-38   
ref|XP_001783632.1|  predicted protein                                  147   1e-38   
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600             140   6e-36   Selaginella moellendorffii
gb|KHF98917.1|  E3 ubiquitin-protein ligase RHF2A -like protein       83.6    6e-16   Gossypium arboreum [tree cotton]
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                   82.4    2e-15   
ref|XP_004226161.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  80.5    2e-14   Ciona intestinalis [sea vase]
gb|ETL45293.1|  hypothetical protein L916_04606                       77.0    3e-13   Phytophthora parasitica
gb|ETO80780.1|  hypothetical protein F444_04815                       77.0    3e-13   Phytophthora parasitica P1976
ref|XP_008902128.1|  hypothetical protein PPTG_09033                  76.6    4e-13   Phytophthora parasitica INRA-310
gb|ETL98448.1|  hypothetical protein L917_04490                       76.6    4e-13   Phytophthora parasitica
gb|ETK91894.1|  hypothetical protein L915_04651                       76.3    5e-13   Phytophthora parasitica
emb|CEG66514.1|  hypothetical protein RMATCC62417_03079               76.3    5e-13   Rhizopus microsporus
ref|XP_001623710.1|  predicted protein                                75.9    8e-13   Nematostella vectensis
emb|CEJ00851.1|  hypothetical protein RMCBS344292_14897               75.1    1e-12   Rhizopus microsporus
gb|KFM64976.1|  CAAX prenyl protease 1-like protein                   74.7    2e-12   Stegodyphus mimosarum
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864           73.9    3e-12   Phytophthora sojae
gb|ETI52023.1|  hypothetical protein F443_04763                       73.9    4e-12   Phytophthora parasitica P1569
gb|ELU11443.1|  hypothetical protein CAPTEDRAFT_171238                73.6    4e-12   Capitella teleta
gb|KFZ20107.1|  hypothetical protein V502_03363                       72.8    7e-12   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
emb|CDW75638.1|  caax prenyl protease 1 homolog                       72.8    7e-12   Stylonychia lemnae
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672            72.8    8e-12   Volvox carteri f. nagariensis
ref|XP_002900396.1|  CAAX prenyl protease 1                           72.8    9e-12   Phytophthora infestans T30-4
gb|KFY87676.1|  hypothetical protein V500_06835                       73.2    1e-11   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ02509.1|  hypothetical protein V501_09542                       72.8    1e-11   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY76197.1|  hypothetical protein V499_04041                       72.8    1e-11   Pseudogymnoascus sp. VKM F-103
gb|EJY66600.1|  CAAX prenyl protease-like protein                     72.0    2e-11   Oxytricha trifallax
gb|EJY68063.1|  Zn-dependent protease with chaperone function         72.8    2e-11   Oxytricha trifallax
ref|XP_008861314.1|  hypothetical protein H310_00342                  71.6    2e-11   Aphanomyces invadans
gb|KFY59517.1|  hypothetical protein V496_05652                       71.2    2e-11   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ESA09906.1|  hypothetical protein GLOINDRAFT_80760                 71.2    2e-11   
gb|KFY38041.1|  hypothetical protein V494_04536                       71.6    2e-11   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|EPB83925.1|  hypothetical protein HMPREF1544_09315                 71.2    2e-11   Mucor circinelloides f. circinelloides 1006PhL
gb|KFX89268.1|  hypothetical protein V490_07139                       71.2    2e-11   Pseudogymnoascus sp. VKM F-3557
gb|KFY09356.1|  hypothetical protein V492_05514                       72.0    3e-11   Pseudogymnoascus sp. VKM F-4246
gb|ELR10214.1|  STE24 endopeptidase                                   70.9    3e-11   Pseudogymnoascus destructans 20631-21
dbj|GAN04268.1|  metallopeptidase                                     70.5    5e-11   Mucor ambiguus
emb|CEP19164.1|  hypothetical protein                                 70.1    7e-11   Parasitella parasitica
ref|XP_003050604.1|  predicted protein                                70.9    7e-11   [Nectria] haematococca mpVI 77-13-4
gb|KFY19341.1|  hypothetical protein V493_08005                       69.7    9e-11   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KFY04966.1|  hypothetical protein V491_09229                       70.1    1e-10   Pseudogymnoascus sp. VKM F-3775
emb|CDH48818.1|  prenyl protease                                      69.3    1e-10   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006681887.1|  hypothetical protein BATDEDRAFT_17759            68.9    1e-10   Batrachochytrium dendrobatidis JAM81
gb|KFH61944.1|  hypothetical protein MVEG_12278                       68.9    2e-10   Mortierella verticillata NRRL 6337
emb|CCO33594.1|  STE24 endopeptidase                                  66.2    2e-10   Rhizoctonia solani AG-1 IB
gb|ESZ94952.1|  putative CAAX prenyl protease 1                       68.6    2e-10   Sclerotinia borealis F-4128
emb|CDS07769.1|  hypothetical protein LRAMOSA01718                    68.2    3e-10   Lichtheimia ramosa
ref|XP_539577.3|  PREDICTED: CAAX prenyl protease 1 homolog           67.8    4e-10   Canis lupus familiaris [dogs]
ref|XP_002154940.2|  PREDICTED: CAAX prenyl protease 1 homolog        67.4    5e-10   Hydra vulgaris
ref|XP_001559859.1|  hypothetical protein BC1G_01418                  67.4    5e-10   Botrytis cinerea B05.10
ref|XP_008080326.1|  hypothetical protein GLAREA_07447                67.4    6e-10   Glarea lozoyensis ATCC 20868
ref|XP_001593172.1|  hypothetical protein SS1G_06094                  67.0    6e-10   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_008149410.1|  PREDICTED: CAAX prenyl protease 1 homolog        67.0    6e-10   Eptesicus fuscus
ref|XP_006098203.1|  PREDICTED: CAAX prenyl protease 1 homolog        67.0    7e-10   Myotis lucifugus
ref|XP_010593554.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  66.6    7e-10   Loxodonta africana [African bush elephant]
ref|XP_005868719.1|  PREDICTED: CAAX prenyl protease 1 homolog        67.0    8e-10   Myotis brandtii
ref|XP_007536149.1|  PREDICTED: CAAX prenyl protease 1 homolog        67.0    8e-10   Erinaceus europaeus [common hedgehog]
dbj|GAA32070.1|  STE24 endopeptidase                                  66.6    8e-10   Clonorchis sinensis [oriental liver fluke]
ref|XP_004371951.1|  PREDICTED: CAAX prenyl protease 1 homolog        66.6    9e-10   Trichechus manatus latirostris
ref|XP_005848523.1|  hypothetical protein CHLNCDRAFT_22375            66.2    9e-10   Chlorella variabilis
ref|XP_009168050.1|  hypothetical protein T265_13631                  66.6    9e-10   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_003415368.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  66.6    9e-10   Loxodonta africana [African bush elephant]
gb|EER44696.1|  CaaX prenyl protease                                  66.6    1e-09   Histoplasma capsulatum H143
gb|EGC45621.1|  CaaX prenyl protease                                  66.6    1e-09   Histoplasma capsulatum H88
gb|EEH10632.1|  CaaX prenyl protease                                  66.6    1e-09   Histoplasma capsulatum G186AR
emb|CEL61202.1|  STE24 endopeptidase                                  66.2    1e-09   Rhizoctonia solani AG-1 IB
emb|CCT67513.1|  probable zinc metallo-protease                       66.2    1e-09   Fusarium fujikuroi IMI 58289
ref|XP_008999216.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  66.2    1e-09   Callithrix jacchus [common marmoset]
ref|XP_001239931.1|  hypothetical protein CIMG_09552                  66.2    1e-09   Coccidioides immitis RS
ref|XP_008589088.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  66.2    1e-09   Galeopterus variegatus [Malayan flying lemur]
ref|XP_002584079.1|  hypothetical protein UREG_04768                  66.2    1e-09   Uncinocarpus reesii 1704
ref|XP_003067440.1|  CAAX prenyl protease, putative                   66.2    1e-09   Coccidioides posadasii C735 delta SOWgp
ref|XP_002750699.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  66.2    1e-09   Callithrix jacchus [common marmoset]
ref|XP_003799067.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    1e-09   
ref|XP_004910060.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_004851106.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.9    2e-09   Heterocephalus glaber [naked mole rat]
ref|XP_008589087.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.9    2e-09   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004591591.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   Ochotona princeps [southern American pika]
ref|XP_004450692.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   
ref|XP_002715233.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_004851105.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.9    2e-09   Heterocephalus glaber [naked mole rat]
ref|XP_004415415.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.9    2e-09   
ref|XP_010861023.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.9    2e-09   Bison bison bison
ref|XP_005898693.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   Bos mutus
ref|XP_010345848.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   Saimiri boliviensis boliviensis
gb|ELR54320.1|  CAAX prenyl protease 1-like protein                   65.9    2e-09   Bos mutus
ref|NP_001179857.1|  CAAX prenyl protease 1 homolog                   65.9    2e-09   Bos taurus [bovine]
emb|CAQ86908.1|  CAAX prenyl protease                                 63.2    2e-09   Acremonium chrysogenum
ref|XP_006061988.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   Bubalus bubalis [domestic water buffalo]
ref|XP_004001889.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   Ovis aries [domestic sheep]
ref|XP_006737576.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   Leptonychotes weddellii
ref|XP_011233459.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   
gb|KFH71808.1|  hypothetical protein MVEG_02102                       65.5    2e-09   Mortierella verticillata NRRL 6337
ref|XP_003937059.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   Saimiri boliviensis boliviensis
ref|XP_005543897.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   Macaca fascicularis [crab eating macaque]
ref|XP_004025583.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   
ref|XP_007453816.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   Lipotes vexillifer [baiji]
ref|XP_004450691.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   Dasypus novemcinctus
ref|XP_002927608.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   Ailuropoda melanoleuca
ref|XP_003989947.2|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   
ref|XP_010352520.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    2e-09   Rhinopithecus roxellana
ref|XP_006215922.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   Vicugna pacos
ref|XP_007977466.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    2e-09   Chlorocebus sabaeus
ref|XP_007114324.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    2e-09   
ref|XP_006188105.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   Camelus ferus
ref|XP_003962545.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    2e-09   Takifugu rubripes [tiger puffer]
ref|XP_008710233.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    3e-09   Ursus maritimus [white bear]
ref|XP_006867649.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    3e-09   Chrysochloris asiatica
ref|XP_007977465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   Chlorocebus sabaeus
ref|NP_001244375.1|  CAAX prenyl protease 1 homolog                   65.5    3e-09   Macaca mulatta [rhesus macaque]
ref|XP_010352519.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   Rhinopithecus roxellana
emb|CAH92474.1|  hypothetical protein                                 65.5    3e-09   Pongo abelii [orang utan]
ref|XP_007077458.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    3e-09   Panthera tigris altaica
ref|XP_513352.2|  PREDICTED: CAAX prenyl protease 1 homolog           65.5    3e-09   Pan troglodytes
ref|NP_001126457.1|  CAAX prenyl protease 1 homolog                   65.1    3e-09   Pongo abelii [orang utan]
ref|XP_003815473.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Pan paniscus [bonobo]
ref|XP_003273371.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_010995251.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  65.1    3e-09   Camelus dromedarius [camel]
ref|XP_010958108.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  65.1    3e-09   Camelus bactrianus [camel]
ref|XP_005317922.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Ictidomys tridecemlineatus
ref|XP_004266443.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Orcinus orca [Orca]
ref|XP_005970531.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004316653.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004426071.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006165004.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  65.1    3e-09   
ref|XP_006758037.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   Myotis davidii
ref|XP_008522391.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.7    4e-09   Equus przewalskii [Przewalski horse]
ref|XP_009254473.1|  hypothetical protein FPSE_03079                  64.7    4e-09   Fusarium pseudograminearum CS3096
ref|XP_007950886.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.7    4e-09   Orycteropus afer afer
gb|EUC55856.1|  CAAX prenyl protease                                  64.3    5e-09   Rhizoctonia solani AG-3 Rhs1AP
ref|NP_001288163.1|  zinc metallopeptidase STE24                      64.7    5e-09   Equus caballus [domestic horse]
ref|XP_009028164.1|  hypothetical protein HELRODRAFT_193946           65.1    5e-09   Helobdella robusta
gb|KEP46996.1|  CAAX prenyl protease                                  64.7    5e-09   Rhizoctonia solani 123E
gb|KIN03786.1|  hypothetical protein OIDMADRAFT_158613                64.3    5e-09   Oidiodendron maius Zn
ref|XP_001540370.1|  CaaX prenyl protease                             64.3    5e-09   Histoplasma capsulatum NAm1
gb|EZF34879.1|  hypothetical protein H101_01566                       63.5    5e-09   Trichophyton interdigitale H6
dbj|BAA33727.1|  Ste24p                                               64.3    5e-09   Homo sapiens [man]
ref|NP_005848.2|  CAAX prenyl protease 1 homolog                      64.3    5e-09   Homo sapiens [man]
ref|XP_010624212.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.3    5e-09   Fukomys damarensis [Damara mole rat]
ref|XP_007164766.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.3    5e-09   Balaenoptera acutorostrata scammoni
gb|KDN36071.1|  hypothetical protein RSAG8_11093                      64.3    6e-09   Rhizoctonia solani AG-8 WAC10335
ref|XP_011324509.1|  hypothetical protein FGSG_12839                  64.3    6e-09   Fusarium graminearum PH-1
ref|XP_011115562.1|  hypothetical protein H072_10056                  64.3    6e-09   
ref|XP_010624213.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.3    6e-09   Fukomys damarensis [Damara mole rat]
ref|XP_004740738.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  63.9    6e-09   Mustela putorius furo [black ferret]
gb|EXL53967.1|  STE24 endopeptidase                                   64.3    6e-09   Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|EWZ02551.1|  STE24 endopeptidase                                   64.3    6e-09   Fusarium oxysporum FOSC 3-a
ref|XP_008832497.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    6e-09   Nannospalax galili
gb|EXM07215.1|  STE24 endopeptidase                                   63.9    6e-09   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EWG42807.1|  STE24 endopeptidase                                   63.9    6e-09   Fusarium verticillioides 7600
ref|XP_007917686.1|  putative caax prenyl protease 1 protein          63.9    7e-09   Phaeoacremonium minimum UCRPA7
ref|XP_004740737.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  63.9    7e-09   Mustela putorius furo [black ferret]
ref|XP_006824576.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  63.9    7e-09   Saccoglossus kowalevskii
ref|XP_003453270.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    7e-09   Oreochromis niloticus
ref|XP_002627156.1|  CaaX prenyl protease                             63.9    7e-09   Blastomyces gilchristii SLH14081
emb|CEJ80463.1|  hypothetical protein VHEMI00644                      63.9    7e-09   Torrubiella hemipterigena
ref|XP_008283596.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    8e-09   Stegastes partitus
emb|CDS32581.1|  farnesylated protein converting enzyme 1             64.3    8e-09   Hymenolepis microstoma
ref|XP_006798596.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    8e-09   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005925764.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    8e-09   Haplochromis burtoni
ref|XP_004540520.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    8e-09   Maylandia zebra
gb|ELK19500.1|  CAAX prenyl protease 1 like protein                   63.5    8e-09   Pteropus alecto
gb|KIM31184.1|  hypothetical protein M408DRAFT_255282                 63.5    9e-09   Serendipita vermifera MAFF 305830
ref|XP_006995844.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    9e-09   Peromyscus maniculatus bairdii
ref|XP_003501864.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    1e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_011376276.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    1e-08   Pteropus vampyrus
gb|KGQ04223.1|  CAAX prenyl protease 1                                63.5    1e-08   Beauveria bassiana D1-5
gb|KFH43653.1|  CAAX prenyl protease-like protein                     63.5    1e-08   Acremonium chrysogenum ATCC 11550
ref|XP_006904034.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  63.5    1e-08   
gb|AIC62085.1|  ZMPSTE24                                              63.5    1e-08   synthetic construct
gb|EGE06070.1|  CAAX prenyl protease                                  63.5    1e-08   Trichophyton equinum CBS 127.97
gb|AAH37283.1|  Zinc metallopeptidase (STE24 homolog, S. cerevisiae)  63.5    1e-08   Homo sapiens [man]
ref|XP_011415720.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    1e-08   Crassostrea gigas
gb|EGU84979.1|  hypothetical protein FOXB_04560                       63.5    1e-08   Fusarium oxysporum Fo5176
ref|XP_003462326.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    1e-08   Cavia porcellus [guinea pig]
pdb|2YPT|A  Chain A, Crystal Structure Of The Human Nuclear Membr...  63.5    1e-08   Homo sapiens [man]
pdb|4AW6|A  Chain A, Crystal Structure Of The Human Nuclear Membr...  63.5    1e-08   Homo sapiens [man]
ref|XP_003023010.1|  hypothetical protein TRV_02831                   63.5    1e-08   Trichophyton verrucosum HKI 0517
gb|EGD96703.1|  CaaX prenyl protease                                  63.2    1e-08   Trichophyton tonsurans CBS 112818
emb|CCG83629.1|  CaaX prenyl protease Ste24                           63.2    1e-08   Taphrina deformans PYCC 5710
ref|XP_004614273.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.2    1e-08   Sorex araneus [Eurasian shrew]
ref|XP_004348317.1|  CAAX prenyl protease 1                           63.2    1e-08   Capsaspora owczarzaki ATCC 30864
emb|CCE28602.1|  probable zinc metallo-protease                       63.2    1e-08   Claviceps purpurea 20.1
