BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018I01

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAM34772.1|AF509872_1  nam-like protein 9                          86.3    7e-19   Petunia x hybrida [garden petunia]
ref|XP_006345843.1|  PREDICTED: NAC domain-containing protein 78-...  80.9    2e-17   Solanum tuberosum [potatoes]
ref|XP_004239710.1|  PREDICTED: NAC domain-containing protein 78-...  79.0    8e-17   Solanum lycopersicum
ref|XP_009764398.1|  PREDICTED: NAC domain-containing protein 78-...  78.2    1e-16   Nicotiana sylvestris
ref|XP_009625486.1|  PREDICTED: NAC domain-containing protein 78-...  77.0    4e-16   Nicotiana tomentosiformis
ref|XP_006361710.1|  PREDICTED: NAC domain-containing protein 78-...  70.9    2e-14   Solanum tuberosum [potatoes]
ref|XP_004250028.1|  PREDICTED: NAC domain-containing protein 78      70.1    3e-14   Solanum lycopersicum
ref|XP_011469277.1|  PREDICTED: NAC domain-containing protein 78 ...  70.5    8e-14   Fragaria vesca subsp. vesca
ref|XP_004307017.1|  PREDICTED: NAC domain-containing protein 78 ...  70.5    8e-14   Fragaria vesca subsp. vesca
ref|XP_011469274.1|  PREDICTED: NAC domain-containing protein 78 ...  70.5    9e-14   Fragaria vesca subsp. vesca
ref|XP_011469276.1|  PREDICTED: NAC domain-containing protein 78 ...  70.5    9e-14   Fragaria vesca subsp. vesca
ref|XP_010552948.1|  PREDICTED: NAC domain-containing protein 78-...  73.6    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_009599412.1|  PREDICTED: NAC domain-containing protein 78-...  68.2    2e-13   Nicotiana tomentosiformis
gb|EYU39671.1|  hypothetical protein MIMGU_mgv1a003896mg              70.1    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_009386218.1|  PREDICTED: NAC domain-containing protein 78-...  68.2    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY44853.1|  BnaC09g50530D                                        73.9    4e-13   Brassica napus [oilseed rape]
emb|CDY61762.1|  BnaAnng17650D                                        73.2    4e-13   Brassica napus [oilseed rape]
ref|XP_009771991.1|  PREDICTED: NAC domain-containing protein 78-...  66.6    5e-13   Nicotiana sylvestris
emb|CDO99814.1|  unnamed protein product                              68.9    6e-13   Coffea canephora [robusta coffee]
emb|CDY14157.1|  BnaC02g02740D                                        73.2    6e-13   Brassica napus [oilseed rape]
ref|NP_196061.1|  NAC family transcriptional activator                72.8    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543581.1|  PREDICTED: NAC domain-containing protein 78-...  70.9    6e-13   Tarenaya hassleriana [spider flower]
gb|KFK38438.1|  hypothetical protein AALP_AA3G113300                  73.2    7e-13   Arabis alpina [alpine rockcress]
ref|XP_002882677.1|  ANAC053                                          72.8    7e-13   
ref|XP_002871092.1|  hypothetical protein ARALYDRAFT_908325           72.8    7e-13   Arabidopsis lyrata subsp. lyrata
gb|AAM65338.1|  NAC, putative                                         72.8    7e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51388.1|AC011560_20  unknown protein; 75639-73470               72.8    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566376.1|  NAC domain containing protein 53                    72.8    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125558.1|  PREDICTED: NAC domain-containing protein 78-...  72.8    8e-13   Brassica rapa
ref|XP_009125559.1|  PREDICTED: NAC domain-containing protein 78-...  72.8    8e-13   Brassica rapa
gb|AAF09254.1|AF201456_1  NAC2                                        72.8    9e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11289.1|  BnaA03g01250D                                        72.4    9e-13   Brassica napus [oilseed rape]
ref|XP_009130821.1|  PREDICTED: NAC domain-containing protein 78-...  72.4    1e-12   Brassica rapa
ref|XP_009130822.1|  PREDICTED: NAC domain-containing protein 78-...  72.4    1e-12   Brassica rapa
ref|XP_002265345.2|  PREDICTED: NAC domain-containing protein 78      67.4    1e-12   Vitis vinifera
ref|XP_006407560.1|  hypothetical protein EUTSA_v10020438mg           72.4    1e-12   Eutrema salsugineum [saltwater cress]
emb|CAN70406.1|  hypothetical protein VITISV_021988                   67.0    1e-12   Vitis vinifera
ref|XP_006398899.1|  hypothetical protein EUTSA_v10013110mg           71.6    1e-12   Eutrema salsugineum [saltwater cress]
gb|EPS65703.1|  nam-like protein 9                                    69.3    1e-12   Genlisea aurea
emb|CDY58437.1|  BnaC03g71220D                                        72.4    2e-12   Brassica napus [oilseed rape]
ref|XP_009361439.1|  PREDICTED: NAC domain-containing protein 78-...  67.0    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_011076897.1|  PREDICTED: NAC domain-containing protein 78-...  67.4    2e-12   Sesamum indicum [beniseed]
ref|XP_010243195.1|  PREDICTED: NAC domain-containing protein 78-...  67.4    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010243196.1|  PREDICTED: NAC domain-containing protein 78-...  67.4    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010464726.1|  PREDICTED: NAC domain-containing protein 78-...  71.6    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010486664.1|  PREDICTED: NAC domain-containing protein 78      71.6    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010485001.1|  PREDICTED: NAC domain-containing protein 78-...  71.6    2e-12   Camelina sativa [gold-of-pleasure]
emb|CDX70227.1|  BnaA10g25760D                                        71.2    2e-12   
ref|XP_009346650.1|  PREDICTED: NAC domain-containing protein 78-...  66.2    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_009346652.1|  PREDICTED: NAC domain-containing protein 78-...  66.2    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_009346651.1|  PREDICTED: NAC domain-containing protein 78-...  66.2    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_004142444.1|  PREDICTED: NAC domain-containing protein 78-...  66.2    3e-12   
ref|XP_004173168.1|  PREDICTED: NAC domain-containing protein 78-...  65.9    3e-12   
gb|KGN52230.1|  hypothetical protein Csa_5G622470                     65.9    3e-12   Cucumis sativus [cucumbers]
gb|EYU32441.1|  hypothetical protein MIMGU_mgv1a002437mg              67.8    3e-12   Erythranthe guttata [common monkey flower]
gb|ADL36811.1|  NAC domain class transcription factor                 66.2    4e-12   Malus domestica [apple tree]
ref|XP_008446811.1|  PREDICTED: NAC domain-containing protein 78-...  65.9    4e-12   Cucumis melo [Oriental melon]
ref|XP_010090439.1|  NAC domain-containing protein 78                 68.9    4e-12   
ref|XP_006297351.1|  hypothetical protein CARUB_v10013370mg           71.6    4e-12   Capsella rubella
ref|XP_008339778.1|  PREDICTED: NAC domain-containing protein 78-...  66.6    4e-12   
ref|XP_008339779.1|  PREDICTED: NAC domain-containing protein 78-...  66.6    4e-12   
ref|XP_008345397.1|  PREDICTED: NAC domain-containing protein 78-...  65.9    4e-12   
ref|XP_011101543.1|  PREDICTED: NAC domain-containing protein 78-...  66.6    5e-12   Sesamum indicum [beniseed]
ref|XP_011101544.1|  PREDICTED: NAC domain-containing protein 78-...  66.2    5e-12   Sesamum indicum [beniseed]
ref|XP_010267268.1|  PREDICTED: NAC domain-containing protein 78-...  66.2    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010694513.1|  PREDICTED: NAC domain-containing protein 78      68.2    6e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|AIA57516.1|  NAC domain-containing protein                         69.7    6e-12   Boehmeria nivea [Chinese silk-plant]
ref|XP_010032131.1|  PREDICTED: NAC domain-containing protein 78      68.2    8e-12   Eucalyptus grandis [rose gum]
ref|XP_010423582.1|  PREDICTED: NAC domain-containing protein 78 ...  68.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010423583.1|  PREDICTED: NAC domain-containing protein 78 ...  68.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009418258.1|  PREDICTED: uncharacterized protein LOC103998499  65.5    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010490948.1|  PREDICTED: NAC domain-containing protein 78-...  68.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010490950.1|  PREDICTED: NAC domain-containing protein 78-...  68.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010694507.1|  PREDICTED: NAC domain-containing protein 2       68.2    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010452336.1|  PREDICTED: NAC domain-containing protein 78-...  68.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010452337.1|  PREDICTED: NAC domain-containing protein 78-...  68.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009122601.1|  PREDICTED: NAC domain-containing protein 78-...  68.6    1e-11   Brassica rapa
emb|CDY41354.1|  BnaA01g31650D                                        69.7    2e-11   Brassica napus [oilseed rape]
ref|XP_002532627.1|  conserved hypothetical protein                   66.2    2e-11   
ref|XP_007218872.1|  hypothetical protein PRUPE_ppa003239mg           62.8    3e-11   Prunus persica
ref|XP_009122853.1|  PREDICTED: NAC domain-containing protein 78      68.6    3e-11   Brassica rapa
ref|XP_008232318.1|  PREDICTED: NAC domain-containing protein 78 ...  62.8    4e-11   Prunus mume [ume]
ref|XP_008232319.1|  PREDICTED: NAC domain-containing protein 78 ...  62.8    4e-11   Prunus mume [ume]
emb|CDY70627.1|  BnaAnng34420D                                        67.4    4e-11   Brassica napus [oilseed rape]
ref|XP_010067201.1|  PREDICTED: uncharacterized protein LOC104454139  65.9    4e-11   Eucalyptus grandis [rose gum]
gb|AGL39700.1|  NAC transcription factor 044                          64.7    4e-11   Jatropha curcas
gb|KHG27497.1|  NAC domain-containing 78 -like protein                67.8    5e-11   Gossypium arboreum [tree cotton]
gb|KJB74741.1|  hypothetical protein B456_012G007000                  67.8    5e-11   Gossypium raimondii