gb|KHJ35024.1|  putative peptidase family m48                         63.2    1e-08   Erysiphe necator
ref|XP_006886567.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.2    1e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008468578.1|  PREDICTED: uncharacterized protein C10orf118...  63.5    1e-08   
ref|XP_003012809.1|  hypothetical protein ARB_01060                   63.2    1e-08   Trichophyton benhamiae CBS 112371
ref|XP_007333006.1|  hypothetical protein AGABI1DRAFT_78691           62.8    2e-08   
ref|XP_006456595.1|  hypothetical protein AGABI2DRAFT_188490          62.8    2e-08   
ref|XP_003236858.1|  CaaX prenyl protease                             62.8    2e-08   
ref|XP_004665222.1|  PREDICTED: CAAX prenyl protease 1 homolog        62.8    2e-08   
ref|XP_005410609.1|  PREDICTED: CAAX prenyl protease 1 homolog        62.8    2e-08   
ref|XP_009059971.1|  hypothetical protein LOTGIDRAFT_209825           62.8    2e-08   
ref|XP_003649011.1|  hypothetical protein THITE_2107126               62.8    2e-08   
ref|XP_004082296.1|  PREDICTED: CAAX prenyl protease 1 homolog        62.4    2e-08   
gb|AAK48913.1|  Afc1 protein                                          62.4    2e-08   
ref|XP_004678903.1|  PREDICTED: CAAX prenyl protease 1 homolog        62.4    2e-08   
gb|EIE81350.1|  hypothetical protein RO3G_06055                       62.4    2e-08   
ref|XP_007244663.1|  PREDICTED: CAAX prenyl protease 1 homolog        62.0    3e-08   
emb|CAX20735.1|  putative CAAX prenyl protease                        62.0    3e-08   
ref|XP_010759714.1|  hypothetical protein PADG_04087                  62.0    4e-08   
ref|XP_010733223.1|  PREDICTED: CAAX prenyl protease 1 homolog        62.0    4e-08   
gb|KIK64206.1|  hypothetical protein GYMLUDRAFT_221506                61.6    4e-08   
gb|KIL91310.1|  hypothetical protein FAVG1_04924                      61.6    4e-08   
ref|XP_004705331.1|  PREDICTED: CAAX prenyl protease 1 homolog        61.6    4e-08   
emb|CCD77520.1|  farnesylated-protein converting enzyme 1 (M48 fa...  61.6    4e-08   
ref|XP_006673104.1|  CaaX prenyl protease                             61.6    4e-08   
ref|XP_004646026.1|  PREDICTED: CAAX prenyl protease 1 homolog        61.6    4e-08   
ref|XP_007283748.1|  prenyl protease                                  61.6    5e-08   
ref|XP_005353368.1|  PREDICTED: CAAX prenyl protease 1 homolog        61.6    5e-08   
emb|CCE44422.1|  hypothetical protein CPAR2_402230                    61.2    5e-08   
ref|XP_011121081.1|  hypothetical protein AOL_s00076g226              61.2    5e-08   
emb|CDQ71667.1|  unnamed protein product                              60.8    7e-08   
ref|XP_003172087.1|  CAAX prenyl protease 1                           60.8    7e-08   
ref|XP_010877922.1|  PREDICTED: CAAX prenyl protease 1 homolog        60.8    7e-08   
gb|AAK38172.1|  Zmpste24                                              60.8    7e-08   
gb|ELU39083.1|  metalloendopeptidase                                  61.2    8e-08   
emb|CAD31792.1|  farnesylated-proteins converting enzyme-1            60.8    8e-08   
gb|EFQ29725.1|  peptidase family M48                                  60.8    8e-08   
ref|NP_766288.1|  CAAX prenyl protease 1 homolog                      60.8    8e-08   
ref|XP_003661486.1|  hypothetical protein MYCTH_2300946               60.8    8e-08   
ref|XP_007855948.1|  putative zinc metallo-protease                   60.8    9e-08   
ref|XP_007492914.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  60.5    9e-08   
ref|XP_005083884.1|  PREDICTED: CAAX prenyl protease 1 homolog        60.8    9e-08   
gb|AAX78522.1|  CaaX prenyl protease                                  60.5    9e-08   
ref|XP_002796885.1|  CAAX prenyl protease                             60.5    9e-08   
gb|AAZ80484.1|  membrane-associated metalloproteinase                 60.5    1e-07   
gb|KIY44638.1|  hypothetical protein FISHEDRAFT_61693                 60.5    1e-07   
ref|XP_460632.1|  DEHA2F06248p                                        60.5    1e-07   
ref|XP_007492913.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  60.5    1e-07   
emb|CAK04159.1|  novel protein (zgc:55655)                            60.5    1e-07   
ref|XP_001381205.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  60.5    1e-07   
ref|XP_006696845.1|  ribosomal protein L34-like protein               60.8    1e-07   
gb|AAI65348.1|  Zmpste24 protein                                      60.5    1e-07   
ref|XP_007834407.1|  hypothetical protein PFICI_07635                 60.1    1e-07   
gb|KDQ52534.1|  hypothetical protein JAAARDRAFT_198172                60.5    1e-07   
ref|NP_956186.1|  CAAX prenyl protease 1 homolog                      60.1    1e-07   
ref|XP_008307531.1|  PREDICTED: CAAX prenyl protease 1 homolog        60.1    1e-07   
ref|XP_007269077.1|  hypothetical protein FOMMEDRAFT_22167            60.1    1e-07   
gb|KGO76072.1|  Peptidase M48                                         60.1    1e-07   
emb|CBJ27157.1|  CaaX prenyl protease Ste24                           60.1    1e-07   
ref|XP_007787411.1|  hypothetical protein EPUS_00192                  60.1    1e-07   
gb|KIJ40265.1|  hypothetical protein M422DRAFT_32316                  60.1    1e-07   
emb|CCX14243.1|  Similar to CAAX prenyl protease 1; acc. no. P47154   60.1    1e-07   
ref|NP_001101444.1|  CAAX prenyl protease 1 homolog                   60.1    2e-07   
gb|KGB37699.1|  CAAX prenyl protease 1-like protein                   59.7    2e-07   
ref|XP_008601147.1|  peptidase family M48                             59.7    2e-07   
ref|XP_006631345.1|  PREDICTED: CAAX prenyl protease 1 homolog        59.7    2e-07   
gb|EKV19760.1|  CaaX prenyl protease Ste24                            59.7    2e-07   
gb|KID96212.1|  Peptidase M48                                         59.3    2e-07   
ref|NP_001133548.1|  CAAX prenyl protease 1 homolog                   59.7    2e-07   
gb|KDO33073.1|  hypothetical protein SPRG_01888                       59.3    2e-07   
emb|CCK69867.1|  hypothetical protein KNAG_0D01150                    59.3    2e-07   
ref|XP_008611054.1|  hypothetical protein SDRG_07015                  59.3    3e-07   
ref|XP_001911737.1|  hypothetical protein                             59.3    3e-07   
ref|XP_008063694.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  59.3    3e-07   
ref|XP_001229027.1|  hypothetical protein CHGG_02511                  58.5    3e-07   
ref|XP_003869947.1|  Ste24 prenyl-dependent protease                  58.9    3e-07   
gb|EPE10297.1|  caax prenyl protease 1                                58.9    3e-07   
ref|XP_005100140.1|  PREDICTED: CAAX prenyl protease 1 homolog        58.9    3e-07   
emb|CCF47842.1|  peptidase family M48                                 58.5    4e-07   
gb|KGQ86300.1|  STE24 endopeptidase                                   58.5    4e-07   
gb|KGO40189.1|  Peptidase M48                                         58.5    4e-07   
ref|XP_007788183.1|  putative caax prenyl protease 1 protein          58.5    4e-07   
ref|XP_713382.1|  potential a-factor pheromone maturation protease    58.5    4e-07   
gb|KHC34914.1|  STE24 endopeptidase                                   58.5    4e-07   
ref|XP_008044250.1|  hypothetical protein TRAVEDRAFT_61072            58.5    4e-07   
ref|XP_007320476.1|  hypothetical protein SERLADRAFT_472109           58.5    5e-07   
gb|KHN95623.1|  Peptidase M48                                         58.5    5e-07   
ref|XP_007376706.1|  hypothetical protein SPAPADRAFT_62544            58.5    5e-07   
ref|XP_003007219.1|  CAAX prenyl protease                             58.2    5e-07   
gb|KID79414.1|  Peptidase M48                                         58.2    5e-07   
ref|XP_009654014.1|  CAAX prenyl protease                             58.2    5e-07   
gb|KID91898.1|  Peptidase M48                                         58.2    6e-07   
gb|KIY67067.1|  metalloendopeptidase                                  58.2    6e-07   
ref|XP_007822354.1|  metallopeptidase                                 58.2    6e-07   
ref|XP_002843395.1|  CAAX prenyl protease 1                           58.2    6e-07   
ref|XP_002599068.1|  hypothetical protein BRAFLDRAFT_81730            55.1    6e-07   
ref|XP_007595308.1|  peptidase family M48                             58.2    6e-07   
ref|XP_002565802.1|  Pc22g18990                                       58.2    7e-07   
emb|CDQ57992.1|  unnamed protein product                              57.8    7e-07   
gb|ENH68811.1|  CAAX prenyl protease 1                                57.8    7e-07   
ref|XP_003765468.1|  PREDICTED: CAAX prenyl protease 1 homolog        58.2    7e-07   
ref|XP_453545.1|  hypothetical protein                                57.8    8e-07   
gb|ELQ35873.1|  CAAX prenyl protease 1                                57.8    8e-07   
ref|XP_003709694.1|  CAAX prenyl protease 1                           57.8    9e-07   
ref|XP_003891707.2|  PREDICTED: CAAX prenyl protease 1 homolog        57.4    1e-06   
gb|ETS60648.1|  hypothetical protein PaG_04544                        57.4    1e-06   
dbj|GAM40464.1|  zinc metalloprotease                                 57.4    1e-06   
ref|XP_003685564.1|  hypothetical protein TPHA_0E00340                57.4    1e-06   
gb|EFB13524.1|  hypothetical protein PANDA_017398                     57.4    1e-06   
gb|KDB15160.1|  putative zinc metallo-protease                        57.4    1e-06   
ref|XP_010861024.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  57.4    1e-06   
emb|CDO69752.1|  hypothetical protein BN946_scf184697.g24             57.0    1e-06   
gb|KIM87869.1|  hypothetical protein PILCRDRAFT_814576                57.4    1e-06   
ref|XP_007386309.1|  metalloendopeptidase                             57.0    1e-06   
ref|XP_010593553.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  57.0    1e-06   
gb|EFX04750.1|  prenyl protease ste24                                 57.4    1e-06   
ref|XP_007812372.1|  putative zinc metallo-protease                   57.0    1e-06   
gb|ERT02053.1|  hypothetical protein HMPREF1624_00350                 57.0    1e-06   
ref|XP_002148969.1|  CaaX prenyl protease Ste24                       57.0    1e-06   
gb|KIN99244.1|  hypothetical protein M404DRAFT_819658                 57.0    1e-06   
ref|XP_002148970.1|  CaaX prenyl protease Ste24                       56.6    2e-06   
tpg|DAA01789.1|  TPA: CaaX prenyl protease                            57.0    2e-06   
gb|KIX06592.1|  hypothetical protein Z518_04568                       57.0    2e-06   
ref|XP_002112567.1|  hypothetical protein TRIADDRAFT_25296            56.6    2e-06   
gb|EUB62249.1|  CAAX prenyl protease                                  56.6    2e-06   
emb|CDM27808.1|  CAAX prenyl protease 1                               56.6    2e-06   
ref|XP_007295712.1|  peptidase family M48                             56.6    2e-06   
ref|XP_005801358.1|  PREDICTED: CAAX prenyl protease 1 homolog        56.6    2e-06   
gb|ENH82556.1|  prenyl protease ste24                                 56.2    2e-06   
gb|KIL00173.1|  hypothetical protein PAXRUDRAFT_130487                56.2    2e-06   
ref|XP_002419706.1|  CAAX prenyl protease, putative; zinc metallo...  56.2    2e-06   
ref|XP_002485210.1|  CaaX prenyl protease Ste24                       56.2    2e-06   
ref|XP_008589089.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  56.2    2e-06   
gb|EYE94778.1|  CaaX prenyl protease Ste24                            56.2    2e-06   
gb|KIK20177.1|  hypothetical protein PISMIDRAFT_596986                56.2    3e-06   
gb|KIJ19598.1|  hypothetical protein PAXINDRAFT_166705                56.2    3e-06   
ref|NP_001087923.1|  zinc metallopeptidase STE24                      56.2    3e-06   
ref|XP_006113336.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  56.2    3e-06   
ref|XP_005529940.1|  PREDICTED: CAAX prenyl protease 1 homolog        55.8    3e-06   
ref|XP_010345849.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  55.8    3e-06   
ref|XP_002194902.2|  PREDICTED: CAAX prenyl protease 1 homolog        55.8    3e-06   
ref|XP_006113334.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  55.8    3e-06   
ref|NP_001017255.1|  zinc metallopeptidase STE24                      55.8    3e-06   
emb|CDO93753.1|  unnamed protein product                              55.8    3e-06   
gb|KEZ39101.1|  CAAX prenyl protease 1                                55.8    3e-06   
gb|EMG47484.1|  CAAX prenyl protease 1                                55.8    4e-06   
ref|XP_007430032.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  55.8    4e-06   
dbj|GAM83450.1|  hypothetical protein ANO11243_014380                 55.8    4e-06   
ref|XP_007430031.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  55.8    4e-06   
gb|KDR22915.1|  CAAX prenyl protease 1-like protein                   55.5    4e-06   
ref|XP_005058383.1|  PREDICTED: CAAX prenyl protease 1 homolog        55.8    4e-06   
ref|XP_007574196.1|  PREDICTED: CAAX prenyl protease 1 homolog        55.5    4e-06   
ref|XP_002377095.1|  CaaX prenyl protease Ste24                       55.5    4e-06   
ref|XP_003225003.1|  PREDICTED: CAAX prenyl protease 1 homolog        55.5    4e-06   
ref|XP_003032250.1|  hypothetical protein SCHCODRAFT_76708            55.5    5e-06   
gb|KIJ62466.1|  hypothetical protein HYDPIDRAFT_30427                 55.1    6e-06   
dbj|BAO41720.1|  CAAX prenyl protease 1                               55.1    6e-06   
ref|XP_007780353.1|  STE24 endopeptidase                              55.1    6e-06   
ref|XP_001821320.1|  CAAX prenyl protease 1                           55.1    6e-06   
ref|XP_009152612.1|  STE24 endopeptidase                              55.1    6e-06   
gb|KDQ22820.1|  hypothetical protein PLEOSDRAFT_1069043               55.1    7e-06   
dbj|BAP73165.1|  CAAX prenyl protease 1                               55.1    7e-06   
emb|CDJ05239.1|  caax prenyl protease 1                               54.7    7e-06   
ref|XP_007365288.1|  hypothetical protein DICSQDRAFT_180370           54.7    7e-06   
emb|CDS17478.1|  caax prenyl protease 1                               54.7    7e-06   
gb|KIK36204.1|  hypothetical protein CY34DRAFT_811473                 54.7    7e-06   
ref|XP_002842311.1|  hypothetical protein                             54.7    7e-06   
ref|XP_008398126.1|  PREDICTED: CAAX prenyl protease 1 homolog        54.7    8e-06   
gb|KII84839.1|  hypothetical protein PLICRDRAFT_45641                 54.7    9e-06   
gb|EHK26722.1|  metallopeptidase M48                                  54.3    1e-05   
ref|XP_005309436.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  54.3    1e-05   
ref|XP_008172699.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  54.3    1e-05   
gb|KIM44315.1|  hypothetical protein M413DRAFT_17987                  54.3    1e-05   
gb|KDN48443.1|  hypothetical protein K437DRAFT_255552                 54.3    1e-05   
ref|XP_010574593.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  53.9    1e-05   
gb|KDR72916.1|  hypothetical protein GALMADRAFT_252262                54.3    1e-05   
gb|KIW12304.1|  hypothetical protein PV08_09581                       54.3    1e-05   
gb|KDN65807.1|  putative peptidase family M48                         54.3    1e-05   
ref|XP_417720.1|  PREDICTED: CAAX prenyl protease 1 homolog           53.9    1e-05   
gb|KIW42251.1|  hypothetical protein PV06_05815                       53.9    1e-05   
ref|XP_010574592.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  53.9    1e-05   
ref|XP_001267265.1|  CaaX prenyl protease Ste24                       53.9    1e-05   
gb|KIL62048.1|  hypothetical protein M378DRAFT_81777                  53.9    1e-05   
gb|EDP50136.1|  CaaX prenyl protease Ste24                            53.9    1e-05   
gb|AGO10617.1|  AaceriABR163Wp                                        53.9    1e-05   
ref|XP_752066.2|  CaaX prenyl protease Ste24                          53.9    2e-05   
gb|KEY76113.1|  CaaX prenyl protease Ste24                            53.9    2e-05   
ref|XP_001271650.1|  CaaX prenyl protease Ste24                       53.9    2e-05   
dbj|GAC72239.1|  metalloprotease                                      53.5    2e-05   
emb|CCJ30223.1|  unnamed protein product                              53.5    2e-05   
gb|KEQ83545.1|  CAAX prenyl protease 1                                53.1    2e-05   
gb|KIP07880.1|  hypothetical protein PHLGIDRAFT_19080                 53.1    2e-05   
gb|EHK42306.1|  metallopeptidase M48                                  53.1    2e-05   
gb|KEQ63120.1|  hypothetical protein M437DRAFT_47585                  53.1    2e-05   
dbj|GAD96409.1|  conserved hypothetical protein                       53.5    3e-05   
ref|XP_001794288.1|  hypothetical protein SNOG_03739                  53.1    3e-05   
gb|KEQ90314.1|  hypothetical protein AUEXF2481DRAFT_9558              53.1    3e-05   
ref|XP_006964512.1|  metallopeptidase                                 53.1    3e-05   
gb|KEQ71244.1|  hypothetical protein M436DRAFT_83534                  53.1    3e-05   
ref|XP_001401563.1|  CAAX prenyl protease 1                           53.1    3e-05   
ref|XP_505269.2|  YALI0F11033p                                        52.8    3e-05   
gb|KIW26412.1|  hypothetical protein PV07_09509                       52.8    3e-05   
ref|XP_005839506.1|  hypothetical protein GUITHDRAFT_161213           52.8    3e-05   
gb|EOA94667.1|  CAAX prenyl protease 1-like protein                   52.8    3e-05   
ref|XP_005029094.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  52.8    3e-05   
ref|XP_010788908.1|  PREDICTED: CAAX prenyl protease 1 homolog        52.8    4e-05   
dbj|GAA82676.1|  CaaX prenyl protease Ste24                           52.8    4e-05   
ref|XP_008063695.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  52.8    4e-05   
gb|AAB61028.1|  A_IG002N01.21 gene product                            52.4    4e-05   
ref|XP_784397.3|  PREDICTED: CAAX prenyl protease 1 homolog           52.4    4e-05   
gb|KIJ91753.1|  hypothetical protein K443DRAFT_471063                 52.4    4e-05   
gb|EQL00306.1|  Peptidase M48                                         52.4    5e-05   
dbj|GAC98932.1|  CaaX prenyl protease Ste24                           52.4    5e-05   
ref|XP_007868390.1|  hypothetical protein GLOTRDRAFT_140021           52.4    5e-05   
gb|KEF63154.1|  STE24 endopeptidase                                   52.4    5e-05   
emb|CCU75602.1|  CAAX prenyl protease 1                               52.0    6e-05   
emb|CCA73227.1|  probable zinc metallo-protease                       52.0    6e-05   
ref|XP_961364.3|  CaaX prenyl protease Ste24                          52.0    6e-05   
ref|XP_001214622.1|  hypothetical protein ATEG_05444                  52.0    6e-05   
ref|XP_009848380.1|  hypothetical protein NEUTE1DRAFT_120293          52.0    6e-05   
gb|ETE70091.1|  CAAX prenyl protease 1-like protein                   52.0    6e-05   
dbj|GAK64260.1|  metalloendopeptidase                                 52.0    7e-05   
ref|XP_002545231.1|  CAAX prenyl protease 1                           52.0    7e-05   
ref|XP_007399987.1|  hypothetical protein PHACADRAFT_32121            52.0    7e-05   
ref|XP_002398411.1|  hypothetical protein MPER_00996                  49.3    7e-05   
emb|CCL98879.1|  predicted protein                                    52.0    8e-05   