ref|XP_002311983.2|  NAC domain-containing protein 78                 67.0    6e-11   
ref|XP_006379522.1|  hypothetical protein POPTR_0008s03170g           67.0    6e-11   
gb|AHJ79210.1|  NAC domain protein NAC69                              67.8    6e-11   Gossypium hirsutum [American cotton]
gb|EMT21706.1|  NAC domain-containing protein 78                      61.6    6e-11   
ref|XP_006361711.1|  PREDICTED: NAC domain-containing protein 78-...  65.1    8e-11   
ref|XP_010090441.1|  NAC domain-containing protein 78                 65.9    8e-11   Morus notabilis
ref|XP_004496132.1|  PREDICTED: NAC domain-containing protein 7-l...  65.5    9e-11   
ref|XP_011031618.1|  PREDICTED: NAC domain-containing protein 78-...  66.2    1e-10   Populus euphratica
ref|XP_004496131.1|  PREDICTED: NAC domain-containing protein 7-l...  65.1    1e-10   Cicer arietinum [garbanzo]
ref|XP_002444576.1|  hypothetical protein SORBIDRAFT_07g023900        61.2    1e-10   Sorghum bicolor [broomcorn]
gb|KFK24891.1|  hypothetical protein AALP_AA8G038000                  65.9    1e-10   Arabis alpina [alpine rockcress]
gb|ADE34584.1|  NAC transcription factor NTL5                         60.8    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003573214.1|  PREDICTED: NAC domain-containing protein 78-...  61.6    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_006297543.1|  hypothetical protein CARUB_v10013564mg           65.5    1e-10   
gb|KEH43316.1|  NAC transcription factor-like protein                 64.7    2e-10   Medicago truncatula
gb|KFK38436.1|  hypothetical protein AALP_AA3G113200                  65.1    2e-10   Arabis alpina [alpine rockcress]
gb|EMS53104.1|  NAC domain-containing protein 78                      60.5    2e-10   Triticum urartu
gb|KFK38437.1|  hypothetical protein AALP_AA3G113200                  65.5    2e-10   Arabis alpina [alpine rockcress]
ref|XP_002882675.1|  ANAC050                                          65.5    2e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_001154602.1|  NAC domain containing protein 50                 64.7    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024333.1|  PREDICTED: NAC domain-containing protein 78-...  65.5    2e-10   Populus euphratica
gb|EAZ08024.1|  hypothetical protein OsI_30288                        60.5    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010486659.1|  PREDICTED: NAC domain-containing protein 8-like  65.5    2e-10   Camelina sativa [gold-of-pleasure]
ref|NP_001062518.1|  Os08g0562200                                     60.5    2e-10   
ref|XP_010464724.1|  PREDICTED: NAC domain-containing protein 74-...  65.5    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011024334.1|  PREDICTED: NAC domain-containing protein 78-...  65.5    2e-10   Populus euphratica
ref|XP_009122861.1|  PREDICTED: NAC domain-containing protein 7-like  65.9    2e-10   Brassica rapa
ref|XP_002315338.2|  hypothetical protein POPTR_0010s23650g           65.5    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008456548.1|  PREDICTED: NAC domain-containing protein 78-...  63.2    2e-10   
ref|XP_006843116.1|  hypothetical protein AMTR_s00140p00087970        58.9    2e-10   Amborella trichopoda
gb|AGV29528.1|  putative NAC domain class transcription factor        63.5    3e-10   Tamarix hispida
ref|XP_008456549.1|  PREDICTED: NAC domain-containing protein 78-...  63.2    3e-10   
ref|XP_006378789.1|  NAC domain-containing protein 78                 65.5    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010484780.1|  PREDICTED: NAC domain-containing protein 74-...  65.5    3e-10   
ref|XP_006297669.1|  hypothetical protein CARUB_v10013694mg           65.5    3e-10   
dbj|BAD09612.1|  putative NAC2 protein                                60.1    3e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDY41353.1|  BnaA01g31660D                                        65.5    3e-10   Brassica napus [oilseed rape]
ref|NP_974272.1|  NAC domain containing protein 50                    65.5    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566374.1|  NAC domain containing protein 50                    65.5    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08601.1|  BnaA05g28370D                                        64.7    3e-10   Brassica napus [oilseed rape]
ref|XP_004974231.1|  PREDICTED: uncharacterized protein LOC101754925  61.6    3e-10   Setaria italica
gb|KDO47587.1|  hypothetical protein CISIN_1g007598mg                 62.4    3e-10   Citrus sinensis [apfelsine]
ref|XP_010484887.1|  PREDICTED: NAC domain-containing protein 74-...  64.3    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004150380.1|  PREDICTED: NAC domain-containing protein 78-...  62.8    4e-10   Cucumis sativus [cucumbers]
ref|XP_006436536.1|  hypothetical protein CICLE_v10031147mg           62.4    4e-10   Citrus clementina [clementine]
ref|XP_010484932.1|  PREDICTED: NAC domain-containing protein 74-...  63.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006436535.1|  hypothetical protein CICLE_v10031147mg           62.4    4e-10   Citrus clementina [clementine]
gb|AAM34767.1|AF509867_1  nam-like protein 4                          66.2    4e-10   Petunia x hybrida [garden petunia]
gb|EYU32440.1|  hypothetical protein MIMGU_mgv1a007979mg              65.9    4e-10   Erythranthe guttata [common monkey flower]
gb|KDO47583.1|  hypothetical protein CISIN_1g007598mg                 62.8    4e-10   Citrus sinensis [apfelsine]
gb|AGV29495.1|  putative NAC domain class transcription factor        64.7    4e-10   Tamarix hispida
ref|XP_010486661.1|  PREDICTED: NAC domain-containing protein 74-...  63.9    4e-10   Camelina sativa [gold-of-pleasure]
gb|KDO47584.1|  hypothetical protein CISIN_1g007598mg                 62.4    4e-10   Citrus sinensis [apfelsine]
gb|KDO47585.1|  hypothetical protein CISIN_1g007598mg                 62.4    4e-10   Citrus sinensis [apfelsine]
gb|KDO47586.1|  hypothetical protein CISIN_1g007598mg                 62.4    4e-10   Citrus sinensis [apfelsine]
ref|XP_010464721.1|  PREDICTED: NAC domain-containing protein 74-...  63.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010464723.1|  PREDICTED: NAC domain-containing protein 74-...  63.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|NP_001168544.1|  uncharacterized protein LOC100382324             61.2    5e-10   Zea mays [maize]
ref|XP_009346645.1|  PREDICTED: filaggrin-2-like isoform X1           62.0    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_009346646.1|  PREDICTED: uncharacterized protein LOC103938...  62.0    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_009346647.1|  PREDICTED: uncharacterized protein LOC103938...  62.0    5e-10   
ref|XP_008345404.1|  PREDICTED: uncharacterized protein LOC103408324  62.0    5e-10   
ref|XP_009346648.1|  PREDICTED: uncharacterized protein LOC103938...  62.0    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_008375621.1|  PREDICTED: uncharacterized protein LOC103438860  62.0    5e-10   
ref|XP_009361440.1|  PREDICTED: uncharacterized protein LOC103951718  62.0    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_008232317.1|  PREDICTED: uncharacterized protein LOC103331477  62.0    5e-10   Prunus mume [ume]
ref|XP_009780872.1|  PREDICTED: NAC domain-containing protein 78-...  65.9    5e-10   Nicotiana sylvestris
emb|CDY41351.1|  BnaA01g31680D                                        64.3    5e-10   Brassica napus [oilseed rape]
ref|XP_009146834.1|  PREDICTED: NAC domain-containing protein 74-...  64.3    5e-10   Brassica rapa
ref|XP_006660391.1|  PREDICTED: uncharacterized protein LOC102710047  60.5    5e-10   Oryza brachyantha
dbj|BAJ91676.1|  predicted protein                                    60.5    5e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK39979.1|  unknown                                               64.3    5e-10   Medicago truncatula
gb|KHG28963.1|  NAC domain-containing 78 -like protein                64.7    6e-10   Gossypium arboreum [tree cotton]
ref|XP_009383926.1|  PREDICTED: NAC domain-containing protein 78-...  61.2    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940544.1|  PREDICTED: uncharacterized protein LOC105059077  60.1    6e-10   Elaeis guineensis
ref|XP_008677550.1|  PREDICTED: uncharacterized protein LOC100382...  61.6    6e-10   
gb|KJB73469.1|  hypothetical protein B456_011G234200                  64.3    6e-10   Gossypium raimondii
ref|XP_009383919.1|  PREDICTED: NAC domain-containing protein 78-...  61.2    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002882676.1|  ANAC051/ANAC052                                  64.3    7e-10   Arabidopsis lyrata subsp. lyrata
gb|AFU61114.1|  NAC domain class transcription factor                 65.1    7e-10   Capsicum annuum
ref|XP_010935813.1|  PREDICTED: NAC domain-containing protein 78-...  60.1    7e-10   Elaeis guineensis
ref|XP_011024336.1|  PREDICTED: NAC transcription factor NAM-A1       63.9    8e-10   Populus euphratica
ref|XP_010935812.1|  PREDICTED: NAC domain-containing protein 78-...  60.5    8e-10   Elaeis guineensis
emb|CDY41352.1|  BnaA01g31670D                                        63.9    8e-10   Brassica napus [oilseed rape]
ref|XP_004239709.1|  PREDICTED: NAC domain-containing protein 78      65.5    8e-10   Solanum lycopersicum
ref|XP_004307019.1|  PREDICTED: uncharacterized protein LOC101300663  62.0    8e-10   Fragaria vesca subsp. vesca
ref|XP_009122872.1|  PREDICTED: NAC domain-containing protein 7-like  63.9    8e-10   Brassica rapa
gb|AHN60141.1|  NAC transcription factor 51                           63.9    8e-10   Brassica napus [oilseed rape]
gb|EPS65704.1|  nam-like protein 4                                    63.9    9e-10   Genlisea aurea
emb|CDY00946.1|  BnaC05g42540D                                        64.7    9e-10   
ref|XP_007010047.1|  NAC domain protein, IPR003441                    65.5    9e-10   
ref|XP_002315336.1|  no apical meristem family protein                63.5    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008779162.1|  PREDICTED: uncharacterized protein LOC103698888  60.5    9e-10   Phoenix dactylifera