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMYIFETYLD+RQHAALKLPTLP+ L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMDSAIL+FG+LPWFWKKSGDFLV +GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHECVTILMDSAILFFGVLPWFWKKSGDFLVVVGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMIL+Y+FETYLD+RQH ALKLPTLP+PLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYLFETYLDLRQHTALKLPTLPRPLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTI+MD AILYFGILPWFWK+SG+FLV+ GLN ENEILHTLAFLAGVMFWSQ
Sbjct  61   HFHFVHELVTIVMDCAILYFGILPWFWKRSGEFLVYAGLNAENEILHTLAFLAGVMFWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|ACU19312.1| unknown [Glycine max]
Length=202

 Score =   202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI+ DS ILYFG+LPWFWKKSGDF+   G N ENEILHTLAFLAG+M WSQ
Sbjct  61   HFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTIAGFNAENEILHTLAFLAGLMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+EAVVGFMILMYIFE+YLD+RQHAA KLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVVGFMILMYIFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFVTI+MDS+ILYF ILPWFWK+SG+FLVFLGLN ENEI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTIIMDSSILYFRILPWFWKRSGEFLVFLGLNAENEIFHTLSFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY FETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI+MDSAIL+FG+LPWFWKKSG+F+VF+GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEFVVFVGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  VTD  123



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY FETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI+MDSAIL+FG+LPWFWKKSG+F+VF+GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEFVVFVGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  VTD  123



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI+MDSAIL+FG+LPWFWKKSG+F+V +GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEFVVLVGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  VTD  123



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+EAVVGFMILMY+FE+YLD+RQHAA KLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVVGFMILMYLFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFVTILMDS+ILYF ILPWFWK+SG+FLV+LGLN ENEI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKRSGEFLVYLGLNAENEIFHTLSFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KJB41394.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=362

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLVGLNEENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  117  RSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS  296
            RS ++S      N+AM FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVIS
Sbjct  25   RSSNISADSTNSNAAMVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVIS  84

Query  297  QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEI  476
            QEKFEKSR YS+DKS FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ ENEI
Sbjct  85   QEKFEKSRGYSLDKSHFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEI  144

Query  477  LHTLAFLAGVMFWSQITD  530
            LHTL+FLAGVM WSQ+TD
Sbjct  145  LHTLSFLAGVMLWSQLTD  162



>gb|KJB41393.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=391

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLVGLNEENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLIGLNEENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KDO86290.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=274

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  LTD  123



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLVGLNEENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVI QEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +FHFVHEFVTILMDSA+LYF ILPWFWK SGDFL++LGLN ENEI HTLAFLAGVM WSQ
Sbjct  61   NFHFVHEFVTILMDSAVLYFRILPWFWKISGDFLIYLGLNAENEIFHTLAFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVI QEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +FHFVHEFVTILMDSA+LYF ILPWFWK SGDFL++LGLN ENEI HTLAFLAGVM WSQ
Sbjct  61   NFHFVHEFVTILMDSAVLYFRILPWFWKISGDFLIYLGLNAENEIFHTLAFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI+ DS ILYFG+LPWFWKKSGDF+   G N ENEILHTLAFLAG+M WSQ
Sbjct  61   HFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTIAGFNAENEILHTLAFLAGLMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KDO86289.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=304

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  LTD  123



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+GFMILMYI ETYLDIRQHAALKLP+LPKPL GV+SQEKFEKSRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMD+AILYFG+LPWFWKKSGDF+ ++GLN ENEI+HTL+FLAGVM WSQ
Sbjct  61   HFHFVHEAVTILMDTAILYFGVLPWFWKKSGDFVAYMGLNAENEIIHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVISQEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVISQEKFKKSQAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +FHFVHEFVTILMDSAILYF ILPWFWK S DFL++LGLN ENEI HTLAFLAGVM WSQ
Sbjct  61   NFHFVHEFVTILMDSAILYFRILPWFWKISRDFLIYLGLNAENEIFHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+EAV+GFMILMYIFETYLD+RQHAA KLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFVTILMDS+ILYF ILPWFWK SG+ LV+LGLN ENEI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKISGESLVYLGLNAENEIFHTLSFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDMRQHKALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +FHF+HEFVTI+ DS ILYFG+LPWFWKKSG+++  +GLN ENEILHTLAFLAG+M WSQ
Sbjct  61   NFHFIHEFVTIVSDSTILYFGVLPWFWKKSGEYVTTVGLNPENEILHTLAFLAGLMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVG MIL+YIFE YLD RQHAALKLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGVMILVYIFECYLDKRQHAALKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +FHFVHE VT+LMDS ILYFGILPWFWK+SG+FL   G N ENEILHTLAFLAGVMFWSQ
Sbjct  61   NFHFVHELVTVLMDSVILYFGILPWFWKRSGEFLGSAGFNAENEILHTLAFLAGVMFWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI++DS ILYFG+LPWFWK SGDF+    LN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVIDSTILYFGVLPWFWKISGDFMTIASLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI++DS ILYFG+LPWFWK SGDF+    LN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVIDSTILYFGVLPWFWKISGDFMTIASLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+EAV+GFMILMYIFETYLD+RQHAA KLPTLPK LVGVISQEKF+KSRAYS+DKS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFKKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFVTILMDS+ILYF ILPWFWK SG+ L++LGLNTENEI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKISGESLLYLGLNTENEIFHTLSFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPY+EAVVGFMILMY FETYLD+RQHAA KLPTLPKPL+GVISQEKFEKSRAYS+DKS
Sbjct  1    MTFPYLEAVVGFMILMYFFETYLDLRQHAAHKLPTLPKPLLGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTI++DS ILYFG+LPWFWKK+GDFLV  G + ENEILHTLAFLAGVM WSQ
Sbjct  61   GFHFVHEFVTIVLDSGILYFGLLPWFWKKAGDFLVHAGFDAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAF YMEAVV FMILMY FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFLYMEAVVCFMILMYFFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWKKSG+FL  +GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKKSGNFLPLVGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KDO86288.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=367

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  LTD  123



>ref|XP_007218054.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19253.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=351

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVI QEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFVTILMDSAIL+F +LPWFWK+SGDF+  +GLN ENEILHTLAFL GVM WSQ
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDFVTLVGLNAENEILHTLAFLGGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP+MEAVV FMILMY+FE+YLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFMEAVVCFMILMYLFESYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +FHFVHEF TILMDSAIL+FGILPWFWKKSG+FLV  GL+ ENEI HTLAFLAGV FWSQ
Sbjct  61   NFHFVHEFFTILMDSAILFFGILPWFWKKSGEFLVLAGLDAENEIFHTLAFLAGVTFWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KDO86287.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=399

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  LTD  123



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  335
            +AMA PYME VVGFMI+MYIFETYLD+RQHAA KLPTLPK LVGVISQEKFEKSRAYS+D
Sbjct  69   AAMAIPYMETVVGFMIVMYIFETYLDLRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLD  128

Query  336  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFW  515
            KS FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ ENEILHTL+FLAGVM W
Sbjct  129  KSYFHFVHEFVTILMDSAILFFGILPWFWKLSGGFLPMVGLDPENEILHTLSFLAGVMTW  188

Query  516  SQITD  530
            SQITD
Sbjct  189  SQITD  193



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+GFMILMYIFETYLDIRQHAALKLP+LPKPL GV+SQEKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPSLPKPLEGVVSQEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMD+AILY GILPWFWKKSGD + ++GLN ENEI+HTL+FLAGVM WSQ
Sbjct  61   QFHFVHEAVTILMDTAILYLGILPWFWKKSGDLVAYMGLNAENEIIHTLSFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFVTILMDSAIL+F +LPWFWK+SGDF+   GLN ENEILHTLAFL GVM WSQ
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDFVTLAGLNAENEILHTLAFLGGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILM+ FETYLD+RQHAA KLPTLPKPL GVI QEKF+KSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFV+ILMDSAIL FGILPWFWKKSG+FLV  GLN ENEILHTL+FLAGVM WSQ
Sbjct  61   RFHFLHEFVSILMDSAILLFGILPWFWKKSGEFLVLAGLNAENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  522  ITD  530
            +TD
Sbjct  121  LTD  123