ref|XP_009146835.1|  PREDICTED: NAC domain-containing protein 78-...  64.3    9e-10   Brassica rapa
ref|XP_009418629.1|  PREDICTED: NAC domain-containing protein 78 ...  62.8    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003556303.1|  PREDICTED: NAC transcription factor NAM-B2-like  62.8    1e-09   Glycine max [soybeans]
gb|KJB60510.1|  hypothetical protein B456_009G309300                  65.1    1e-09   Gossypium raimondii
ref|XP_009619467.1|  PREDICTED: NAC domain-containing protein 78-...  64.7    1e-09   Nicotiana tomentosiformis
gb|KJB60511.1|  hypothetical protein B456_009G309300                  65.1    1e-09   Gossypium raimondii
gb|KHN00952.1|  NAC domain-containing protein 78                      62.8    1e-09   Glycine soja [wild soybean]
ref|XP_009418630.1|  PREDICTED: NAC domain-containing protein 78 ...  62.4    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFP93563.1|  NAC                                                   64.3    1e-09   Cestrum nocturnum [night jessamine]
ref|XP_006345842.1|  PREDICTED: NAC domain-containing protein 78-...  65.5    1e-09   Solanum tuberosum [potatoes]
ref|XP_006407563.1|  hypothetical protein EUTSA_v10020745mg           63.2    1e-09   Eutrema salsugineum [saltwater cress]
ref|XP_006407562.1|  hypothetical protein EUTSA_v10020745mg           63.2    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_009625487.1|  PREDICTED: NAC domain-containing protein 78-...  63.9    2e-09   Nicotiana tomentosiformis
ref|XP_009796718.1|  PREDICTED: NAC domain-containing protein 78-...  63.9    2e-09   Nicotiana sylvestris
ref|NP_850554.1|  NAC domain containing protein 52                    62.8    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543579.1|  PREDICTED: NAC domain-containing protein 4-l...  63.2    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_011076898.1|  PREDICTED: NAC domain-containing protein 78-...  63.5    2e-09   Sesamum indicum [beniseed]
ref|XP_008446812.1|  PREDICTED: NAC domain-containing protein 77-...  59.3    2e-09   Cucumis melo [Oriental melon]
ref|XP_009135112.1|  PREDICTED: NAC domain-containing protein 78-...  63.2    2e-09   Brassica rapa
ref|XP_007144246.1|  hypothetical protein PHAVU_007G140300g           62.4    2e-09   Phaseolus vulgaris [French bean]
ref|XP_004142442.1|  PREDICTED: uncharacterized protein LOC101210923  59.3    2e-09   Cucumis sativus [cucumbers]
ref|XP_002265550.1|  PREDICTED: NAC domain-containing protein 77-...  62.0    2e-09   Vitis vinifera
emb|CDO99813.1|  unnamed protein product                              63.2    3e-09   Coffea canephora [robusta coffee]
gb|AGL39699.1|  NAC transcription factor 043                          62.0    3e-09   Jatropha curcas
ref|XP_011101541.1|  PREDICTED: NAC domain-containing protein 78 ...  63.2    3e-09   Sesamum indicum [beniseed]
ref|XP_011101542.1|  PREDICTED: NAC domain-containing protein 78 ...  63.2    3e-09   Sesamum indicum [beniseed]
ref|NP_566375.1|  NAC domain containing protein 52                    62.4    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY61662.1|  BnaCnng38230D                                        63.5    3e-09   Brassica napus [oilseed rape]
ref|XP_007144247.1|  hypothetical protein PHAVU_007G140300g           62.4    3e-09   Phaseolus vulgaris [French bean]
ref|XP_007010050.1|  NAC domain protein, IPR003441, putative isof...  60.5    4e-09   
gb|AAM34771.1|AF509871_1  nam-like protein 8                          60.8    4e-09   Petunia x hybrida [garden petunia]
gb|KDO47588.1|  hypothetical protein CISIN_1g007598mg                 60.5    4e-09   Citrus sinensis [apfelsine]
gb|KJB60503.1|  hypothetical protein B456_009G309000                  58.5    4e-09   Gossypium raimondii
ref|XP_009145146.1|  PREDICTED: uncharacterized protein LOC103868845  61.2    4e-09   
ref|XP_002532631.1|  hypothetical protein RCOM_0351490                62.8    4e-09   
emb|CDY00677.1|  BnaC03g36610D                                        61.6    5e-09   
emb|CDX73920.1|  BnaA03g31270D                                        62.8    6e-09   
ref|XP_011026224.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  62.8    6e-09   Populus euphratica
gb|KGN54941.1|  hypothetical protein Csa_4G608170                     58.2    6e-09   Cucumis sativus [cucumbers]
emb|CBI31390.3|  unnamed protein product                              60.8    7e-09   Vitis vinifera
ref|XP_006849894.1|  hypothetical protein AMTR_s00022p00094930        58.9    7e-09   Amborella trichopoda
ref|XP_010424782.1|  PREDICTED: NAC domain-containing protein 78-...  61.2    8e-09   
ref|XP_007010051.1|  NAC domain containing protein 2, putative is...  60.1    8e-09   
ref|XP_006436533.1|  hypothetical protein CICLE_v10031606mg           60.1    9e-09   Citrus clementina [clementine]
gb|AIA57527.1|  NAC domain-containing protein                         57.8    1e-08   Boehmeria nivea [Chinese silk-plant]
emb|CAN70405.1|  hypothetical protein VITISV_021987                   59.7    1e-08   Vitis vinifera
ref|XP_010316553.1|  PREDICTED: NAC domain-containing protein 86 ...  54.3    1e-08   Solanum lycopersicum
ref|XP_011026226.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  62.0    1e-08   Populus euphratica
gb|KHN00769.1|  NAC domain-containing protein 78                      58.5    1e-08   Glycine soja [wild soybean]
ref|XP_010260495.1|  PREDICTED: NAC domain-containing protein 78-...  59.3    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010456393.1|  PREDICTED: NAC domain-containing protein 78-...  62.0    2e-08   Camelina sativa [gold-of-pleasure]
ref|NP_001077648.1|  NAC domain containing protein 16                 59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006348211.1|  PREDICTED: uncharacterized protein LOC102601721  53.9    2e-08   Solanum tuberosum [potatoes]
gb|AAM34765.1|AF509865_1  nam-like protein 2                          56.2    2e-08   Petunia x hybrida [garden petunia]
gb|AGL39698.1|  NAC transcription factor 042                          55.8    2e-08   Jatropha curcas
ref|XP_009121977.1|  PREDICTED: NAC domain-containing protein 78-...  59.7    2e-08   Brassica rapa
gb|KDP42610.1|  hypothetical protein JCGZ_24384                       55.8    2e-08   Jatropha curcas
emb|CDX69774.1|  BnaA10g21230D                                        61.2    2e-08   
ref|XP_009121976.1|  PREDICTED: NAC domain-containing protein 78-...  59.7    2e-08   
ref|XP_006407561.1|  hypothetical protein EUTSA_v10020717mg           58.9    3e-08   Eutrema salsugineum [saltwater cress]
ref|XP_009121975.1|  PREDICTED: NAC domain-containing protein 78-...  60.1    3e-08   Brassica rapa
emb|CDX73304.1|  BnaC05g28020D                                        58.9    3e-08   
ref|XP_010499958.1|  PREDICTED: uncharacterized protein LOC104777407  58.5    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008787444.1|  PREDICTED: NAC domain-containing protein 78      54.3    3e-08   Phoenix dactylifera
ref|XP_002300866.2|  hypothetical protein POPTR_0002s05820g           61.2    3e-08   
gb|KJB28924.1|  hypothetical protein B456_005G076200                  61.6    4e-08   Gossypium raimondii
ref|XP_010495071.1|  PREDICTED: NAC domain-containing protein 78-...  58.9    4e-08   Camelina sativa [gold-of-pleasure]
gb|KJB28926.1|  hypothetical protein B456_005G076200                  61.6    4e-08   Gossypium raimondii
ref|XP_007146987.1|  hypothetical protein PHAVU_006G087000g           51.2    4e-08   Phaseolus vulgaris [French bean]
gb|KJB12788.1|  hypothetical protein B456_002G036700                  54.7    4e-08   Gossypium raimondii
ref|XP_006415017.1|  hypothetical protein EUTSA_v10007196mg           58.5    4e-08   Eutrema salsugineum [saltwater cress]
gb|EYU22420.1|  hypothetical protein MIMGU_mgv1a022481mg              56.2    4e-08   Erythranthe guttata [common monkey flower]
ref|XP_009786294.1|  PREDICTED: uncharacterized protein LOC104234432  61.2    5e-08   Nicotiana sylvestris
gb|KFK45123.1|  hypothetical protein AALP_AA1G347100                  58.9    5e-08   Arabis alpina [alpine rockcress]
gb|KHG10038.1|  NAC domain-containing 78 -like protein                61.2    5e-08   Gossypium arboreum [tree cotton]
ref|XP_007141427.1|  hypothetical protein PHAVU_008G194600g           60.1    5e-08   Phaseolus vulgaris [French bean]
gb|AGL39705.1|  NAC transcription factor 049                          61.2    5e-08   Jatropha curcas
gb|AGY49285.1|  putative membrane bound NAC transcription factor 2    61.2    5e-08   Solanum tuberosum [potatoes]
gb|KJB28923.1|  hypothetical protein B456_005G076200                  61.2    6e-08   Gossypium raimondii
gb|KJB28928.1|  hypothetical protein B456_005G076200                  60.8    6e-08   Gossypium raimondii
gb|KJB28927.1|  hypothetical protein B456_005G076200                  61.2    6e-08   Gossypium raimondii
ref|XP_010316554.1|  PREDICTED: NAC domain-containing protein 86 ...  53.1    6e-08   Solanum lycopersicum
gb|AHJ79186.1|  NAC domain protein NAC45                              61.2    6e-08   Gossypium hirsutum [American cotton]
ref|XP_009353916.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  56.6    6e-08   Pyrus x bretschneideri [bai li]
ref|XP_009599075.1|  PREDICTED: NAC domain-containing protein 74-...  60.8    6e-08   Nicotiana tomentosiformis
gb|KJB28925.1|  hypothetical protein B456_005G076200                  60.8    6e-08   Gossypium raimondii
ref|NP_176766.1|  NAC domain containing protein 28                    50.1    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37882.1|  NAC domain-containing protein 78                      56.6    6e-08   Glycine soja [wild soybean]
ref|XP_009127458.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.1    6e-08   Brassica rapa
ref|XP_003536286.1|  PREDICTED: NAC domain-containing protein 7-like  56.6    7e-08   Glycine max [soybeans]
gb|AIZ68168.1|  NAC domain-containing protein 74-like isoform X1      58.9    7e-08   Ornithogalum longebracteatum [sea-onion]
ref|XP_011043876.1|  PREDICTED: NAC domain-containing protein 86-...  50.8    7e-08   Populus euphratica
ref|XP_002888465.1|  predicted protein                                50.1    8e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_004237849.1|  PREDICTED: uncharacterized protein LOC101260636  60.5    8e-08   Solanum lycopersicum
ref|XP_006301376.1|  hypothetical protein CARUB_v10021788mg           50.1    8e-08   Capsella rubella
emb|CBI21756.3|  unnamed protein product                              53.9    9e-08   Vitis vinifera
ref|XP_010415135.1|  PREDICTED: NAC domain-containing protein 86-...  50.1    9e-08   Camelina sativa [gold-of-pleasure]
gb|AGC27316.1|  NAC domain protein 13                                 56.6    9e-08   Gossypium hirsutum [American cotton]
ref|XP_004515740.1|  PREDICTED: NAC domain-containing protein 7-l...  57.0    9e-08   
ref|XP_010511513.1|  PREDICTED: NAC domain-containing protein 86 ...  50.1    1e-07   
ref|XP_010415136.1|  PREDICTED: NAC domain-containing protein 86-...  50.1    1e-07   
ref|XP_010094888.1|  NAC domain-containing protein 78                 60.1    1e-07   
ref|XP_009761611.1|  PREDICTED: NAC domain-containing protein 7-like  57.0    1e-07   
ref|XP_011071000.1|  PREDICTED: putative NAC domain-containing pr...  54.7    1e-07   
ref|XP_010470462.1|  PREDICTED: NAC domain-containing protein 86-...  49.7    1e-07   
ref|XP_009597016.1|  PREDICTED: NAC domain-containing protein 7-like  57.0    1e-07   
ref|XP_008343143.1|  PREDICTED: uncharacterized protein LOC103405...  50.1    1e-07   
ref|XP_008343142.1|  PREDICTED: uncharacterized protein LOC103405...  50.1    1e-07   
ref|XP_004150048.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  52.4    1e-07   
ref|XP_007020198.1|  NAC domain protein, IPR003441, putative isof...  60.1    1e-07   
ref|XP_010511514.1|  PREDICTED: NAC domain-containing protein 86 ...  50.1    1e-07   
ref|XP_010932189.1|  PREDICTED: NAC domain-containing protein 45-...  55.5    1e-07   
ref|XP_004173216.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  52.4    1e-07   
ref|XP_009370573.1|  PREDICTED: uncharacterized protein LOC103959...  50.1    1e-07   
ref|XP_011469065.1|  PREDICTED: NAC domain-containing protein 86 ...  50.1    1e-07   
ref|XP_009370574.1|  PREDICTED: uncharacterized protein LOC103959...  49.7    1e-07   
ref|XP_004289565.1|  PREDICTED: NAC domain-containing protein 86 ...  50.1    1e-07   
ref|XP_010932188.1|  PREDICTED: uncharacterized protein LOC105052...  55.5    1e-07   
ref|XP_003556180.1|  PREDICTED: uncharacterized protein LOC100787...  58.9    1e-07   
ref|XP_009367106.1|  PREDICTED: uncharacterized protein LOC103956792  50.1    1e-07   
gb|EMT03563.1|  Putative NAC domain-containing protein 9              54.3    1e-07   
ref|XP_002305903.1|  hypothetical protein POPTR_0004s07910g           50.1    1e-07   
ref|XP_010470463.1|  PREDICTED: NAC domain-containing protein 86-...  49.7    1e-07   
gb|KHN24171.1|  NAC domain-containing protein 74                      49.7    1e-07   
ref|XP_003537430.2|  PREDICTED: uncharacterized protein LOC100808596  49.7    1e-07   
gb|KHN08773.1|  NAC domain-containing protein 74                      49.7    1e-07   
gb|KJB59536.1|  hypothetical protein B456_009G260000                  59.7    1e-07   
gb|KHG15925.1|  NAC domain-containing 78 -like protein                59.7    1e-07   
ref|XP_003552888.2|  PREDICTED: uncharacterized protein LOC100818019  49.7    1e-07   
ref|XP_007020196.1|  NAC domain protein, IPR003441, putative isof...  59.7    1e-07   
ref|XP_009135111.1|  PREDICTED: NAC domain-containing protein 4-like  57.0    1e-07   
gb|KJB22460.1|  hypothetical protein B456_004G048200                  50.1    1e-07   
emb|CDX93723.1|  BnaA09g23230D                                        58.5    2e-07   
ref|XP_003544352.1|  PREDICTED: protein FEZ-like                      50.4    2e-07   
ref|XP_009339761.1|  PREDICTED: uncharacterized protein LOC103931956  59.7    2e-07   
ref|XP_006286823.1|  hypothetical protein CARUB_v10003768mg           56.6    2e-07   
ref|XP_006290189.1|  hypothetical protein CARUB_v10003869mg           50.4    2e-07   
ref|XP_003518362.1|  PREDICTED: protein FEZ-like                      50.4    2e-07   
ref|XP_008381390.1|  PREDICTED: uncharacterized protein LOC103444...  50.1    2e-07   
ref|XP_008381391.1|  PREDICTED: uncharacterized protein LOC103444...  50.1    2e-07   
ref|XP_008227899.1|  PREDICTED: uncharacterized protein LOC103327366  49.7    2e-07   
ref|XP_007141968.1|  hypothetical protein PHAVU_008G241200g           50.4    2e-07   
gb|KHN41028.1|  NAC domain-containing protein 74                      50.4    2e-07   
gb|AGY49287.1|  putative membrane bound NAC transcription factor 2    59.7    2e-07   
gb|KJB59534.1|  hypothetical protein B456_009G260000                  59.7    2e-07   
gb|KHN17058.1|  NAC domain-containing protein 78                      58.5    2e-07   
ref|XP_007020193.1|  NAC domain protein, IPR003441, putative isof...  59.7    2e-07   
ref|XP_006858416.1|  hypothetical protein AMTR_s00071p00055960        54.3    2e-07   
ref|NP_001274375.1|  uncharacterized protein LOC100794925             58.5    2e-07   
gb|AAM67294.1|  NAM-like protein                                      59.7    2e-07   
gb|KJB59535.1|  hypothetical protein B456_009G260000                  59.7    2e-07   
ref|XP_011074130.1|  PREDICTED: NAC domain-containing protein 86-...  58.5    2e-07   
gb|EMS63623.1|  Protein FEZ                                           53.5    2e-07   
gb|KEH43609.1|  NAC transcription factor-like protein                 59.7    2e-07   
ref|XP_004490776.1|  PREDICTED: uncharacterized protein LOC101514...  50.1    2e-07   
ref|XP_004490777.1|  PREDICTED: uncharacterized protein LOC101514...  50.1    2e-07   
ref|XP_007048346.1|  NAC domain containing protein 82, putative       55.8    2e-07   
ref|XP_002265883.1|  PREDICTED: transcription factor JUNGBRUNNEN 1    53.9    2e-07   
ref|XP_004238798.2|  PREDICTED: putative NAC domain-containing pr...  53.5    2e-07   
ref|XP_010320683.1|  PREDICTED: putative NAC domain-containing pr...  53.5    2e-07   
ref|XP_008381037.1|  PREDICTED: uncharacterized protein LOC103443912  59.3    2e-07   
ref|XP_007215001.1|  hypothetical protein PRUPE_ppa002384mg           49.7    2e-07   
ref|XP_008446344.1|  PREDICTED: protein FEZ                           53.1    2e-07   
ref|XP_004155390.1|  PREDICTED: protein FEZ-like                      53.1    2e-07   
gb|AHN60140.1|  NAC transcription factor 50                           57.0    2e-07   
gb|KJB59533.1|  hypothetical protein B456_009G260000                  59.3    2e-07   
ref|XP_006391326.1|  hypothetical protein EUTSA_v10018275mg           49.7    2e-07   
emb|CAN72060.1|  hypothetical protein VITISV_037482                   54.7    2e-07   
emb|CDY00676.1|  BnaC03g36600D                                        56.6    2e-07   
ref|XP_010923739.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  58.5    2e-07   
ref|XP_009415577.1|  PREDICTED: uncharacterized protein LOC103996378  55.5    2e-07   
ref|NP_564439.1|  NAC domain containing protein 16                    59.3    2e-07   
ref|XP_006366116.1|  PREDICTED: protein FEZ-like                      53.5    2e-07   
ref|XP_004496404.1|  PREDICTED: NAC domain-containing protein 89-...  57.0    2e-07   
ref|XP_008664658.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  53.5    2e-07   
ref|XP_002265838.2|  PREDICTED: transcription factor JUNGBRUNNEN 1    54.3    2e-07   
ref|XP_010420434.1|  PREDICTED: NAC domain-containing protein 86-...  49.7    2e-07   
ref|XP_004144678.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  58.5    2e-07   
gb|KJB43218.1|  hypothetical protein B456_007G188800                  48.9    2e-07   
ref|XP_004139890.1|  PREDICTED: uncharacterized protein LOC101211980  53.5    2e-07   
gb|AHJ79173.1|  NAC domain protein NAC32                              52.4    2e-07   
gb|KGN44268.1|  hypothetical protein Csa_7G237830                     53.5    2e-07   
ref|XP_010420435.1|  PREDICTED: NAC domain-containing protein 86-...  49.7    2e-07   
ref|XP_008678593.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  53.5    2e-07   
ref|NP_001242528.1|  uncharacterized protein LOC100795553             58.5    2e-07   
emb|CAN72061.1|  hypothetical protein VITISV_037483                   54.3    2e-07   
ref|XP_010246011.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  58.2    2e-07   
emb|CDX91785.1|  BnaC08g07040D                                        58.2    2e-07   
ref|XP_009629525.1|  PREDICTED: putative NAC domain-containing pr...  53.1    3e-07   
ref|XP_009413062.1|  PREDICTED: uncharacterized protein LOC103994...  50.4    3e-07   
ref|XP_007032209.1|  NAC domain protein, IPR003441, putative isof...  49.3    3e-07   
ref|XP_009629524.1|  PREDICTED: putative NAC domain-containing pr...  53.1    3e-07   
ref|XP_009782167.1|  PREDICTED: protein FEZ-like isoform X2           53.1    3e-07   
ref|XP_006283880.1|  hypothetical protein CARUB_v10004997mg           55.5    3e-07   
ref|XP_009782166.1|  PREDICTED: protein FEZ-like isoform X1           53.1    3e-07   
ref|XP_009790763.1|  PREDICTED: uncharacterized protein LOC104238166  49.7    3e-07   
ref|XP_004956807.1|  PREDICTED: protein FEZ-like                      53.5    3e-07   
gb|AIU39717.1|  NAC transcription factor 57                           54.3    3e-07   
ref|XP_003600640.1|  NAC domain protein                               49.3    3e-07   
gb|KCW67726.1|  hypothetical protein EUGRSUZ_F01463                   52.4    3e-07   
ref|XP_007048341.1|  NAC domain containing protein 82, putative       55.1    3e-07   
ref|XP_009107934.1|  PREDICTED: NAC domain-containing protein 74-...  57.8    3e-07   
ref|XP_002444402.1|  hypothetical protein SORBIDRAFT_07g021400        52.8    3e-07   
ref|XP_009625360.1|  PREDICTED: uncharacterized protein LOC104116251  50.1    3e-07   