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVI QEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HEFVTILMDSAIL+F +LPWFWK+SGDF+  +GLN ENEILHTLAFL GVM WSQ
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDFVTLVGLNAENEILHTLAFLGGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAV+GFM+LMYIFE+YLD+RQH ALKLPTLPK L GVISQEKF+KSRAYS+DKS
Sbjct  1    MAFPYMEAVLGFMVLMYIFESYLDMRQHCALKLPTLPKTLEGVISQEKFKKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             F+FVHEFVTIL+DSAILYFGILPW WK+SG+FL+ +GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   HFNFVHEFVTILLDSAILYFGILPWSWKESGNFLLLVGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSA+L+FGILPWFWK SG FL  +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAMLFFGILPWFWKLSGGFLPMVGLDPENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMIL+Y FETYLD+RQ AALKLP LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQRAALKLPILPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             F+FVHEFVTIL+DSAIL++GILPWFWKKSG F+V  G N ENEILHTLAFLAGVM WSQ
Sbjct  61   HFNFVHEFVTILLDSAILFYGILPWFWKKSGSFVVLAGFNEENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSA+L+FGILPWFWK SG FL  +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAMLFFGILPWFWKLSGGFLSMVGLDPENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYME VVGFMI+MYIFETYLD+RQHAALKLPTLPK LVG+I QEKFEKSRAYS+DKS
Sbjct  1    MAFPYMETVVGFMIMMYIFETYLDLRQHAALKLPTLPKTLVGLIGQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFV  +VTILMDSAIL+FGILPWFWKKSGDFL  +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVQGYVTILMDSAILFFGILPWFWKKSGDFLPSVGLDPENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYME+VVGFMILMYIFETYLDIRQH +LKLP LPKPL GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMESVVGFMILMYIFETYLDIRQHRSLKLPNLPKPLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HE VTILMD+AIL+FGILPWFWK+S +FL++  LN ENEILHTLAFL+GVM WSQ
Sbjct  61   HFHFIHEAVTILMDTAILFFGILPWFWKRSAEFLIYTNLNPENEILHTLAFLSGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSA+L+FG+LPWFWK SG FL  +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAMLFFGVLPWFWKLSGGFLPMVGLDPENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMIL+Y FETYLD+RQ AALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQLAALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             F+FVHEFVTIL+DSAIL++GILPWFWKKSG F+V  G N ENEILHTLAFLAGVM WSQ
Sbjct  61   HFNFVHEFVTILLDSAILFYGILPWFWKKSGSFVVLAGFNEENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ ENEILHTL+FLAG+M WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGGFLPIVGLDPENEILHTLSFLAGLMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ ENEI+HTL+FLAG+M WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGGFLPMVGLDPENEIMHTLSFLAGLMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFM++MY+FETYLD+RQH ALKLPTLPK LVGVISQ+KFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMVVMYVFETYLDLRQHTALKLPTLPKTLVGVISQDKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGAFLPMVGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ ENEI+HTL+FLAG+M WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGGFLPMVGLDPENEIMHTLSFLAGLMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+GFMILMYI ETYLDIRQHAALKLP+LPKPL GV+ QEKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVGQEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE V+ILMD+AILYFGILPWFWKK+GD + ++GLN ENEI+HTL+FLAGVM WSQ
Sbjct  61   HFHFVHEAVSILMDTAILYFGILPWFWKKTGDLVAYMGLNAENEIIHTLSFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYME VVGFMI+MYI E YLD+RQH+ALKLPTLPK L+GVISQEKFEKSRAYS++KS
Sbjct  1    MAFPYMETVVGFMIMMYILEMYLDLRQHSALKLPTLPKTLIGVISQEKFEKSRAYSLEKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFV+EFVTILMDSAIL+FGILPWFWK SGDFL  +GL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVYEFVTILMDSAILFFGILPWFWKISGDFLPLVGLDPENEILHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMY FETYLD+RQHAALKLP+LPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYFFETYLDLRQHAALKLPSLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             F+FVHEFVTIL+DSAIL++ ILPWFWKKSG FLV +GL+ ENEI +TLAFLAGVM WSQ
Sbjct  61   YFNFVHEFVTILLDSAILFYAILPWFWKKSGSFLVLVGLDEENEIFNTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+GFMILMYIFETYLDIRQHAALKLP LPKPL GV+SQEKFEKSRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPRLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMD+AILYFGILPWFWK SG+ + ++ LN ENEI+HTL+FLAGVM WSQ
Sbjct  61   HFHFVHEAVTILMDTAILYFGILPWFWKISGNLVAYMDLNAENEIIHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+EAV+GFMI MY FETYLDIRQHAALKL  LPKPL GVISQEKFE++RAYSIDKS
Sbjct  1    MAFPYLEAVLGFMIFMYFFETYLDIRQHAALKLTNLPKPLEGVISQEKFERARAYSIDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HE VTILMD+AILYFGILPWFWK SG+ + +LGL+ ENEI+HTL+FLAGVM WSQ
Sbjct  61   GFHFIHEAVTILMDTAILYFGILPWFWKVSGNLVAYLGLDAENEIMHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  165  AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  344
            +FP++E+V+GFMILMY FETYLD RQH+ALKLPTLPK L GVISQEKFEKSRAYS++KS 
Sbjct  4    SFPFLESVIGFMILMYFFETYLDTRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLEKSH  63

Query  345  FHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQI  524
            FHFVHEFVTILMDSAIL+F +LPWFWKKSGDF+V  GLN ENEILHTLAFLAGV  WSQI
Sbjct  64   FHFVHEFVTILMDSAILFFRVLPWFWKKSGDFVVLAGLNAENEILHTLAFLAGVTIWSQI  123

Query  525  TD  530
            TD
Sbjct  124  TD  125



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +3

Query  129  VSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKF  308
            +  +L L +  ++     A  GFMILMY FETYLD+RQHAALKLPTLPK LVGVISQEKF
Sbjct  2    LPCFLLLFDGTLSGTPTHANTGFMILMYFFETYLDLRQHAALKLPTLPKTLVGVISQEKF  61

Query  309  EKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTL  488
            EKSRAYS+DKS FHFVHEFV+ILMDS+IL+FG+LPWFWKKSGDFLV +GLN ENEILHTL
Sbjct  62   EKSRAYSLDKSHFHFVHEFVSILMDSSILFFGVLPWFWKKSGDFLVLVGLNAENEILHTL  121

Query  489  AFLAGVMFWSQITD  530
            AFLAGVM WSQITD
Sbjct  122  AFLAGVMIWSQITD  135



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP++EAV+GFMILMY FETYLD+RQHAALKLPTLP+ L GVISQEKFEKSRAY +++S
Sbjct  1    MAFPFLEAVIGFMILMYNFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYCLERS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +FHFVH+FVT+LMD+AIL++ ILPWFWKKSGDF+V  GLN ENEI HTL+FLAGVM W Q
Sbjct  61   NFHFVHDFVTLLMDTAILFYRILPWFWKKSGDFVVLAGLNAENEIRHTLSFLAGVMIWEQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MYIFE+YLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFESYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK  G  L  LGL+ ENEILHTL+FLAGV  WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMCGGVLPMLGLDPENEILHTLSFLAGVTAWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+EAV+GFMI MY+FETYLDIRQHAALKLP LPKPL GVIS+EKFEK+RAYSIDKS
Sbjct  1    MAFPYLEAVLGFMIFMYLFETYLDIRQHAALKLPNLPKPLEGVISREKFEKARAYSIDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HE VTILMD+AILYFG+LPWFWK SG+ + +LGL+ ENEI+HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEAVTILMDTAILYFGLLPWFWKLSGNLVAYLGLDAENEIIHTLSFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP++EAV+GFMI +Y FETYLD+RQHAA KLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+F +LPWFWK+S DF+   GLN ENEI HTLAFL GVM WSQ
Sbjct  61   RFHFVHEFVTILMDSAILFFRVLPWFWKRSADFVALAGLNAENEIWHTLAFLGGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP++EAV+GFMI +Y FETYLD+RQHAA KLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+F +LPWFWK+S DF+   GLN ENEI HTLAFL GVM WSQ
Sbjct  61   RFHFVHEFVTILMDSAILFFRVLPWFWKRSADFVALAGLNAENEIWHTLAFLGGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPYMEAVVGFMILMYIFE+YLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFESYLDLRQHKALKLPTLPKSLEGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVH  VTI+ DS ILYF +LPWFWKKSGDF+   GLN ENEI HTL FLAG+M WSQ
Sbjct  61   HFHFVHALVTIITDSTILYFKVLPWFWKKSGDFVTLAGLNAENEIFHTLGFLAGLMIWSQ  120

Query  522  ITD  530
             TD
Sbjct  121  TTD  123



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMSGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMSGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HE VTILMD+ ILY+ +LPWFWKKSG+    +GLN ENEI+HTLAFLAGVM WSQ
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWFWKKSGELATNVGLNAENEIIHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMDSAIL+F ILPWFWK SG  L  LGL+ ENEILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFWILPWFWKMSGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            YMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVI+QEKFEKSRAYS+DKS FHF
Sbjct  11   YMEAVVGFMILMYIFETYLDLRQHVALKLPTLPKSLKGVINQEKFEKSRAYSLDKSHFHF  70

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQITD  530
            +H FVTI+ DS ILYF +LPWFWKKSGDF    GLN ENEILHTLAFLAG+M WSQ TD
Sbjct  71   IHAFVTIVTDSTILYFRVLPWFWKKSGDFATLAGLNAENEILHTLAFLAGLMIWSQTTD  129



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HE VTILMD+ ILY+ +LPW WKKSG+     GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWVWKKSGELATNAGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMILMYIFETYLDIRQH ALK PTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKEPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+HE VTILMD+ ILY+ +LPW WKKSG+     GLN ENEILHTLAFLAGVM WSQ
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWVWKKSGELATNAGLNAENEILHTLAFLAGVMIWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GLN ENEI+HTLAFLAG M WSQ
Sbjct  61   YFHFVHEAVTILMDTTILYYRVLPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PYME+VVGFM+LMYIFETYLD+RQHAALKLPTLP+PL GV+SQ+KFEKS+AYS+DKS
Sbjct  1    MALPYMESVVGFMVLMYIFETYLDLRQHAALKLPTLPRPLHGVVSQDKFEKSQAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHF+H  VTI+MD +IL FG+LPWFW+KS   LV++GLN ENEI+HTLAFLAGVM WSQ
Sbjct  61   HFHFIHGVVTIVMDVSILLFGVLPWFWQKSEAVLVYMGLNPENEIVHTLAFLAGVMLWSQ  120

Query  522  ITD  530
            IT+
Sbjct  121  ITE  123



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPL+GVIS EKF++SR YS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFKRSRDYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GLN ENEI+HTLAFLAG M WSQ
Sbjct  61   HFHFVHEAVTILMDTTILYYRVLPWFWKKSGELITNVGLNAENEIIHTLAFLAGAMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMI MYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GL+ ENEI+HTLAFLAG M WSQ
Sbjct  61   YFHFVHEAVTILMDTTILYYRVLPWFWKKSGELVTSVGLSAENEIIHTLAFLAGSMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMI MYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  204  MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  263

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GL+ ENEI+HTLAFLAG M WSQ
Sbjct  264  YFHFVHEAVTILMDTTILYYRVLPWFWKKSGELVTSVGLSAENEIIHTLAFLAGSMVWSQ  323

Query  522  ITD  530
            ITD
Sbjct  324  ITD  326



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA  Y+EAV+ FMILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMD+ ILY+  +PWFWKKSG+ +  +GLN ENEI+HTLAFLAG M WS+
Sbjct  61   YFHFVHEFVTILMDTTILYYRSVPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSK  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA  Y+EAV+ FMILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFVHEFVTILMD+ ILY+  +PWFWKKSG+ +  +GLN ENEI+HTLAFLAG M WS+
Sbjct  61   YFHFVHEFVTILMDTTILYYRSVPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSK  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +3

Query  198  MILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEFVTIL  377
            MILM+ FETYLD+RQHAA KLPTLPKPL GVI QEKF+KSRAYS+DKS FHF+HEFV+IL
Sbjct  1    MILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKSRFHFLHEFVSIL  60

Query  378  MDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQITD  530
            MDSAIL FGILPWFWKKSG+FLV  GLN ENEILHTL+FLAGVM WSQITD
Sbjct  61   MDSAILLFGILPWFWKKSGEFLVLAGLNAENEILHTLSFLAGVMIWSQITD  111



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMIL+YIFETYL+IRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILLYIFETYLNIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +F+FV E VTI  D  ILY+ +LPWFWKKSG+    +GLN ENEI+HTLAFLAGVM WSQ
Sbjct  61   NFNFVREAVTITSDIIILYYKVLPWFWKKSGELATNIGLNAENEIIHTLAFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 107/130 (82%), Gaps = 7/130 (5%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAY    +
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYRDIIT  60

Query  342  D-------FHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLA  500
            +       FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ ENEILHTL+FLA
Sbjct  61   ENFNICSYFHFVHEFVTILMDSAILFFGILPWFWKMSGAVLPRLGLDPENEILHTLSFLA  120

Query  501  GVMFWSQITD  530
            GVM WSQITD
Sbjct  121  GVMTWSQITD  130



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFP+++ VVG MILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAY +++S
Sbjct  1    MAFPFLDVVVGSMILMYIFETYLDLRQHSALKLPTLPKTLEGVISQEKFEKSRAYRLERS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFV E V ILMD AIL+F +LPWFWKKSG F+  +GLN ENEILHTLAFLAGV+ W +
Sbjct  61   HFHFVCELVRILMDLAILFFKVLPWFWKKSGHFVALVGLNEENEILHTLAFLAGVLIWLE  120

Query  522  ITD  530
            IT 
Sbjct  121  ITS  123



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            M FPY+EAV+  MIL+YIFETYL +R+HA LKLPTLPK L GV+SQEKFEKSRAYS+DKS
Sbjct  1    MEFPYLEAVLVVMILIYIFETYLALREHATLKLPTLPKALEGVVSQEKFEKSRAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             F FVH FVT L DSAILYF ILPWFWKKSG+FL+ LGLNTENEILHTLAFLAGVM WSQ
Sbjct  61   RFGFVHGFVTTLTDSAILYFRILPWFWKKSGNFLLLLGLNTENEILHTLAFLAGVMMWSQ  120

Query  522  ITD  530
            +T+
Sbjct  121  VTE  123



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMIL YIFETYL+IRQH ALKLPTLPK L GVIS EKFEK+RAYS+DKS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAGVISGEKFEKARAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +F+FV E VTI+ D  ILY+ +LPWFWKKSG+    +GLN ENEI+HTLAFLAGVM WSQ
Sbjct  61   NFNFVREGVTIVFDITILYYKVLPWFWKKSGELATNVGLNAENEIIHTLAFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  198  MILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEFVTIL  377
            MILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS FHFVHEFVTIL
Sbjct  1    MILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKSYFHFVHEFVTIL  60

Query  378  MDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQITD  530
            MD+ ILY+  +PWFWKKSG+ +  +GLN ENEI+HTLAFLAG M WS+ITD
Sbjct  61   MDTTILYYRSVPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSKITD  111



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FMIL YIFETYL+IRQH ALKLPTLPK L  VIS EKFE++RAYS+DKS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAKVISHEKFEQARAYSLDKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
            +F+FV E +TI+ D  ILY+ +LPW WK SG  +  +GLN ENEI+HTLAFLAGVM WSQ
Sbjct  61   NFNFVREAITIVCDIIILYYKVLPWLWKNSGVLVTNVGLNAENEIIHTLAFLAGVMVWSQ  120

Query  522  ITD  530
            ITD
Sbjct  121  ITD  123



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+EAV+GF ILMY FETYL++RQ  A KL TLPK L GVIS++ F+K+R+YS+D S
Sbjct  1    MAFPYLEAVIGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSLDHS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             FHFV +FVTI+ DSAIL+FG++PWFWKKS DF+  +GLN +NEILH++AFLAG M   Q
Sbjct  61   RFHFVCQFVTIVRDSAILFFGVMPWFWKKSEDFMTLIGLNADNEILHSIAFLAGCMILLQ  120

Query  522  IT  527
            IT
Sbjct  121  IT  122



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  153  NSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSI  332
             S   FPY+EAVVGFM+ MY+FETYLD+RQHAALKLPTLP PLVG++S EKFEK++AYS+
Sbjct  2    ESPAPFPYLEAVVGFMVFMYLFETYLDMRQHAALKLPTLPAPLVGIVSMEKFEKAQAYSL  61