ref|XP_007143604.1|  hypothetical protein PHAVU_007G085600g           58.9    3e-07   
ref|XP_004973529.1|  PREDICTED: protein FEZ-like                      53.1    3e-07   
ref|XP_002513398.1|  NAC domain-containing protein, putative          52.8    3e-07   
emb|CDY46459.1|  BnaA08g06490D                                        57.8    3e-07   
ref|NP_001061889.1|  Os08g0436700                                     52.8    3e-07   
ref|XP_009114751.1|  PREDICTED: uncharacterized protein LOC103840...  57.4    3e-07   
gb|EAZ07109.1|  hypothetical protein OsI_29357                        52.8    3e-07   
ref|XP_004157040.1|  PREDICTED: uncharacterized protein LOC101224912  48.9    3e-07   
ref|XP_009114752.1|  PREDICTED: uncharacterized protein LOC103840...  57.4    3e-07   
gb|ACX47024.1|  NAP-like transcription factor                         54.3    3e-07   
ref|XP_010651865.1|  PREDICTED: NAC transcription factor 29           54.3    3e-07   
ref|XP_010528598.1|  PREDICTED: NAC domain-containing protein 86 ...  48.9    3e-07   
ref|XP_009386703.1|  PREDICTED: NAC domain-containing protein 69-...  53.9    3e-07   
ref|XP_011074131.1|  PREDICTED: protein FEZ-like                      58.9    3e-07   
ref|XP_010064537.1|  PREDICTED: transcription factor JUNGBRUNNEN 1    52.4    3e-07   
gb|KHN11983.1|  NAC domain-containing protein 42                      57.8    3e-07   
ref|XP_010528600.1|  PREDICTED: NAC domain-containing protein 86 ...  48.9    3e-07   
emb|CDY16943.1|  BnaC09g40700D                                        48.9    3e-07   
gb|EEE58257.1|  hypothetical protein OsJ_09253                        50.1    3e-07   
ref|XP_006595570.1|  PREDICTED: uncharacterized protein LOC100795...  57.8    3e-07   
ref|XP_004503094.1|  PREDICTED: protein FEZ-like isoform X2           49.3    3e-07   
ref|XP_002267333.1|  PREDICTED: NAC domain-containing protein 86      48.9    3e-07   
emb|CDX70745.1|  BnaC03g08290D                                        49.3    3e-07   
ref|XP_010461247.1|  PREDICTED: uncharacterized protein LOC104741989  58.5    4e-07   
ref|XP_004135458.1|  PREDICTED: uncharacterized protein LOC101205554  52.4    4e-07   
ref|XP_004503093.1|  PREDICTED: protein FEZ-like isoform X1           49.3    4e-07   
ref|XP_009604550.1|  PREDICTED: uncharacterized protein LOC104099302  54.7    4e-07   
ref|XP_008439092.1|  PREDICTED: NAC domain-containing protein 7-like  53.1    4e-07   
ref|XP_006307120.1|  hypothetical protein CARUB_v10008706mg           58.5    4e-07   
ref|XP_004148915.1|  PREDICTED: uncharacterized protein LOC101209310  48.9    4e-07   
ref|XP_008463166.1|  PREDICTED: uncharacterized protein LOC103501372  49.3    4e-07   
ref|XP_006382846.1|  hypothetical protein POPTR_0005s06040g           53.5    4e-07   
ref|XP_006422209.1|  hypothetical protein CICLE_v10006695mg           55.8    4e-07   
ref|XP_010093173.1|  NAC domain-containing protein 42                 50.8    4e-07   
ref|XP_011032332.1|  PREDICTED: NAC transcription factor 29-like      53.5    4e-07   
emb|CBI27341.3|  unnamed protein product                              48.9    4e-07   
ref|XP_007146230.1|  hypothetical protein PHAVU_006G023100g           57.8    4e-07   
ref|XP_010918221.1|  PREDICTED: putative NAC domain-containing pr...  56.6    4e-07   
ref|NP_564440.1|  NAC domain containing protein 17                    56.6    4e-07   
ref|XP_006400258.1|  hypothetical protein EUTSA_v10013344mg           48.9    4e-07   
ref|XP_010552578.1|  PREDICTED: protein FEZ-like                      52.4    4e-07   
ref|XP_006437125.1|  hypothetical protein CICLE_v10032203mg           57.8    4e-07   
gb|ABO92972.1|  no apical meristem (NAM)-like protein                 52.4    4e-07   
ref|XP_008385273.1|  PREDICTED: NAC domain-containing protein 7-like  54.7    4e-07   
gb|ABR18034.1|  unknown                                               53.5    4e-07   
ref|XP_006659439.1|  PREDICTED: protein FEZ-like                      52.4    4e-07   
gb|AAT38710.2|  no apical meristem, identical                         52.4    4e-07   
gb|AAT39970.1|  Putative nam-like protein, identical                  52.4    4e-07   
ref|XP_008796590.1|  PREDICTED: uncharacterized protein LOC103712002  55.1    4e-07   
ref|XP_009121402.1|  PREDICTED: NAC domain-containing protein 19      48.5    4e-07   
ref|XP_009119137.1|  PREDICTED: protein BEARSKIN1-like                48.5    4e-07   
ref|XP_009376510.1|  PREDICTED: NAC domain-containing protein 7-like  54.7    4e-07   
ref|XP_007048365.1|  Transcription factor, putative                   54.3    4e-07   
ref|XP_010485657.1|  PREDICTED: NAC domain-containing protein 45-...  48.1    4e-07   
ref|XP_008383340.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  53.5    4e-07   
gb|EYU36537.1|  hypothetical protein MIMGU_mgv1a005759mg              58.2    4e-07   
ref|XP_003517789.2|  PREDICTED: protein FEZ                           51.6    4e-07   
ref|XP_007144249.1|  hypothetical protein PHAVU_007G140500g           51.2    4e-07   
ref|XP_010432195.1|  PREDICTED: NAC domain-containing protein 7-like  55.1    4e-07   
ref|XP_008466914.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  52.4    4e-07   
gb|KEH17171.1|  NAC transcription factor-like protein                 47.8    4e-07   
ref|XP_006372479.1|  hypothetical protein POPTR_0017s02020g           48.1    5e-07   
ref|XP_006390990.1|  hypothetical protein EUTSA_v10019631mg           52.4    5e-07   
ref|XP_009413063.1|  PREDICTED: uncharacterized protein LOC103994...  50.8    5e-07   
gb|KHM99647.1|  NAC domain-containing protein 42                      57.4    5e-07   
ref|XP_002526579.1|  hypothetical protein RCOM_1603380                48.5    5e-07   
emb|CDX95832.1|  BnaC05g35830D                                        53.9    5e-07   
ref|XP_010525037.1|  PREDICTED: NAC domain-containing protein 45-...  48.9    5e-07   
ref|XP_006297561.1|  hypothetical protein CARUB_v10013584mg           48.1    5e-07   
ref|XP_008796459.1|  PREDICTED: uncharacterized protein LOC103711919  53.1    5e-07   
ref|XP_011015092.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  52.4    5e-07   
ref|XP_009130343.1|  PREDICTED: protein BEARSKIN1 isoform X1          48.5    5e-07   
ref|XP_010446817.1|  PREDICTED: NAC domain-containing protein 7-like  54.7    5e-07   
gb|KHN45185.1|  NAC domain-containing protein 42                      57.4    5e-07   
ref|XP_009130344.1|  PREDICTED: protein BEARSKIN1 isoform X2          48.5    5e-07   
emb|CDY43143.1|  BnaA05g32430D                                        48.5    5e-07   
ref|XP_002867032.1|  hypothetical protein ARALYDRAFT_491017           54.7    5e-07   
emb|CDY48632.1|  BnaC06g08090D                                        57.0    5e-07   
ref|XP_003551931.1|  PREDICTED: transcription factor JUNGBRUNNEN 1    57.4    5e-07   
ref|XP_009598687.1|  PREDICTED: uncharacterized protein LOC104094...  49.3    5e-07   
gb|AGL39703.1|  NAC transcription factor 047                          47.8    5e-07   
ref|XP_006430405.1|  hypothetical protein CICLE_v10011293mg           49.7    5e-07   
ref|XP_003546832.1|  PREDICTED: NAC domain-containing protein 68-...  50.4    5e-07   
ref|XP_010053433.1|  PREDICTED: NAC domain-containing protein 7 i...  50.4    5e-07   
ref|XP_009131585.1|  PREDICTED: protein SOMBRERO-like                 48.9    5e-07   
ref|XP_002884362.1|  predicted protein                                47.8    5e-07   
ref|NP_001242810.1|  uncharacterized protein LOC100810472             57.0    6e-07   
ref|XP_004488556.1|  PREDICTED: NAC domain-containing protein 78-...  50.4    6e-07   
ref|XP_006481957.1|  PREDICTED: protein FEZ-like                      50.1    6e-07   
ref|XP_010463767.1|  PREDICTED: NAC domain-containing protein 45      48.1    6e-07   
ref|XP_003595952.1|  NAC domain protein                               50.4    6e-07   
ref|XP_004252556.1|  PREDICTED: uncharacterized protein LOC101255476  57.8    6e-07   
ref|XP_010437369.1|  PREDICTED: NAC domain-containing protein 7-like  54.7    6e-07   
gb|KEH28399.1|  transcription factor jungbrunnen-like protein         57.0    6e-07   
ref|XP_002297931.1|  hypothetical protein POPTR_0001s11660g           52.8    6e-07   
ref|XP_010453910.1|  PREDICTED: NAC domain-containing protein 86-...  49.7    6e-07   
emb|CDY28745.1|  BnaCnng06310D                                        48.5    6e-07   
ref|XP_010507160.1|  PREDICTED: NAC domain-containing protein 45      47.8    6e-07   
ref|XP_010552945.1|  PREDICTED: uncharacterized protein LOC104823...  54.7    6e-07   
ref|NP_196060.1|  NAC domain containing protein 77                    57.4    6e-07   
ref|NP_195339.1|  NAC domain containing protein 76                    54.3    6e-07   
ref|XP_010492671.1|  PREDICTED: NAC domain-containing protein 86-...  48.1    6e-07   
ref|XP_010090859.1|  NAC domain-containing protein 78                 53.9    6e-07   
ref|NP_186970.2|  NAC domain containing protein 45                    47.8    6e-07   
ref|XP_009420175.1|  PREDICTED: NAC domain-containing protein 74-...  55.8    6e-07   
emb|CDX69208.1|  BnaC01g02450D                                        54.3    6e-07   
ref|XP_007149170.1|  hypothetical protein PHAVU_005G047300g           50.1    6e-07   
ref|XP_009613292.1|  PREDICTED: NAC domain-containing protein 19-...  57.8    7e-07   
ref|XP_009350270.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  53.1    7e-07   
ref|XP_010062323.1|  PREDICTED: NAC domain-containing protein 78      47.8    7e-07   
ref|XP_010551540.1|  PREDICTED: protein FEZ                           51.6    7e-07   
ref|XP_002891081.1|  ANAC016                                          57.8    7e-07   
ref|XP_011022380.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  52.0    7e-07   
ref|XP_010461249.1|  PREDICTED: uncharacterized protein LOC104741...  55.8    7e-07   
gb|AHA84182.1|  NAC transcription factor 49                           57.8    7e-07   



>gb|AAM34772.1|AF509872_1 nam-like protein 9 [Petunia x hybrida]
Length=462

 Score = 86.3 bits (212),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MESRGSS+LLAPGFRFHPTDEELV YYLRR+VC KPLR DAIS
Sbjct  1    MESRGSSKLLAPGFRFHPTDEELVRYYLRRKVCGKPLRIDAIS  43


 Score = 33.9 bits (76),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYKVEPWDLPG
Sbjct  45   IDIYKVEPWDLPG  57



>ref|XP_006345843.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=544

 Score = 80.9 bits (198),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MES+GS++L+APGFRFHPTDEELV YYLRR++  KPLRFDAIS
Sbjct  1    MESKGSAKLMAPGFRFHPTDEELVRYYLRRKIIGKPLRFDAIS  43


 Score = 34.3 bits (77),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYKVEPWDLPG
Sbjct  44   EIDIYKVEPWDLPG  57



>ref|XP_004239710.1| PREDICTED: NAC domain-containing protein 78-like [Solanum lycopersicum]
Length=544

 Score = 79.0 bits (193),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MES+GS++ +APGFRFHPTDEELV YYLRR+V  KPLRFDAIS
Sbjct  1    MESKGSAKWMAPGFRFHPTDEELVRYYLRRKVIGKPLRFDAIS  43


 Score = 33.9 bits (76),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYKVEPWDLPG
Sbjct  44   EIDIYKVEPWDLPG  57



>ref|XP_009764398.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=542

 Score = 78.2 bits (191),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MESR S  LLAPGFRFHPTDEELV YYLRR++  KPLRFDAIS
Sbjct  1    MESRRSKNLLAPGFRFHPTDEELVRYYLRRKIIGKPLRFDAIS  43


 Score = 33.9 bits (76),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYKVEPWDLPG
Sbjct  44   EIDIYKVEPWDLPG  57



>ref|XP_009625486.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=542

 Score = 77.0 bits (188),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            ME+R S  LLAPGFRFHPTDEELV YYLRR++  KPLRFDAIS
Sbjct  1    METRRSKNLLAPGFRFHPTDEELVRYYLRRKIIGKPLRFDAIS  43


 Score = 33.9 bits (76),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYKVEPWDLPG
Sbjct  44   EIDIYKVEPWDLPG  57



>ref|XP_006361710.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Solanum 
tuberosum]
Length=543

 Score = 70.9 bits (172),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MESRGSS+LLAPGFRFHPTDEELV YYLRR++  +  + D IS
Sbjct  1    MESRGSSKLLAPGFRFHPTDEELVRYYLRRKIYGRTFKSDLIS  43


 Score = 34.3 bits (77),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYKVEPWDLPG
Sbjct  44   EIDIYKVEPWDLPG  57



>ref|XP_004250028.1| PREDICTED: NAC domain-containing protein 78 [Solanum lycopersicum]
Length=528

 Score = 70.1 bits (170),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MESRGSS+LLAPGFRFHPTDEELV YYLRR++  +  + D IS
Sbjct  1    MESRGSSKLLAPGFRFHPTDEELVRYYLRRKIYGRTFKSDLIS  43


 Score = 34.7 bits (78),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYKVEPWDLPG
Sbjct  44   EIDIYKVEPWDLPG  57



>ref|XP_011469277.1| PREDICTED: NAC domain-containing protein 78 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=560

 Score = 70.5 bits (171),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R SSQ LAPGFRFHPTDEELV+YYL+R+V  K  RFDAIS
Sbjct  3    RQSSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAIS  42


 Score = 32.7 bits (73),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK+EPWDLPG
Sbjct  44   VDIYKIEPWDLPG  56



>ref|XP_004307017.1| PREDICTED: NAC domain-containing protein 78 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=559

 Score = 70.5 bits (171),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R SSQ LAPGFRFHPTDEELV+YYL+R+V  K  RFDAIS
Sbjct  3    RQSSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAIS  42


 Score = 32.7 bits (73),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK+EPWDLPG
Sbjct  44   VDIYKIEPWDLPG  56



>ref|XP_011469274.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=597

 Score = 70.5 bits (171),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R SSQ LAPGFRFHPTDEELV+YYL+R+V  K  RFDAIS
Sbjct  3    RQSSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAIS  42


 Score = 32.3 bits (72),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK+EPWDLPG
Sbjct  44   VDIYKIEPWDLPG  56



>ref|XP_011469276.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=596

 Score = 70.5 bits (171),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R SSQ LAPGFRFHPTDEELV+YYL+R+V  K  RFDAIS
Sbjct  3    RQSSQSLAPGFRFHPTDEELVWYYLKRKVAGKSFRFDAIS  42


 Score = 32.3 bits (72),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK+EPWDLPG
Sbjct  44   VDIYKIEPWDLPG  56



>ref|XP_010552948.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=568

 Score = 73.6 bits (179),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R++C KP RFDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKICNKPFRFDAIS  42


 Score = 28.9 bits (63),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            IDIYK EPWDLP
Sbjct  44   IDIYKSEPWDLP  55



>ref|XP_009599412.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=541

 Score = 68.2 bits (165),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MESRGS + LAPGFRFHPTDEELV YYLRR++  KP++   IS
Sbjct  1    MESRGSLKSLAPGFRFHPTDEELVRYYLRRKITGKPIKSAPIS  43


 Score = 33.5 bits (75),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYKVEPWDLPG
Sbjct  45   IDIYKVEPWDLPG  57



>gb|EYU39671.1| hypothetical protein MIMGU_mgv1a003896mg [Erythranthe guttata]
Length=557

 Score = 70.1 bits (170),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 4/47 (9%)
 Frame = +1

Query  157  MES----RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MES    + SS LLAPGFRFHPTDEELV YYLRR+VC +  RFDAIS
Sbjct  3    MESNAGKKKSSGLLAPGFRFHPTDEELVRYYLRRKVCGRGFRFDAIS  49


 Score = 30.8 bits (68),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +IDIYK EPWDLP
Sbjct  50   EIDIYKAEPWDLP  62