Query  333  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMF  512
            +KS FHFVH  V I+ +SA L  G+LPW W KSG  +  LG +  +EILHTLAFLA +  
Sbjct  62   EKSRFHFVHAAVGIVEESATLLLGLLPWTWDKSGSLVGKLGFDQSSEILHTLAFLAVITL  121

Query  513  WSQITD  530
            WSQ+ +
Sbjct  122  WSQVLE  127



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  285  GVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNT  464
            GVISQEKFEKSRAYS+DKS FHFVHEFVTI+ DS ILYFG+LPWFWKKSGDF+   G N 
Sbjct  31   GVISQEKFEKSRAYSLDKSHFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTIAGFNA  90

Query  465  ENEILHTLAFLAGVMFWSQITD  530
            ENEILHTLAFLAG+M WSQITD
Sbjct  91   ENEILHTLAFLAGLMIWSQITD  112



>ref|XP_003622452.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=195

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +3

Query  165  AFPYMEAVV----GFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSI  332
              P  +AV+    GF ILMY FETYL++RQ  A KL TLPK L GVIS++ F+K+R+YS+
Sbjct  53   GLPQPKAVLVANDGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSL  112

Query  333  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMF  512
            D S FHFV +FVTI+ DSAIL+FG++PWFWKKS DF+  +GLN +NEILH++AFLAG M 
Sbjct  113  DHSRFHFVCQFVTIVRDSAILFFGVMPWFWKKSEDFMTLIGLNADNEILHSIAFLAGCMI  172

Query  513  WSQIT  527
              Q++
Sbjct  173  LLQVS  177



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  153  NSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSI  332
             ++  FPY+EAVVGFM+ MY+ ETYLDIRQH ALKL  LP PL G++SQEKFEK++AYS+
Sbjct  2    EASAPFPYLEAVVGFMLFMYMLETYLDIRQHGALKLSNLPAPLKGIVSQEKFEKAQAYSL  61

Query  333  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMF  512
            DKS FHFVH  V I+ +SAIL  G+LPW W KSG  +  LG + ++EIL TL+FLA    
Sbjct  62   DKSRFHFVHAAVNIVEESAILLLGLLPWAWDKSGSLVGKLGFDEKSEILQTLSFLAVTTL  121

Query  513  WSQITD  530
            WSQI +
Sbjct  122  WSQILE  127



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MAFPY+E+VVGFMI MY  E+YL +RQ+ ALKLPTLP  L GV+SQEKFEKSRAY+I+KS
Sbjct  1    MAFPYLESVVGFMIFMYFVESYLHLRQYRALKLPTLPPTLEGVVSQEKFEKSRAYTIEKS  60

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
             F F+H   TI+ +  +L   ILPW W KSGD  V LG + +NEI  TLAFL     WSQ
Sbjct  61   RFQFIHSVWTIVEECCMLLLKILPWIWMKSGDLAVRLGFDPQNEIAQTLAFLVLTTIWSQ  120

Query  522  ITD  530
            IT+
Sbjct  121  ITE  123



>gb|KHF98917.1| E3 ubiquitin-protein ligase RHF2A -like protein [Gossypium arboreum]
Length=362

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 60/100 (60%), Gaps = 27/100 (27%)
 Frame = +3

Query  231  DIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGIL  410
            D+RQHA LKLPTLPK L  VISQEKFEKSRAYS+DK                        
Sbjct  5    DLRQHATLKLPTLPKTLEAVISQEKFEKSRAYSLDK------------------------  40

Query  411  PWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQITD  530
                 KSG FL  LGL  ENEILHTL+FLAG M WSQITD
Sbjct  41   ---RLKSGTFLPLLGLIEENEILHTLSFLAGAMIWSQITD  77



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 59/123 (48%), Gaps = 46/123 (37%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            MA PY+EAV+ FM L YIFETYL+IRQH A             +      KS A      
Sbjct  1    MALPYLEAVLCFMTLNYIFETYLNIRQHRA-------------LKLPTLPKSLA------  41

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQ  521
                                       KKSG  +  +GLN ENEI+HTLAFLAGVM WSQ
Sbjct  42   ---------------------------KKSGVLVTNVGLNAENEIIHTLAFLAGVMVWSQ  74

Query  522  ITD  530
            ITD
Sbjct  75   ITD  77



>ref|XP_004226161.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Ciona intestinalis]
Length=469

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = +3

Query  180  EAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFV  356
            E+V+GF  ++Y++E+YL  RQH+           +  VI Q  F+KSR Y++DKS + F 
Sbjct  4    ESVLGFSWIVYLWESYLSKRQHSIYVNVQSVPKELTSVIDQSTFDKSRRYALDKSTYGFW  63

Query  357  HEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAF-LAGVMF  512
            +   + +  +AIL+ G LP+ W  SG  L  LG N+E+EILH+L F L G +F
Sbjct  64   NGLYSQIESTAILWLGGLPFLWAASGVVLEKLGYNSEHEILHSLVFTLLGSLF  116



>gb|ETL45293.1| hypothetical protein L916_04606 [Phytophthora parasitica]
Length=484

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 67/150 (45%), Gaps = 36/150 (24%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  296
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  297  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  407
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  408  LPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
            LP+ W  SG  L+ LGL+ +NEI   L  L
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLL  169



>gb|ETO80780.1| hypothetical protein F444_04815 [Phytophthora parasitica P1976]
Length=484

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 67/150 (45%), Gaps = 36/150 (24%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  296
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIKGLGSYRMKKDEKE  79

Query  297  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  407
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  408  LPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
            LP+ W  SG  L+ LGL+ +NEI   L  L
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLL  169



>ref|XP_008902128.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
 gb|ETN12113.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
Length=484

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 67/150 (45%), Gaps = 36/150 (24%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  296
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  297  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  407
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  408  LPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
            LP+ W  SG  L+ LGL+ +NEI   L  L
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLL  169



>gb|ETL98448.1| hypothetical protein L917_04490 [Phytophthora parasitica]
 gb|ETM51609.1| hypothetical protein L914_04599 [Phytophthora parasitica]
 gb|ETP49699.1| hypothetical protein F442_04842 [Phytophthora parasitica P10297]
Length=484

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 67/150 (45%), Gaps = 36/150 (24%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  296
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  297  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  407
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  408  LPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
            LP+ W  SG  L+ LGL+ +NEI   L  L
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLL  169



>gb|ETK91894.1| hypothetical protein L915_04651 [Phytophthora parasitica]
 gb|ETP21822.1| hypothetical protein F441_04764 [Phytophthora parasitica CJ01A1]
Length=484

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 67/150 (45%), Gaps = 36/150 (24%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  296
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  297  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  407
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  408  LPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
            LP+ W  SG  L+ LGL+ +NEI   L  L
Sbjct  140  LPFMWTVSGKALLSLGLDADNEIYRALMLL  169



>emb|CEG66514.1| hypothetical protein RMATCC62417_03079 [Rhizopus microsporus]
Length=440

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 69/119 (58%), Gaps = 1/119 (1%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            Y + V+ F  ++Y FE YL+ RQH    +   P  L  ++++E F+KS+AY++DKS F F
Sbjct  11   YKQFVIVFSCIVYAFEQYLNYRQHCRYLMRHRPDELADIVTEEDFKKSQAYNLDKSRFSF  70

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTENEILHTLAFLAGVMFWSQIT  527
            +  F   +    +L++  LP  W  SGD L  + G +T+ EILH++ FL     +S +T
Sbjct  71   IESFYKQIETVLMLHYDALPKMWNFSGDLLYKISGYSTDYEILHSIVFLIIFTIFSTVT  129



>ref|XP_001623710.1| predicted protein [Nematostella vectensis]
 gb|EDO31610.1| predicted protein [Nematostella vectensis]
Length=450

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 66/117 (56%), Gaps = 1/117 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV  F+ L+Y++E+YL  RQH   K        +  V+ ++ FEK+R Y +D+S + F H
Sbjct  7    AVFVFLWLVYLWESYLSYRQHKLFKETEDIPVELKDVLEKDTFEKARKYQLDRSTYGFYH  66

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQITD  530
               + +  S IL  G +P+ W  SG+ +   G  TE EI H+++FL   + +S ITD
Sbjct  67   GIYSQIETSVILLLGGIPFLWNISGNLIAKFGFTTEYEITHSMSFLICAVIFSTITD  123



>emb|CEJ00851.1| hypothetical protein RMCBS344292_14897 [Rhizopus microsporus]
Length=440

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 69/119 (58%), Gaps = 1/119 (1%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            Y + V+ F  ++Y FE YL+ RQH    +   P  L  ++++E F+KS+AY++DKS F F
Sbjct  11   YKQFVIVFSCIVYAFEQYLNYRQHCRYLMRHRPDELADIVTEEDFKKSQAYNLDKSRFGF  70

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTENEILHTLAFLAGVMFWSQIT  527
            +  F   +    +L++  LP  W  SGD L  + G +T+ EILH++ FL     +S +T
Sbjct  71   IESFYKQVETVLMLHYDALPKMWNFSGDLLYKISGYSTDYEILHSIVFLIIFTIFSTVT  129



>gb|KFM64976.1| CAAX prenyl protease 1-like protein, partial [Stegodyphus mimosarum]
Length=465

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = +3

Query  177  MEAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHF  353
            M A++ F  ++YI+E YL  RQH  ++  T   P + GV+ Q  + K+R Y++DKS F F
Sbjct  35   MTAIIAFTWVVYIWEAYLSYRQHVVMQKVTSVPPELAGVMDQTTYNKARLYNLDKSRFSF  94

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAF  494
            V      +  +A+L FG +P+ W  SG      G   E+EI HT+ F
Sbjct  95   VSSLYEQVFQTAVLVFGGIPFLWSASGKVTAHFGYGKEHEITHTVVF  141



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 68/139 (49%), Gaps = 23/139 (17%)
 Frame = +3

Query  129  VSLYLQLG--NSAMAFPYMEAVVGFMILMYIFETYLDIRQHAA------lklptlpkplV  284
            V L+ + G   SA   PY +  + FM L+++FETYLD+RQH         K        +
Sbjct  8    VPLFREPGWRPSASPVPYFQGALVFMTLVFLFETYLDLRQHRKLHDKQFPKPLAEAIEGL  67

Query  285  GVISQE---------------KFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWF  419
            G  SQ+               KF+KSRAY +DKS F FV      L  +  L  G LP+ 
Sbjct  68   GSYSQKEEEEEETTLLEATRTKFDKSRAYGLDKSTFGFVSGGYNQLEATVFLLLGYLPFA  127

Query  420  WKKSGDFLVFLGLNTENEI  476
            W  SG  L+ LGL+ +NEI
Sbjct  128  WTMSGKALLALGLDADNEI  146



>gb|ETI52023.1| hypothetical protein F443_04763 [Phytophthora parasitica P1569]
Length=484

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 66/150 (44%), Gaps = 36/150 (24%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  296
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  297  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  407
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  408  LPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
            LP+ W  S   L+ LGL+ +NEI   L  L
Sbjct  140  LPFMWTMSDKALLSLGLDADNEIYRALMLL  169



>gb|ELU11443.1| hypothetical protein CAPTEDRAFT_171238 [Capitella teleta]
Length=459

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 68/116 (59%), Gaps = 2/116 (2%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHA--AlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFV  356
            AV+ F+ ++Y++ETYL  RQ       +  +P  L GV+ +E FEK+R Y++D+S F F 
Sbjct  13   AVLAFLWVVYVWETYLSYRQRELYRSSVGKIPVELDGVLEEETFEKARLYNLDRSVFGFW  72

Query  357  HEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQI  524
                + +  S IL FG +P+ W+ SG  +   GL+ E EI  ++ FL G + +S I
Sbjct  73   SGLYSQITTSLILVFGGIPFLWRISGSLIAQFGLDAEYEITQSMVFLVGSVLYSTI  128



>gb|KFZ20107.1| hypothetical protein V502_03363 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=458

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIIIQQV  135



>emb|CDW75638.1| caax prenyl protease 1 homolog [Stylonychia lemnae]
Length=431

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 67/111 (60%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FPY+  V+ F + +Y+FE YL+ RQ+        PK +  +++Q++F+KS++++ DK +F
Sbjct  6    FPYLYCVITFELFVYLFELYLNWRQYKKFCENETPKEIEHLVTQKEFKKSQSHNKDKMEF  65

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLA  500
              + +++ IL +     F +  W W  S +  + +GLN E++ L TLAFL 
Sbjct  66   KMLQDYLGILANVVWQIFRLPVWLWAFSAEICIAVGLNPEDDSLRTLAFLG  116



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +3

Query  171  PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFH  350
            PY+   VGF + +Y+F TYLD+RQ  AL+ P+ P+ L G+ S E + K+RAY++DK  F 
Sbjct  19   PYLHLYVGFTVAVYLFHTYLDVRQLRALRRPSPPEALAGLFSPELYAKTRAYNLDKWSFS  78

Query  351  FVHEFVTILMDSAILYFGILPWFWKKSGDFL  443
            F H   + +   A++  G+LP+ W  SG+ L
Sbjct  79   FAHSLYSTVETLALILAGVLPYVWVFSGNLL  109



>ref|XP_002900396.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
 gb|EEY60189.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
Length=485

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 65/151 (43%), Gaps = 37/151 (25%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  296
            S    PY    + FM ++Y+ ETYLDIRQH  L     PKPL   I              
Sbjct  20   STSPVPYFLGALIFMTVVYLLETYLDIRQHRKLHDKQFPKPLTEAIEGLGSYNIKKKDEK  79

Query  297  ------------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFG  404
                                    Q KF+KSRAY +DKS F FVH     L   A L  G
Sbjct  80   EPEDDKREDADAQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEAIAFLLLG  139

Query  405  ILPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
             LP+ W  SG  L+FLGL+ +NEI   L  L
Sbjct  140  YLPFVWTMSGKALLFLGLDADNEIYRALMLL  170



>gb|KFY87676.1| hypothetical protein V500_06835 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=679

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  237  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  296

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  297  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIIIQQV  356



>gb|KFZ02509.1| hypothetical protein V501_09542 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=680

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  298  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLRFAPTRFSGEISHSIVFVLTFIIIQQV  357



>gb|KFY76197.1| hypothetical protein V499_04041 [Pseudogymnoascus pannorum VKM 
F-103]
Length=680

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  298  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLRFAPTRFSGEISHSIVFVLTFIIIQQV  357



>gb|EJY66600.1| CAAX prenyl protease-like protein [Oxytricha trifallax]
Length=484

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 71/133 (53%), Gaps = 0/133 (0%)
 Frame = +3

Query  102  SVIDLRSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkpl  281
            S+I  + L +S       S   FPY+ AV+ F IL+Y+FE YL+ RQ+       +PK +
Sbjct  8    SIIQPQDLQISHPQIFDTSKQVFPYIYAVLAFEILVYLFEQYLNWRQYKKYCEKEMPKEI  67

Query  282  VGVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLN  461
              +++ E+FEKS+A++ DK +F  +  ++     +    F +  W W  S      +GLN
Sbjct  68   TTIVTIEQFEKSQAHNKDKMEFELLKNYLEQFESTLWQLFRMPVWLWGYSVQLCELVGLN  127

Query  462  TENEILHTLAFLA  500
             +++   TLA++ 
Sbjct  128  PDDDSQRTLAYMG  140



>gb|EJY68063.1| Zn-dependent protease with chaperone function [Oxytricha trifallax]
Length=1433

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 72/133 (54%), Gaps = 0/133 (0%)
 Frame = +3

Query  102   SVIDLRSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkpl  281
             S+I  + L +S       S   FPY+ AV+ F IL+Y+FE YL+ RQ+       +PK +
Sbjct  968   SIIQPQDLKISHPQVFDTSKQVFPYIYAVLAFEILVYLFEQYLNWRQYKKYCEKEMPKEI  1027