>ref|XP_009386218.1| PREDICTED: NAC domain-containing protein 78-like [Musa acuminata 
subsp. malaccensis]
Length=631

 Score = 68.2 bits (165),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M    SS  LAPGFRFHPTDEELV YYL+R++C +PLR DAI+
Sbjct  1    MIGASSSAALAPGFRFHPTDEELVGYYLQRKICGRPLRVDAIA  43


 Score = 32.7 bits (73),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK EPWDLPG
Sbjct  44   EVDLYKCEPWDLPG  57



>emb|CDY44853.1| BnaC09g50530D [Brassica napus]
Length=560

 Score = 73.9 bits (180),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  45   DIYKSEPWDLP  55



>emb|CDY61762.1| BnaAnng17650D [Brassica napus]
Length=519

 Score = 73.2 bits (178),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP  FDAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFNFDAIS  42


 Score = 27.3 bits (59),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_009771991.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score = 66.6 bits (161),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            MESRGS + LAPGFRFHPTDEELV YYLRR++  +P++   IS
Sbjct  1    MESRGSLKSLAPGFRFHPTDEELVRYYLRRKITGRPIKSAPIS  43


 Score = 33.5 bits (75),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 13/13 (100%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYKVEPWDLPG
Sbjct  45   IDIYKVEPWDLPG  57



>emb|CDO99814.1| unnamed protein product [Coffea canephora]
Length=582

 Score = 68.9 bits (167),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +S  LAPGFRFHPTDEELV YYLRR++C KP R DAIS
Sbjct  5    TSTSLAPGFRFHPTDEELVRYYLRRKLCGKPFRLDAIS  42


 Score = 31.2 bits (69),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYK EPW+LPG
Sbjct  43   EIDIYKAEPWELPG  56



>emb|CDY14157.1| BnaC02g02740D [Brassica napus]
Length=516

 Score = 73.2 bits (178),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP  FDAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFNFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|NP_196061.1| NAC family transcriptional activator [Arabidopsis thaliana]
 sp|Q84K00.2|NAC78_ARATH RecName: Full=NAC domain-containing protein 78; Short=ANAC078 
[Arabidopsis thaliana]
 emb|CAB85547.1| putative protein [Arabidopsis thaliana]
 gb|AAM20460.1| putative protein [Arabidopsis thaliana]
 gb|AAM91259.1| putative protein [Arabidopsis thaliana]
 gb|AED90739.1| NAC family transcriptional activator [Arabidopsis thaliana]
Length=567

 Score = 72.8 bits (177),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  45   DIYKSEPWDLP  55



>ref|XP_010543581.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=567

 Score = 70.9 bits (172),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S   LAPGFRFHPTDEELV YYL+R++C KP RFDAIS
Sbjct  3    RDSVTSLAPGFRFHPTDEELVRYYLKRKICNKPFRFDAIS  42


 Score = 29.3 bits (64),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            IDIYK EPWDLP
Sbjct  44   IDIYKSEPWDLP  55



>gb|KFK38438.1| hypothetical protein AALP_AA3G113300 [Arabis alpina]
Length=558

 Score = 73.2 bits (178),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGSS  LAPGFRFHPTDEELV YYL+R++C KPL+FDAIS
Sbjct  3    RGSS--LAPGFRFHPTDEELVCYYLKRKICNKPLKFDAIS  40


 Score = 26.6 bits (57),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  43   DVYKSEPWDLP  53



>ref|XP_002882677.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58936.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
Length=560

 Score = 72.8 bits (177),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_002871092.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47351.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
Length=568

 Score = 72.8 bits (177),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  45   DIYKSEPWDLP  55



>gb|AAM65338.1| NAC, putative [Arabidopsis thaliana]
Length=549

 Score = 72.8 bits (177),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>gb|AAG51388.1|AC011560_20 unknown protein; 75639-73470 [Arabidopsis thaliana]
 gb|AAF76351.1| NAC, putative [Arabidopsis thaliana]
Length=558

 Score = 72.8 bits (177),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|NP_566376.1| NAC domain containing protein 53 [Arabidopsis thaliana]
 gb|AAK93680.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85076.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74917.1| NAC domain containing protein 53 [Arabidopsis thaliana]
Length=549

 Score = 72.8 bits (177),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_009125558.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=505

 Score = 72.8 bits (177),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP  FDAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFNFDAIS  42


 Score = 26.6 bits (57),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_009125559.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=504

 Score = 72.8 bits (177),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP  FDAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFNFDAIS  42


 Score = 26.6 bits (57),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>gb|AAF09254.1|AF201456_1 NAC2 [Arabidopsis thaliana]
Length=569

 Score = 72.8 bits (177),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  3    RGSVASLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  45   DIYKSEPWDLP  55



>emb|CDY11289.1| BnaA03g01250D [Brassica napus]
Length=566

 Score = 72.4 bits (176),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP + DAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFKLDAIS  42


 Score = 27.3 bits (59),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_009130821.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=567

 Score = 72.4 bits (176),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP + DAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFKLDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_009130822.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=566

 Score = 72.4 bits (176),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP + DAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFKLDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_002265345.2| PREDICTED: NAC domain-containing protein 78 [Vitis vinifera]
 emb|CBI31389.3| unnamed protein product [Vitis vinifera]
Length=559

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S+  LAPGFRFHPTDEELV+YYL+R+VC K  RFD IS
Sbjct  3    RESAASLAPGFRFHPTDEELVWYYLKRKVCGKLFRFDTIS  42


 Score = 32.0 bits (71),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYK EPWDLPG
Sbjct  43   EIDIYKSEPWDLPG  56



>ref|XP_006407560.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
 gb|ESQ49013.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
Length=553

 Score = 72.4 bits (176),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SRGS   LAPGFRFHPT+EELV YYL+R++C KP +FDAIS
Sbjct  2    SRGSETSLAPGFRFHPTEEELVCYYLKRKICNKPFKFDAIS  42


 Score = 26.9 bits (58),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>emb|CAN70406.1| hypothetical protein VITISV_021988 [Vitis vinifera]
Length=573

 Score = 67.0 bits (162),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S+  LAPGFRFHPTDEELV+YYL+R+VC K  RFD IS
Sbjct  3    RESAASLAPGFRFHPTDEELVWYYLKRKVCGKLFRFDTIS  42


 Score = 32.0 bits (71),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYK EPWDLPG
Sbjct  43   EIDIYKSEPWDLPG  56



>ref|XP_006398899.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
 gb|ESQ40352.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
Length=572

 Score = 71.6 bits (174),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R+VC +P +FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKVCNRPFKFDAIS  42


 Score = 27.3 bits (59),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  45   DIYKSEPWDLP  55



>gb|EPS65703.1| nam-like protein 9 [Genlisea aurea]
Length=542

 Score = 69.3 bits (168),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SS +LAPGFRFHPTDEELV YYLRR+VC K  RFDAIS
Sbjct  16   SSTMLAPGFRFHPTDEELVRYYLRRKVCGKGFRFDAIS  53


 Score = 29.3 bits (64),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            IDIYK EPWDLP
Sbjct  55   IDIYKAEPWDLP  66



>emb|CDY58437.1| BnaC03g71220D [Brassica napus]
Length=556

 Score = 72.4 bits (176),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS+  LAPGFRFHPTDEELV YYL+R+VC KP + DAIS
Sbjct  3    RGSATSLAPGFRFHPTDEELVRYYLKRKVCNKPFKLDAIS  42


 Score = 26.6 bits (57),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_009361439.1| PREDICTED: NAC domain-containing protein 78-like [Pyrus x bretschneideri]
Length=589

 Score = 67.0 bits (162),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 31.6 bits (70),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  44   IDIYKTEPWDLPG  56



>ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-like [Sesamum indicum]
Length=563

 Score = 67.4 bits (163),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  181  LLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +LAPGFRFHPTDEELV YYLRR+VC K  RFDAIS
Sbjct  16   MLAPGFRFHPTDEELVRYYLRRKVCGKGFRFDAIS  50


 Score = 30.8 bits (68),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +IDIYK EPWDLP
Sbjct  51   EIDIYKAEPWDLP  63



>ref|XP_010243195.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nelumbo 
nucifera]
Length=557

 Score = 67.4 bits (163),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            G    LAPGFRFHPTDEELV YYL+R+V  KP RFDAIS
Sbjct  2    GGEAALAPGFRFHPTDEELVSYYLKRKVLGKPFRFDAIS  40


 Score = 31.2 bits (69),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +ID+YK EPWDLPG
Sbjct  41   EIDVYKSEPWDLPG  54



>ref|XP_010243196.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Nelumbo 
nucifera]
Length=556

 Score = 67.4 bits (163),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            G    LAPGFRFHPTDEELV YYL+R+V  KP RFDAIS
Sbjct  2    GGEAALAPGFRFHPTDEELVSYYLKRKVLGKPFRFDAIS  40


 Score = 31.2 bits (69),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +ID+YK EPWDLPG
Sbjct  41   EIDVYKSEPWDLPG  54



>ref|XP_010464726.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=556

 Score = 71.6 bits (174),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GS+  LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  4    GSATSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 26.6 bits (57),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_010486664.1| PREDICTED: NAC domain-containing protein 78 [Camelina sativa]
Length=555

 Score = 71.6 bits (174),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GS+  LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  4    GSATSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 26.6 bits (57),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>ref|XP_010485001.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
 ref|XP_010485043.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
 ref|XP_010485093.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Camelina 
sativa]
Length=555

 Score = 71.6 bits (174),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GS+  LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  4    GSATSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 26.2 bits (56),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>emb|CDX70227.1| BnaA10g25760D [Brassica napus]
Length=554

 Score = 71.2 bits (173),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV YYL+R+VC KP  FDAIS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFNFDAIS  42


 Score = 26.6 bits (57),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  45   DIYKSEPWDLP  55



>ref|XP_009346650.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Pyrus 
x bretschneideri]
Length=608

 Score = 66.2 bits (160),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 31.6 bits (70),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK+EPWDLPG
Sbjct  44   VDIYKIEPWDLPG  56