Query  282   VGVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLN  461
               +++ E+FEKS+A++ DK +F F+  ++     +    F +  W W  S      +GL+
Sbjct  1028  TTIVTMEQFEKSQAHNKDKMEFEFLKNYLEQFESTLWQLFRMPVWLWGYSVQLCQLVGLD  1087

Query  462   TENEILHTLAFLA  500
              +++   TLA++ 
Sbjct  1088  PDDDSQRTLAYIG  1100



>ref|XP_008861314.1| hypothetical protein H310_00342 [Aphanomyces invadans]
 gb|ETW09903.1| hypothetical protein H310_00342 [Aphanomyces invadans]
Length=472

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 67/144 (47%), Gaps = 28/144 (19%)
 Frame = +3

Query  150  GNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVI------------  293
            G  A A PY+E  + F+ +M++FETYLDIRQH  L   TLP  L   I            
Sbjct  10   GWRASAVPYLEGTILFICVMHVFETYLDIRQHRKLYETTLPDKLSRAIRHVDEQNIDKKH  69

Query  294  ----------------SQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWK  425
                            +  KF+K R YS+DKS F FVH+   +    A+L  G +P+ W+
Sbjct  70   GGVQGKGHEVASLLEQTTAKFDKCRLYSLDKSRFKFVHDTFQVADGLAMLVLGYMPFMWQ  129

Query  426  KSGDFLVFLGLNTENEILHTLAFL  497
                 L   G    NEI+ +L F+
Sbjct  130  YCRALLASFGYTPTNEIMVSLTFV  153



>gb|KFY59517.1| hypothetical protein V496_05652 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=458

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWNLTGSWLLQFAPTRFSGEISHSIVFVLTFIIIQQV  135



>gb|ESA09906.1| hypothetical protein GLOINDRAFT_80760 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73371.1| Ste24p [Rhizophagus irregularis DAOM 197198w]
Length=430

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-QEKFEKSRAYSI  332
             A   PY E V+ F   +Y FE YL +RQ+  L+ P  PK L  +   +EKF K++ Y +
Sbjct  9    KAQDTPYKEFVLAFSWAVYTFEQYLSVRQYRKLREPHPPKSLQDIEEVREKFRKTQEYGL  68

Query  333  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAF  494
            DK+ F FV      +  + ++ F ILPW W  SG++L + G   ++EI  +L F
Sbjct  69   DKAKFEFVSALFGQIQSTCMIVFDILPWLWNLSGEWLAYAGYGPDHEITQSLIF  122



>gb|KFY38041.1| hypothetical protein V494_04536 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=527

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  85   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  144

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ +       EI H++ F+   +   Q+
Sbjct  145  SFVSSLYGQIQNTAFIYYDILPKLWGLTGSWLLQYAPARFSGEISHSIVFVLTFIIIQQV  204



>gb|EPB83925.1| hypothetical protein HMPREF1544_09315 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=442

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            Y + V+GF +++Y+FE YL+ RQ+    +P  P  L  ++++E F+K++ Y+ DKS F F
Sbjct  13   YKQFVLGFTVIVYVFEQYLNYRQYTRYLMPKRPSELADIVTEEDFKKAQLYNYDKSRFAF  72

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTENEILHTLAFLAGVMFWSQIT  527
            V     ++    IL+F  LP  W  +GD L  + G   E EIL +L F+      S +T
Sbjct  73   VENLYKLIETMLILHFDGLPKIWDTAGDILFKVSGYGAEYEILQSLVFITLFTLISTVT  131



>gb|KFX89268.1| hypothetical protein V490_07139 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFX89748.1| hypothetical protein O988_08517 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY43474.1| hypothetical protein V495_03913 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY52182.1| hypothetical protein V497_08611 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=458

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   QI
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIVIQQI  135



>gb|KFY09356.1| hypothetical protein V492_05514 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=698

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  256  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  315

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV      + ++A +Y+ ILP  W  +G +L+ +       EI H++ F+
Sbjct  316  SFVSSLYGQIQNTAFIYYDILPKLWGLTGSWLLQYAPTRFSGEISHSIVFV  366



>gb|ELR10214.1| STE24 endopeptidase [Pseudogymnoascus destructans 20631-21]
Length=487

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  45   FPWKKLIVGFSLAQYLFESFLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  104

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  105  SFVSSLYGQVQNTAFIYYDILPKLWTLTGSWLIQFAPTRFSGEISHSIVFVLTFIIIQQV  164



>dbj|GAN04268.1| metallopeptidase [Mucor ambiguus]
Length=442

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            Y + V GF I++Y+FE YL+ RQ+    +P  P  L  ++++E F+K++ Y+ DKS F F
Sbjct  13   YKQFVEGFTIIVYVFEQYLNYRQYTRYLMPKRPSELADIVTEEDFKKAQLYNYDKSRFSF  72

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTENEILHTLAFLAGVMFWSQIT  527
            V     ++    +L++  LP  W  +GD L  + G   E EILH+L FL      S IT
Sbjct  73   VVNLWKLVETVLMLHYDGLPKIWDAAGDILFKVAGYGAEYEILHSLVFLTLFTLISTIT  131



>emb|CEP19164.1| hypothetical protein [Parasitella parasitica]
Length=442

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            Y + V+ F  ++Y+FE YL+ RQH    +P  P  L  ++S++ F+K++AY+ +KS F F
Sbjct  13   YKQFVLAFSCIVYVFEQYLNYRQHTRYLMPKRPSELADIVSEDDFKKAQAYNYEKSRFAF  72

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTENEILHTLAFLAGVMFWSQITD  530
            V      +    +LY+  LP  W  SG+ L+ + G  +E EIL +L FL      S +T 
Sbjct  73   VEGLYKQVETVLMLYYDALPKIWNASGEILLKVSGYGSEYEILQSLVFLTLFSLISTVTQ  132



>ref|XP_003050604.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU44891.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=868

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FET+L +RQ+  L+    P  L   +SQE F+KS+AY   K+ F
Sbjct  420  FPWKKLIMGFSVGQYLFETFLTLRQYRVLQNTKPPVVLSKEVSQEVFDKSQAYGRAKAKF  479

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              V+   + L + A ++F ILP  W  SGD L+ F       EI HT+ F+      SQI
Sbjct  480  EIVNGLYSQLQNIAFMHFDILPKLWSWSGDLLLKFAPARFTGEISHTIVFVLTFAAISQI  539



>gb|KFY19341.1| hypothetical protein V493_08005 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=458

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIMIQQV  135



>gb|KFY04966.1| hypothetical protein V491_09229 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=678

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  236  FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  295

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  296  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPARFSGEISHSIVFVLTFIIIQQV  355



>emb|CDH48818.1| prenyl protease [Lichtheimia corymbifera JMRC:FSU:9682]
Length=447

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            Y + V+GF   +Y FE YL+ RQH    +   P+ L  ++++  F KS++Y+++KS F F
Sbjct  16   YKDYVLGFSCAVYAFEQYLNYRQHCRYLMRERPQDLADIVNETDFSKSQSYNLEKSRFAF  75

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQITD  530
            V      L     L++ +LPW W  SG  L  + G  +E EIL ++ F+    F S  T 
Sbjct  76   VENAYKQLEILLQLHYDVLPWLWDFSGRLLSQYAGYGSEYEILQSMVFMTVYSFISTATS  135



>ref|XP_006681887.1| hypothetical protein BATDEDRAFT_17759 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77279.1| hypothetical protein BATDEDRAFT_17759 [Batrachochytrium dendrobatidis 
JAM81]
Length=438

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 6/118 (5%)
 Frame = +3

Query  171  PYMEAVVGFMILMYIFETYLDIRQHA-----AlklptlpkplVGVISQEKFEKSRAYSID  335
            P+ E V+ F  +++ +ETYL++RQH       +            +S + FEKSR YS D
Sbjct  15   PWKEYVLIFSFIVFFWETYLNVRQHKKLGIKTIPAQVHKAFEPHTLSIQDFEKSRHYSYD  74

Query  336  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVM  509
            KS ++F+    + L  + I  F +LPW W  +G+    LG   E EIL ++ F AGV 
Sbjct  75   KSTYNFIATAYSQLETTLIFSFNLLPWVWTYAGNLRARLGYGVEAEILQSVIF-AGVC  131



>gb|KFH61944.1| hypothetical protein MVEG_12278 [Mortierella verticillata NRRL 
6337]
Length=450

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = +3

Query  165  AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  344
            AFPYM  ++G   L + +E Y+  R +  L    LP  L G +S+E+F K++AY  DK+ 
Sbjct  21   AFPYMNTLLGCKYLFFFWEQYILYRHYRNLCSKVLPTALKGYVSEEQFRKAQAYGRDKTR  80

Query  345  FHFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAF  494
              F     +++ +S  L   +LPW W  SG  +  FLGL++++EI+ +L F
Sbjct  81   CSFSKATFSLVQESLWLTCDVLPWLWGVSGRIMFRFLGLDSKHEIVQSLIF  131



>emb|CCO33594.1| STE24 endopeptidase [Rhizoctonia solani AG-1 IB]
Length=211

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +3

Query  186  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  365
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  + + 
Sbjct  31   VLAFSWGVWAFETYLIYRQFPNYSRPHPPAALKSHFTDEVFRKSQRYGKDKAKFGLISKL  90

Query  366  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAF  494
             + L+++A++ FG  PW WK SG  L   G   E EI+H++AF
Sbjct  91   YSQLLETALIVFGSFPWAWKISGSLLAKFGYGPEYEIVHSIAF  133



>gb|ESZ94952.1| putative CAAX prenyl protease 1 [Sclerotinia borealis F-4157]
Length=462

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFEGFLSLRQYQVLKQTRPPKVLSNEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNT-ENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +YF +LP  W+ +G +L+ L       EI H++ F+   +   QI
Sbjct  76   GFVAGLYGQIQNTAFIYFDVLPKLWELTGSWLLQLAPARFSGEISHSIVFVLTFIIIQQI  135



>emb|CDS07769.1| hypothetical protein LRAMOSA01718 [Absidia idahoensis var. thermophila]
Length=447

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +3

Query  174  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  353
            Y + V+GF   +Y FE YL+ RQH    +   P  L  ++++  F KS++Y+++KS F F
Sbjct  16   YKDYVLGFSCAVYAFEQYLNYRQHRRYLMRERPHDLADIVNETDFSKSQSYNLEKSRFAF  75

Query  354  VHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQITD  530
            V      L     L++ +LPW W  SG  L  + G  +E EIL ++ F+    F S  T 
Sbjct  76   VENAYKQLEILLQLHYDVLPWLWDFSGRLLSQYAGYGSEYEILQSMVFMTVYSFISTATS  135



>ref|XP_539577.3| PREDICTED: CAAX prenyl protease 1 homolog [Canis lupus familiaris]
Length=473

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  20   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  79

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G  TE EI  +L FL     +S +T
Sbjct  80   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGTEYEITQSLVFLLLATLFSALT  135



>ref|XP_002154940.2| PREDICTED: CAAX prenyl protease 1 homolog [Hydra vulgaris]
Length=385

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 60/123 (49%), Gaps = 1/123 (1%)
 Frame = +3

Query  162  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDK  338
            M  P    V+ FM + +++ETYL  RQH            +   + ++ FEKSR Y +D+
Sbjct  1    MVDPIFAGVLTFMWITFLWETYLSYRQHKVYLNTKDIPVELKDSLDKQTFEKSRLYQVDR  60

Query  339  SDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWS  518
            S F FV    + L  + IL FG LP+ W  SG     LG +  +EI  +  FL     +S
Sbjct  61   SKFGFVSSIYSQLELTVILLFGGLPFLWAVSGSLNEALGFDATHEIKQSCVFLVLSTLFS  120

Query  519  QIT  527
             +T
Sbjct  121  TVT  123



>ref|XP_001559859.1| hypothetical protein BC1G_01418 [Botrytis cinerea B05.10]
 emb|CCD46490.1| similar to CaaX prenyl protease [Botrytis cinerea T4]
 gb|EMR91295.1| putative caax prenyl protease 1 protein [Botrytis cinerea BcDW1]
Length=456

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFEGFLSLRQYQVLKQTRPPKVLSNEVSQEVFDKSQAYGRAKAQF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNT-ENEILHTLAFL  497
             FV      + ++A +YF ILP  W  +G +L+ L       EI H++ F+
Sbjct  76   GFVAGLYGQIQNTAFIYFDILPKLWDFTGSWLLRLAPARFTGEISHSIVFV  126



>ref|XP_008080326.1| hypothetical protein GLAREA_07447 [Glarea lozoyensis ATCC 20868]
 gb|EHK96814.1| putative CAAX prenyl protease 1 [Glarea lozoyensis 74030]
 gb|EPE32314.1| hypothetical protein GLAREA_07447 [Glarea lozoyensis ATCC 20868]
Length=456

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ +
Sbjct  16   FPWKKLIVGFSLAQYAFEGFLSLRQYQVLKQTKPPKVLKNEVSQEVFDKSQAYGRAKAKY  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +YF ILP  W  +G +LV +       EI H++ F+   +   QI
Sbjct  76   GFVSGLYGQIQNTAFIYFDILPKLWALTGSWLVSYAPPRFSGEISHSIVFVLSFIVIQQI  135



>ref|XP_001593172.1| hypothetical protein SS1G_06094 [Sclerotinia sclerotiorum 1980]
 gb|EDO03613.1| hypothetical protein SS1G_06094 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=461

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLTQYLFEGFLSLRQYQILKQTRPPKVLSNEVSQEVFDKSQAYGRAKAQF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNT-ENEILHTLAFLAGVMFWSQI  524
             FV      + ++A +YF +LP  W  +G +L+ L       EI H++ F+   +   QI
Sbjct  76   GFVAGLYGQIQNTAFIYFDVLPKLWDLTGSWLLRLAPARFTGEISHSIVFVLTFVVIQQI  135



>ref|XP_008149410.1| PREDICTED: CAAX prenyl protease 1 homolog [Eptesicus fuscus]
Length=473

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  20   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  79

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  80   GLYSEMEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLMATLFSALT  135



>ref|XP_006098203.1| PREDICTED: CAAX prenyl protease 1 homolog [Myotis lucifugus]
Length=475

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLMATLFSALT  137



>ref|XP_010593554.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Loxodonta 
africana]
Length=393

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 5/126 (4%)
 Frame = +3

Query  165  AFPYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYS  329
            A P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y 
Sbjct  12   AMPAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQ  71

Query  330  IDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVM  509
            +DKS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL    
Sbjct  72   LDKSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLAT  131

Query  510  FWSQIT  527
             +S +T
Sbjct  132  LFSALT  137



>ref|XP_005868719.1| PREDICTED: CAAX prenyl protease 1 homolog [Myotis brandtii]
 gb|EPQ09249.1| CAAX prenyl protease 1 like protein [Myotis brandtii]
Length=475

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLMATLFSALT  137



>ref|XP_007536149.1| PREDICTED: CAAX prenyl protease 1 homolog [Erinaceus europaeus]
Length=475

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ETYL  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETYLAQRQRRIYKTTTHVPMELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G  +E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYGGFGSEYEITQSLVFLLLATLFSALT  137



>dbj|GAA32070.1| STE24 endopeptidase [Clonorchis sinensis]
Length=472

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (58%), Gaps = 13/118 (11%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQ-HAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVH  359
            AV  F+ L+Y++ETYLD RQ    L    +P  LV VI+ ++F KS+AY +DK  F F H
Sbjct  19   AVFCFLWLVYLWETYLDRRQRQVVLNTSNVPSELVHVINADEFSKSKAYVLDKMMFSFFH  78

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFL------------VFLGLNTENEILHTLAFL  497
            +   +L  + +L+F ++PW W K  +              V +GL++E+EIL +L FL
Sbjct  79   DAYDMLEATLVLWFSVVPWLWDKVTEHAAPLNKSIKNLLGVDIGLSSESEILCSLLFL  136



>ref|XP_004371951.1| PREDICTED: CAAX prenyl protease 1 homolog [Trichechus manatus 
latirostris]
Length=475

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 65/124 (52%), Gaps = 5/124 (4%)
 Frame = +3

Query  171  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  335
            P  E + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  14   PAEERIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLD  73

Query  336  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFW  515
            KS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL     +
Sbjct  74   KSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLATLF  133

Query  516  SQIT  527
            S +T
Sbjct  134  SALT  137



>ref|XP_005848523.1| hypothetical protein CHLNCDRAFT_22375, partial [Chlorella variabilis]
 gb|EFN56421.1| hypothetical protein CHLNCDRAFT_22375, partial [Chlorella variabilis]
Length=372

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = +3

Query  156  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  335
            S   FP++EAV  F   +++  TYLD RQ  AL+LP  P  +  + S+E+FEK RAY+ D
Sbjct  4    SGDGFPWLEAVAVFNTAVFLVHTYLDTRQQHALRLPAPPPVVAHLYSKEEFEKKRAYNQD  63

Query  336  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
            K  +  VH     ++++ +L  G LP  W+ +G  L   G   + EI  T+A++
Sbjct  64   KLRYSMVHGQWDFVLNTGLLLAGFLPATWRLAGALLARWGW--DGEIPQTVAWV  115



>ref|XP_009168050.1| hypothetical protein T265_13631, partial [Opisthorchis viverrini]
 gb|KER28247.1| hypothetical protein T265_13631, partial [Opisthorchis viverrini]
Length=472

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 69/118 (58%), Gaps = 13/118 (11%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklpt-lpkplVGVISQEKFEKSRAYSIDKSDFHFVH  359
            AV  F+ L+Y++ETYLD RQ   +   + +P  LV VI+ ++F KS+AY +DK  F F H
Sbjct  19   AVFCFLWLVYLWETYLDRRQRQVVLNTSDVPSELVHVINADEFSKSKAYVLDKMMFSFFH  78

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFL------------VFLGLNTENEILHTLAFL  497
            +   +L  + +L+F ++PW W K  +              V +GL++E+EIL +L FL
Sbjct  79   DAYDMLEATLVLWFSVVPWLWDKVTEHAAPLNKSIKNLLGVDIGLSSESEILCSLLFL  136



>ref|XP_003415368.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Loxodonta 
africana]
Length=475

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 5/126 (4%)
 Frame = +3

Query  165  AFPYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYS  329
            A P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y 
Sbjct  12   AMPAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQ  71

Query  330  IDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVM  509
            +DKS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL    
Sbjct  72   LDKSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLAT  131

Query  510  FWSQIT  527
             +S +T
Sbjct  132  LFSALT  137



>gb|EER44696.1| CaaX prenyl protease [Histoplasma capsulatum H143]
Length=456

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ  F+KS+AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV    + + + A +Y+ +LP  W  +G FL  ++      EI HTLAF+
Sbjct  76   GFVSGLYSQIQNLAFIYYDVLPKLWAVTGLFLTRYMPERFTGEISHTLAFV  126



>gb|EGC45621.1| CaaX prenyl protease [Histoplasma capsulatum H88]
Length=456

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ  F+KS+AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV    + + + A +Y+ +LP  W  +G FL  ++      EI HTLAF+
Sbjct  76   GFVSGLYSQIQNLAFIYYDVLPKLWAVTGLFLTRYMPERFTGEISHTLAFV  126



>gb|EEH10632.1| CaaX prenyl protease [Histoplasma capsulatum G186AR]
Length=456

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ  F+KS+AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV    + + + A +Y+ +LP  W  +G FL  ++      EI HTLAF+
Sbjct  76   GFVSGLYSQIQNLAFIYYDVLPKLWAVTGLFLTRYMPERFTGEISHTLAFV  126



>emb|CEL61202.1| STE24 endopeptidase [Rhizoctonia solani AG-1 IB]
Length=440

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +3

Query  186  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  365
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  + + 
Sbjct  31   VLAFSWGVWAFETYLIYRQFPNYSRPHPPAALKSHFTDEVFRKSQRYGKDKAKFGLISKL  90

Query  366  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAF  494
             + L+++A++ FG  PW WK SG  L   G   E EI+H++AF
Sbjct  91   YSQLLETALIVFGSFPWAWKISGSLLAKFGYGPEYEIVHSIAF  133



>emb|CCT67513.1| probable zinc metallo-protease [Fusarium fujikuroi IMI 58289]
Length=463

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              ++ F + + + A ++F +LP  W  +GD L+ +       EI HT+ F+      SQ+
Sbjct  76   EIINGFYSQVQNIAFMHFDVLPKLWSWTGDLLLRWAPARFTGEISHTIVFVLTFAVISQL  135



>ref|XP_008999216.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Callithrix 
jacchus]
Length=427

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYVWETFLAQRQRRIYKTTTQVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_001239931.1| hypothetical protein CIMG_09552 [Coccidioides immitis RS]
 gb|EAS28348.1| CaaX prenyl protease [Coccidioides immitis RS]
Length=455

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYRILQQKKPPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV    + + + A +Y+  LP  W  +G +L  +L    + EI HTL F+
Sbjct  76   GFVSGLYSQIQNLAFIYYDALPKLWAVTGLWLTRYLPERFQGEITHTLVFV  126



>ref|XP_008589088.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Galeopterus 
variegatus]
Length=427

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 59/106 (56%), Gaps = 1/106 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
               + +  + IL FG +P+ W+ SG F  + G   E+EI  +L FL
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEHEITQSLVFL  127



>ref|XP_002584079.1| hypothetical protein UREG_04768 [Uncinocarpus reesii 1704]
 gb|EEP79926.1| hypothetical protein UREG_04768 [Uncinocarpus reesii 1704]
Length=456

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 1/110 (1%)
 Frame = +3

Query  171  PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFH  350
            P+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQE FEKS+AY   K+ F 
Sbjct  17   PWKKIIVGFSLGQYLLEGFLSLRQYKVLQQKRPPKVLEGEVSQEVFEKSQAYGRAKAKFG  76

Query  351  FVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
            FV    + + + A +Y+  LP  W  +G +L  +L    + EI HTL F+
Sbjct  77   FVSGLYSQIQNLAFIYYDALPKLWAVTGIWLTRYLPDRFQGEITHTLVFV  126



>ref|XP_003067440.1| CAAX prenyl protease, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER25295.1| CAAX prenyl protease, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW19732.1| CaaX prenyl protease [Coccidioides posadasii str. Silveira]
Length=455

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYRILQQKKPPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV    + + + A +Y+  LP  W  +G +L  +L    + EI HTL F+
Sbjct  76   GFVSGLYSQIQNLAFIYYDALPKLWAVTGLWLTRYLPERFQGEITHTLVFV  126



>ref|XP_002750699.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Callithrix 
jacchus]
Length=475

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYVWETFLAQRQRRIYKTTTQVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_003799067.1| PREDICTED: CAAX prenyl protease 1 homolog [Otolemur garnettii]
Length=446

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G  +E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGSEYEITQSLVFLLLATLFSALT  137



>ref|XP_004910060.1| PREDICTED: CAAX prenyl protease 1 homolog [Heterocephalus glaber]
Length=474

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  ++G   E EI+H+L FL     +S +T
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGRFCGYVGFGPEYEIIHSLVFLLLATLFSALT  137



>ref|XP_004851106.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Heterocephalus 
glaber]
Length=424

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  ++G   E EI+H+L FL     +S +T
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGRFCGYVGFGPEYEIIHSLVFLLLATLFSALT  137



>ref|XP_008589087.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Galeopterus 
variegatus]
Length=475

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 59/106 (56%), Gaps = 1/106 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
               + +  + IL FG +P+ W+ SG F  + G   E+EI  +L FL
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEHEITQSLVFL  127



>ref|XP_004591591.1| PREDICTED: CAAX prenyl protease 1 homolog [Ochotona princeps]
Length=475

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ WK SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTFILLFGGIPYLWKLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_004450692.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Dasypus 
novemcinctus]
Length=366

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ETYL  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETYLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRISGWFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_002715233.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryctolagus cuniculus]
Length=473

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  20   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  79

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ WK SG F  + G   E EI  +L FL     +S +T
Sbjct  80   GLYSEVEGTFILLFGGIPYLWKLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  135



>ref|XP_004851105.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Heterocephalus 
glaber]
Length=475

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  ++G   E EI+H+L FL     +S +T
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGRFCGYVGFGPEYEIIHSLVFLLLATLFSALT  137



>ref|XP_004415415.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004415416.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Odobenus 
rosmarus divergens]
Length=475

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_010861023.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Bison bison 
bison]
Length=475

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_005898693.1| PREDICTED: CAAX prenyl protease 1 homolog [Bos mutus]
Length=475

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_010345848.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Saimiri 
boliviensis boliviensis]
Length=427

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>gb|ELR54320.1| CAAX prenyl protease 1-like protein [Bos mutus]
Length=476

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|NP_001179857.1| CAAX prenyl protease 1 homolog [Bos taurus]
 tpg|DAA31098.1| TPA: zinc metallopeptidase [Bos taurus]
Length=475

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>emb|CAQ86908.1| CAAX prenyl protease [Acremonium chrysogenum]
Length=200

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  YIFE++L +RQ+  L+ P  P  L   ++ E F KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGHYIFESFLTMRQYRVLQRPQPPAVLAKEVTPETFAKSQAYGRAKARF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              V      + + A ++F +LP  W  +GD L+ F       EI H++ F+ G +   Q+
Sbjct  76   QIVEGLWDQIQNLAFIHFDVLPKLWSFTGDILLRFAPARFTGEISHSIVFVLGFLVAQQV  135



>ref|XP_006061988.1| PREDICTED: CAAX prenyl protease 1 homolog [Bubalus bubalis]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_004001889.1| PREDICTED: CAAX prenyl protease 1 homolog [Ovis aries]
 ref|XP_005678699.1| PREDICTED: CAAX prenyl protease 1 homolog [Capra hircus]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_006737576.1| PREDICTED: CAAX prenyl protease 1 homolog [Leptonychotes weddellii]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_011233459.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Ailuropoda 
melanoleuca]
Length=427

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>gb|KFH71808.1| hypothetical protein MVEG_02102 [Mortierella verticillata NRRL 
6337]
Length=451

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = +3

Query  165  AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  344
             FPY   V+GFM+L++ +E YL +R ++ L+    PK L   ++ E+F+K++AY  DK+ 
Sbjct  24   PFPYKAFVLGFMLLVFYWEEYLRLRHYSNLRSKECPKALREHVTDEEFQKAQAYGRDKAT  83

Query  345  FHFVHEFVTILMDSAILYFGILPWFWKKSGDFL-VFLGLNTENEILHTLAFLA  500
            F FV   V  +  + +L    LPW W  SG  +    G  ++ EI  ++ F A
Sbjct  84   FGFVSNLVDQIQSALMLVLDFLPWLWGVSGRVMFAATGFGSDYEITQSIIFFA  136



>ref|XP_003937059.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Saimiri 
boliviensis boliviensis]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_005543897.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Macaca 
fascicularis]
Length=427

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_004025583.1| PREDICTED: CAAX prenyl protease 1 homolog [Gorilla gorilla gorilla]
Length=422

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_007453816.1| PREDICTED: CAAX prenyl protease 1 homolog [Lipotes vexillifer]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_004450691.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 1 [Dasypus 
novemcinctus]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ETYL  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETYLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRISGWFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_002927608.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Ailuropoda 
melanoleuca]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_003989947.2| PREDICTED: CAAX prenyl protease 1 homolog [Felis catus]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_010352520.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Rhinopithecus 
roxellana]
Length=427

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_006215922.1| PREDICTED: CAAX prenyl protease 1 homolog [Vicugna pacos]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_007977466.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Chlorocebus 
sabaeus]
Length=427

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_007114324.1| PREDICTED: CAAX prenyl protease 1 homolog [Physeter catodon]
Length=432

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_006188105.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelus ferus]
Length=475

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_003962545.1| PREDICTED: CAAX prenyl protease 1 homolog [Takifugu rubripes]
Length=467

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+GF   +Y++E YL  RQ    +  T   P +G +I  E F+KSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRKIYRTTTHVPPELGKIIDSETFQKSRLYQLDKSNFGFWS  76

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               +    + IL  G +P+ W  +G      GL +E EI  +L FL     +S +T
Sbjct  77   GLYSETEGTLILILGGIPFLWNIAGSVTARFGLGSEYEITQSLVFLTLATLFSAVT  132



>ref|XP_008710233.1| PREDICTED: CAAX prenyl protease 1 homolog [Ursus maritimus]
Length=529

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_006867649.1| PREDICTED: CAAX prenyl protease 1 homolog [Chrysochloris asiatica]
Length=475

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 5/124 (4%)
 Frame = +3

Query  171  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  335
            P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  14   PAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLD  73

Query  336  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFW  515
            KS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL     +
Sbjct  74   KSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLATLF  133

Query  516  SQIT  527
            S +T
Sbjct  134  SALT  137



>ref|XP_007977465.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Chlorocebus 
sabaeus]
Length=475

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|NP_001244375.1| CAAX prenyl protease 1 homolog [Macaca mulatta]
 ref|XP_005543896.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Macaca 
fascicularis]
 gb|EHH14652.1| hypothetical protein EGK_00615 [Macaca mulatta]
 gb|EHH49811.1| hypothetical protein EGM_00534 [Macaca fascicularis]
Length=475

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_010352519.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Rhinopithecus 
roxellana]
Length=475

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>emb|CAH92474.1| hypothetical protein [Pongo abelii]
Length=493

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_007077458.1| PREDICTED: CAAX prenyl protease 1 homolog [Panthera tigris altaica]
Length=473

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_513352.2| PREDICTED: CAAX prenyl protease 1 homolog [Pan troglodytes]
Length=475

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|NP_001126457.1| CAAX prenyl protease 1 homolog [Pongo abelii]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_003815473.1| PREDICTED: CAAX prenyl protease 1 homolog [Pan paniscus]
Length=476

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_003273371.1| PREDICTED: CAAX prenyl protease 1 homolog [Nomascus leucogenys]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_010995251.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Camelus dromedarius]
Length=481

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_010958108.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Camelus bactrianus]
Length=483

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_005317922.1| PREDICTED: CAAX prenyl protease 1 homolog [Ictidomys tridecemlineatus]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDAETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_004266443.1| PREDICTED: CAAX prenyl protease 1 homolog [Orcinus orca]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_005970531.1| PREDICTED: CAAX prenyl protease 1 homolog [Pantholops hodgsonii]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_004316653.1| PREDICTED: CAAX prenyl protease 1 homolog [Tursiops truncatus]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_004426071.1| PREDICTED: CAAX prenyl protease 1 homolog [Ceratotherium simum 
simum]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E E+  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGQFCGYAGFGPEYEVTQSLVFLLLATLFSALT  137



>ref|XP_006165004.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Tupaia chinensis]
Length=478

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKATTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W  SG F  + G   E EI+ +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWSLSGRFCGYAGFGPEYEIMQSLVFLLLATLFSALT  137



>ref|XP_006758037.1| PREDICTED: CAAX prenyl protease 1 homolog [Myotis davidii]
 gb|ELK34617.1| CAAX prenyl protease 1 like protein [Myotis davidii]
Length=475

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGSAGFGPEYEITQSLVFLLMATLFSALT  137



>ref|XP_008522391.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Equus przewalskii]
Length=434

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 1/106 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFL  127



>ref|XP_009254473.1| hypothetical protein FPSE_03079 [Fusarium pseudograminearum CS3096]
 gb|EKJ76893.1| hypothetical protein FPSE_03079 [Fusarium pseudograminearum CS3096]
Length=463

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              V+   + + + A ++F +LP  W  +GD L+ +       EI HT+ F+      SQ+
Sbjct  76   EIVNGLYSQVQNIAFMHFDVLPKLWSWTGDLLLKWAPARFTGEISHTIVFVLTFTVISQL  135



>ref|XP_007950886.1| PREDICTED: CAAX prenyl protease 1 homolog [Orycteropus afer afer]
Length=475

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 5/124 (4%)
 Frame = +3

Query  171  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  335
            P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  14   PAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLD  73

Query  336  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFW  515
            KS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL     +
Sbjct  74   KSTFSFWSGLYSEIEGTFILLFGGIPYLWRLSGRFCGYAGFGQEYEIIQSLVFLLLATLF  133

Query  516  SQIT  527
            S +T
Sbjct  134  SALT  137



>gb|EUC55856.1| CAAX prenyl protease, partial [Rhizoctonia solani AG-3 Rhs1AP]
Length=452

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +3

Query  186  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  365
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  V + 
Sbjct  31   VLAFSWGVWAFETYLTYRQFPNYSRPHPPTALKSHFTDEVFNKSQRYGKDKARFSLVSKL  90

Query  366  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAF  494
             + L+++ ++  G  PW WK SG  L   G   E EI H++AF
Sbjct  91   YSQLLETGMITLGAFPWAWKVSGSLLARFGYGPEYEITHSIAF  133



>ref|NP_001288163.1| zinc metallopeptidase STE24 [Equus caballus]
 ref|XP_008522390.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Equus przewalskii]
Length=475

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 1/106 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFL  497
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFL  127



>ref|XP_009028164.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
 gb|ESN93745.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
Length=1187

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = +3

Query  189  VGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVHEF  365
            + F+  M+I+E YL  RQ    K  T+   ++  ++  E FEK+R Y++DKS+F F    
Sbjct  32   LAFLWFMFIWELYLAYRQRKIFKNVTVRPKVIESIMDSESFEKARLYNLDKSNFAFWSGL  91

Query  366  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
             + +  + I++F +L + W  S + +V+ GLN + EI  +L F +    +S IT
Sbjct  92   YSQIETTVIIWFFLLSYAWDWSENIVVYFGLNKDYEITQSLVFTSITSLYSLIT  145



>gb|KEP46996.1| CAAX prenyl protease [Rhizoctonia solani 123E]
Length=483

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +3

Query  186  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  365
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  V + 
Sbjct  31   VLAFSWGVWAFETYLTYRQFPNYSRPHPPTALKSHFTDEVFNKSQRYGKDKARFSLVSKL  90

Query  366  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAF  494
             + L+++ ++  G  PW WK SG  L   G   E EI H++AF
Sbjct  91   YSQLLETGMITLGAFPWAWKVSGSLLARFGYGPEYEITHSIAF  133



>gb|KIN03786.1| hypothetical protein OIDMADRAFT_158613 [Oidiodendron maius Zn]
Length=456

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+   +VGF I  Y+FE +L +RQ+  LK    PK L   +SQ+ F+KS+AY   K+ +
Sbjct  16   FPWKNLIVGFSIAQYLFEGFLSLRQYRVLKQTRPPKVLQNEVSQDVFDKSQAYGRAKAKY  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              ++     + ++A +YF +LP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  76   SLINGLYGQIQNTAFIYFDVLPKLWTLTGSWLLRFAPARFTGEISHSIVFVLSFIVIQQV  135



>ref|XP_001540370.1| CaaX prenyl protease [Histoplasma capsulatum NAm1]
 gb|EDN07700.1| CaaX prenyl protease [Histoplasma capsulatum NAm1]
Length=453

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  YI E +L +RQ+  L+    PK L   +SQ  F+KS+AY   K+ F
Sbjct  13   FPWKKVIVGFSVGQYIIEGFLSLRQYKILQQKKPPKVLAEEVSQSVFDKSQAYGRAKAKF  72

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV    + + + A +Y+  LP  W  +G FL  ++      EI HTLAF+
Sbjct  73   GFVSGLYSQIQNLAFIYYDALPKLWALTGLFLSRYMPKRFTGEISHTLAFV  123



>gb|EZF34879.1| hypothetical protein H101_01566, partial [Trichophyton interdigitale 
H6]
Length=315

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV    + + + A +Y  +LP  W  +G  L  +       EI HTL F+
Sbjct  76   GFVSGLYSQIQNLAFIYGDVLPKLWGATGLLLAKYAPEGFRGEITHTLLFV  126



>dbj|BAA33727.1| Ste24p [Homo sapiens]
Length=475

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|NP_005848.2| CAAX prenyl protease 1 homolog [Homo sapiens]
 sp|O75844.2|FACE1_HUMAN RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Homo sapiens]
 gb|AAC68866.1| CAAX prenyl protease [Homo sapiens]
 emb|CAB46277.1| farnesylated-proteins converting enzyme 1 [Homo sapiens]
 gb|EAX07233.1| zinc metallopeptidase (STE24 homolog, yeast), isoform CRA_a [Homo 
sapiens]
 gb|EAX07234.1| zinc metallopeptidase (STE24 homolog, yeast), isoform CRA_a [Homo 
sapiens]
 dbj|BAG52049.1| unnamed protein product [Homo sapiens]
Length=475

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_010624212.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Fukomys 
damarensis]
Length=424

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W  SG F  ++G   E EI+H+L FL     +S +T
Sbjct  82   GLYSEVEGTFILLFGGIPYLWSLSGRFCGYVGFGPEYEIIHSLMFLLLATLFSALT  137



>ref|XP_007164766.1| PREDICTED: CAAX prenyl protease 1 homolog [Balaenoptera acutorostrata 
scammoni]
Length=475

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLSRRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGHAGFGPEYEITQSLVFLLLATLFSALT  137



>gb|KDN36071.1| hypothetical protein RSAG8_11093, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=483

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 57/115 (50%), Gaps = 0/115 (0%)
 Frame = +3

Query  186  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  365
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  V + 
Sbjct  31   VLAFSWGVWAFETYLIARQFPNYNRPHPPTALKSHFTDEVFIKSQRYGKDKARFGLVSKL  90

Query  366  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQITD  530
             + L+++ ++  G  PW WK SG  L   G   E EI H+LAF   + F + I +
Sbjct  91   YSQLLETGMITLGAFPWAWKASGSLLARFGYGPEYEIAHSLAFGTVLFFLTTIPN  145



>ref|XP_011324509.1| hypothetical protein FGSG_12839 [Fusarium graminearum PH-1]
 gb|ESU11933.1| hypothetical protein FGSG_12839 [Fusarium graminearum PH-1]
 gb|EYB33412.1| hypothetical protein FG05_12839 [Fusarium graminearum]
 emb|CEF86797.1| unnamed protein product [Fusarium graminearum]
Length=463

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              ++   + + + A ++F +LP  W  +GD L+ +       EI HT+ F+      SQ+
Sbjct  76   EIINGLYSQVQNIAFMHFDVLPKLWSWTGDLLLKWAPARFTGEISHTIVFVLTFTVISQL  135



>ref|XP_011115562.1| hypothetical protein H072_10056 [Dactylellina haptotyla CBS 200.50]
 gb|EPS36425.1| hypothetical protein H072_10056 [Dactylellina haptotyla CBS 200.50]
Length=439

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+   ++GF +  Y+FETYL  RQ+  L+   +PK L G + Q+ F+KS+AY   K+DF
Sbjct  16   FPWKNLILGFSVAQYLFETYLSARQYKVLRGTRIPKQLEGSVEQDVFDKSQAYGRAKADF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAF  494
             ++      + + + + F +LP  W  +G  ++ +L      EI H++ F
Sbjct  76   GYLRGLYGQVQNVSFIVFDVLPKLWGFTGSLMITYLPARFNGEITHSIVF  125



>ref|XP_010624213.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Fukomys 
damarensis]
 gb|KFO32523.1| CAAX prenyl protease 1 like protein [Fukomys damarensis]
Length=475

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++ET+L  RQ    K  T     +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W  SG F  ++G   E EI+H+L FL     +S +T
Sbjct  82   GLYSEVEGTFILLFGGIPYLWSLSGRFCGYVGFGPEYEIIHSLMFLLLATLFSALT  137



>ref|XP_004740738.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Mustela 
putorius furo]
 ref|XP_004783003.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Mustela 
putorius furo]
Length=427

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++E++L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWESFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>gb|EXL53967.1| STE24 endopeptidase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=463

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              ++   + + + A ++F +LP  W  +GD L+ +       EI HT+ F+      SQ+
Sbjct  76   EIINGLYSQVQNLAFMHFDVLPKLWSWTGDLLLKWAPARFTGEISHTIVFVLTFAVISQL  135



>gb|EWZ02551.1| STE24 endopeptidase [Fusarium oxysporum FOSC 3-a]
 gb|EWZ48634.1| STE24 endopeptidase [Fusarium oxysporum Fo47]
 gb|EWZ93702.1| STE24 endopeptidase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41803.1| STE24 endopeptidase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK45987.1| STE24 endopeptidase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK96784.1| STE24 endopeptidase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXM34146.1| STE24 endopeptidase [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=463

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              ++   + + + A ++F +LP  W  +GD L+ +       EI HT+ F+      SQ+
Sbjct  76   EIINGLYSQVQNLAFMHFDVLPKLWSWTGDLLLKWAPARFTGEISHTIVFVLTFAVISQL  135



>ref|XP_008832497.1| PREDICTED: CAAX prenyl protease 1 homolog [Nannospalax galili]
Length=384

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F  ++Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWIVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T
Sbjct  82   GLYSEMEGTFILLFGGIPYLWRLSGRFCGSAGFGPEYEITQSLVFLLLATLFSALT  137



>gb|EXM07215.1| STE24 endopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
Length=463

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              ++   + + + A ++F +LP  W  +GD L+ +       EI HT+ F+      SQ+
Sbjct  76   EIINGLYSQVQNLAFMHFDVLPKLWSWTGDLLLKWAPARFTGEISHTIVFVLTFAVISQL  135



>gb|EWG42807.1| STE24 endopeptidase [Fusarium verticillioides 7600]
Length=463

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE++L +RQ+  L+  + P  L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIMGFSVGQYLFESFLTLRQYRVLQKTSPPAVLSKEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              ++   + + + A ++F +LP  W  +GD L+ +       EI HT+ F+      SQ+
Sbjct  76   EIINGLYSQVQNIAFMHFDVLPKLWSWTGDLLLKWAPARFTGEISHTIVFVLTFAVISQL  135



>ref|XP_007917686.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
 gb|EON97602.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
Length=462

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIIGFSVAQYVFEGFLSLRQYQVLKKAKPPKVLEQEVSQEVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV  446
             FV+     + + A ++F +LP  W  +GD L+
Sbjct  76   EFVNGLYGQIQNIAFIHFDVLPKLWSWTGDLLL  108



>ref|XP_004740737.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
 ref|XP_004783002.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
Length=475

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+ F   +Y++E++L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWESFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALT  137



>ref|XP_006824576.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog, 
partial [Saccoglossus kowalevskii]
Length=483

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 3/120 (3%)
 Frame = +3

Query  177  MEAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHF  353
            + AV+ F  L+Y++ETYL  RQ A  K  T     +  ++  E F+K+R Y ++KS+F F
Sbjct  8    LNAVLVFFWLVYVWETYLAYRQRAIYKTFTKVPAEIYTILDHETFDKARLYQLEKSNFGF  67

Query  354  -VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQITD  530
             V  F  I M + IL  G +P+ W  +G+   + G   E EI+ +L F+   M +S ITD
Sbjct  68   WVGLFSQIEM-TLILILGGIPFLWNAAGNCTAYFGYGPEYEIMQSLMFIFLSMIFSTITD  126



>ref|XP_003453270.1| PREDICTED: CAAX prenyl protease 1 homolog [Oreochromis niloticus]
Length=467

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 57/116 (49%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+GF   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRTTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               +    + IL  G +P+ W  +G      G   E EI  +L FL     +S IT
Sbjct  77   GLYSETEGTLILLLGGIPFLWAVAGSVTARFGFGPEYEITQSLVFLTLATLFSAIT  132



>ref|XP_002627156.1| CaaX prenyl protease [Blastomyces dermatitidis SLH14081]
 gb|EEQ74796.1| CaaX prenyl protease [Blastomyces dermatitidis SLH14081]
 gb|EEQ88614.1| CaaX prenyl protease [Blastomyces dermatitidis ER-3]
 gb|EGE77219.1| CaaX prenyl protease [Blastomyces dermatitidis ATCC 18188]
 gb|EQL38711.1| STE24 endopeptidase [Blastomyces dermatitidis ATCC 26199]
Length=456

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + +VGF +  +I E +L +RQ+  L+    PK L   +SQ  F+KS+AY   K+ F
Sbjct  16   FPWKKVIVGFSVGQFILEGFLSLRQYGILQKTKPPKVLEEEVSQSVFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFL  497
             FV      + + AI+Y+  LP  W  +G FL  ++      EI HTLAF+
Sbjct  76   GFVSGLYGQIQNLAIIYYDALPKLWAVTGLFLTRYMPERFTGEISHTLAFV  126



>emb|CEJ80463.1| hypothetical protein VHEMI00644 [Torrubiella hemipterigena]
Length=459

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +3

Query  168  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  347
            FP+ + ++GF +  ++ ET+L  RQ+  L+ P  P  L   I+QE F+KS+AY   K+ F
Sbjct  16   FPWKKLIIGFSVGQFVLETFLTFRQYRVLQAPKPPAVLAKEINQETFDKSQAYGRAKAKF  75

Query  348  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTENEILHTLAFLAGVMFWSQI  524
              V   +  + + A +++ +LP  W  +GD L+ +       EI H++ F+   +   Q+
Sbjct  76   SVVTSLIGQIQNLAFIHYDVLPKIWSWTGDLLLKYAPTGFRGEISHSVVFMVAFLLIQQV  135



>ref|XP_008283596.1| PREDICTED: CAAX prenyl protease 1 homolog [Stegastes partitus]
Length=467

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 1/116 (1%)
 Frame = +3

Query  183  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  359
            AV+GF   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRSTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  360  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTENEILHTLAFLAGVMFWSQIT  527
               +    + IL  G +P+ W  +G      G + E EI  +L FL     +S IT
Sbjct  77   GLYSETEGTLILLLGGIPFLWGVAGSVTARFGFSPEYEITQSLVFLTLATLFSAIT  132



>emb|CDS32581.1| farnesylated protein converting enzyme 1 [Hymenolepis microstoma]
Length=882

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +3

Query  165  AFPYMEAVVGFMILMYIFETYLDIRQHA-AlklptlpkplVGVISQEKFEKSRAYSIDKS  341
            +F    A++ F+ L++ +ETYL++RQ + A K    P+ +  ++S+E F+KSR YSI+K 
Sbjct  13   SFSCYNAIIIFVWLLFAWETYLNLRQISLAKKTIKRPQQIEKIMSEEDFDKSRRYSIEKM  72

Query  342  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLV--------FLGLNTENEILHTLAF  494
            +F  V  F  I+  S +L+FG++ W W  S + L+         LG   +++IL +L F
Sbjct  73   NFEVVSSFYNIISMSVVLHFGLIAWAWNISKNHLLRLDAYFSHTLGATKDSDILFSLVF  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200