>ref|XP_009346652.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Pyrus 
x bretschneideri]
Length=607

 Score = 66.2 bits (160),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 31.6 bits (70),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK+EPWDLPG
Sbjct  44   VDIYKIEPWDLPG  56



>ref|XP_009346651.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Pyrus 
x bretschneideri]
Length=607

 Score = 66.2 bits (160),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 31.6 bits (70),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK+EPWDLPG
Sbjct  44   VDIYKIEPWDLPG  56



>ref|XP_004142444.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
Length=524

 Score = 66.2 bits (160),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S+  LAPGFRFHPTDEELV YYL+R+V  KP RFD IS
Sbjct  3    RDSATSLAPGFRFHPTDEELVSYYLKRKVSGKPFRFDPIS  42


 Score = 31.6 bits (70),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  44   IDIYKSEPWDLPG  56



>ref|XP_004173168.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
Length=566

 Score = 65.9 bits (159),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S+  LAPGFRFHPTDEELV YYL+R+V  KP RFD IS
Sbjct  3    RDSATSLAPGFRFHPTDEELVSYYLKRKVSGKPFRFDPIS  42


 Score = 31.6 bits (70),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  44   IDIYKSEPWDLPG  56



>gb|KGN52230.1| hypothetical protein Csa_5G622470 [Cucumis sativus]
Length=562

 Score = 65.9 bits (159),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S+  LAPGFRFHPTDEELV YYL+R+V  KP RFD IS
Sbjct  3    RDSATSLAPGFRFHPTDEELVSYYLKRKVSGKPFRFDPIS  42


 Score = 32.0 bits (71),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  44   IDIYKSEPWDLPG  56



>gb|EYU32441.1| hypothetical protein MIMGU_mgv1a002437mg [Erythranthe guttata]
Length=675

 Score = 67.8 bits (164),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 4/48 (8%)
 Frame = +1

Query  154  VMES----RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +MES    + S+ LLAPGFRFHPTDEELV YYLRR++  K  RFDAIS
Sbjct  154  LMESIAGKKKSTSLLAPGFRFHPTDEELVRYYLRRKIFGKSFRFDAIS  201


 Score = 29.6 bits (65),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            ++D+YK EPWDLP
Sbjct  202  EVDVYKSEPWDLP  214



>gb|ADL36811.1| NAC domain class transcription factor [Malus domestica]
Length=607

 Score = 66.2 bits (160),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 31.2 bits (69),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  44   IDIYKTEPWDLPG  56



>ref|XP_008446811.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis melo]
Length=561

 Score = 65.9 bits (159),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S+  LAPGFRFHPTDEELV YYL+R+V  KP RFD IS
Sbjct  3    RDSATSLAPGFRFHPTDEELVSYYLKRKVSGKPFRFDPIS  42


 Score = 31.6 bits (70),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  44   IDIYKSEPWDLPG  56



>ref|XP_010090439.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB39454.1| NAC domain-containing protein 78 [Morus notabilis]
Length=612

 Score = 68.9 bits (167),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R SS  LAPGFRFHPTDEELV YYL+R+VC +PLR D IS
Sbjct  3    RDSSTSLAPGFRFHPTDEELVRYYLKRKVCGRPLRIDPIS  42


 Score = 28.1 bits (61),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            +D+YK EPWDLP
Sbjct  44   VDVYKSEPWDLP  55



>ref|XP_006297351.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
 gb|EOA30249.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
Length=558

 Score = 71.6 bits (174),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GS+  LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  4    GSATSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  42


 Score = 25.4 bits (54),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 8/10 (80%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
 Frame = +3

Query  294  IYKVEPWDLP  323
            +YK EPWDLP
Sbjct  46   VYKSEPWDLP  55



>ref|XP_008339778.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Malus 
domestica]
Length=603

 Score = 66.6 bits (161),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 30.8 bits (68),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK EPWDLPG
Sbjct  44   VDIYKTEPWDLPG  56



>ref|XP_008339779.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Malus 
domestica]
Length=602

 Score = 66.6 bits (161),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 30.8 bits (68),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK EPWDLPG
Sbjct  44   VDIYKTEPWDLPG  56



>ref|XP_008345397.1| PREDICTED: NAC domain-containing protein 78-like [Malus domestica]
Length=609

 Score = 65.9 bits (159),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG    LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  2    ARGKENSLAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  42


 Score = 31.2 bits (69),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  44   IDIYKTEPWDLPG  56



>ref|XP_011101543.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Sesamum 
indicum]
Length=547

 Score = 66.6 bits (161),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            L PGFRFHPTDEELV YYLRR+VC K LR DAIS
Sbjct  19   LGPGFRFHPTDEELVQYYLRRKVCGKALRLDAIS  52


 Score = 30.4 bits (67),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +ID+YK EPWDLP
Sbjct  53   EIDVYKAEPWDLP  65



>ref|XP_011101544.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Sesamum 
indicum]
Length=542

 Score = 66.2 bits (160),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            L PGFRFHPTDEELV YYLRR+VC K LR DAIS
Sbjct  19   LGPGFRFHPTDEELVQYYLRRKVCGKALRLDAIS  52


 Score = 30.4 bits (67),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +ID+YK EPWDLP
Sbjct  53   EIDVYKAEPWDLP  65



>ref|XP_010267268.1| PREDICTED: NAC domain-containing protein 78-like [Nelumbo nucifera]
Length=589

 Score = 66.2 bits (160),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            G    LAPGFRFHPTDEELV YYL+R++  KP RF+AIS
Sbjct  14   GGEAALAPGFRFHPTDEELVSYYLKRKILGKPFRFEAIS  52


 Score = 30.8 bits (68),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK EPWDLPG
Sbjct  53   EVDLYKTEPWDLPG  66



>ref|XP_010694513.1| PREDICTED: NAC domain-containing protein 78 [Beta vulgaris subsp. 
vulgaris]
Length=540

 Score = 68.2 bits (165),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M    SS  LAPGFRFHPTDEELV+YYLRR+V  KP R DAIS
Sbjct  1    MGRNSSSTSLAPGFRFHPTDEELVWYYLRRKVSGKPFRVDAIS  43


 Score = 28.5 bits (62),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +IDIYKVEP DLPG
Sbjct  44   EIDIYKVEPSDLPG  57



>gb|AIA57516.1| NAC domain-containing protein [Boehmeria nivea]
Length=631

 Score = 69.7 bits (169),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R SS  LAPGFRFHPTDEELV YYL+R+VC KPLR D I+
Sbjct  3    RDSSTSLAPGFRFHPTDEELVRYYLKRKVCGKPLRVDPIT  42


 Score = 26.9 bits (58),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            +DIYK EPW+LP
Sbjct  44   VDIYKSEPWELP  55



>ref|XP_010032131.1| PREDICTED: NAC domain-containing protein 78 [Eucalyptus grandis]
 gb|KCW51525.1| hypothetical protein EUGRSUZ_J01038 [Eucalyptus grandis]
Length=538

 Score = 68.2 bits (165),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R   + LAPGFRFHPTDEEL+ YYL+R+V  KPLRFDAIS
Sbjct  3    RDKGKSLAPGFRFHPTDEELIRYYLKRKVSGKPLRFDAIS  42


 Score = 28.1 bits (61),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            ++D+YK EPWDLP
Sbjct  43   EVDVYKCEPWDLP  55



>ref|XP_010423582.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Camelina 
sativa]
Length=563

 Score = 68.9 bits (167),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  10   LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  43


 Score = 26.9 bits (58),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_010423583.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Camelina 
sativa]
Length=562

 Score = 68.9 bits (167),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  10   LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  43


 Score = 26.9 bits (58),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_009418258.1| PREDICTED: uncharacterized protein LOC103998499 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score = 65.5 bits (158),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC +PLR DA++
Sbjct  25   LAPGFRFHPTDEELVSYYLKRKVCGRPLRNDAVA  58


 Score = 30.4 bits (67),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+Y+ EPWDLPG
Sbjct  59   EVDLYRCEPWDLPG  72



>ref|XP_010490948.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
 ref|XP_010490949.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=563

 Score = 68.9 bits (167),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  10   LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  43


 Score = 26.6 bits (57),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_010490950.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Camelina 
sativa]
 ref|XP_010490951.1| PREDICTED: NAC domain-containing protein 78-like isoform X4 [Camelina 
sativa]
Length=562

 Score = 68.9 bits (167),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  10   LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  43


 Score = 26.6 bits (57),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_010694507.1| PREDICTED: NAC domain-containing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=401

 Score = 68.2 bits (165),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRS  291
            LAPGFRFHPTD+ELV YYL+R++C KP+RFDAIS +
Sbjct  24   LAPGFRFHPTDQELVSYYLKRKICGKPIRFDAISET  59


 Score = 27.3 bits (59),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            + DIYK EPWDLP 
Sbjct  58   ETDIYKSEPWDLPA  71



>ref|XP_010452336.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
Length=563

 Score = 68.9 bits (167),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  10   LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  43


 Score = 26.6 bits (57),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_010452337.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=562

 Score = 68.9 bits (167),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC KP +FDAIS
Sbjct  10   LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAIS  43


 Score = 26.6 bits (57),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_009122601.1| PREDICTED: NAC domain-containing protein 78-like [Brassica rapa]
Length=554

 Score = 68.6 bits (166),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GS   LAPGFRFHPTDEELV YYL+R+VC KP  FDAIS
Sbjct  4    GSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFTFDAIS  42


 Score = 26.6 bits (57),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  45   DIYKSEPWDLP  55



>emb|CDY41354.1| BnaA01g31650D [Brassica napus]
Length=537

 Score = 69.7 bits (169),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +1

Query  169  GSSQL--LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GSS+   LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  6    GSSETSSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  46


 Score = 25.8 bits (55),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 8/10 (80%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
 Frame = +3

Query  294  IYKVEPWDLP  323
            +YK EPWDLP
Sbjct  50   VYKSEPWDLP  59



>ref|XP_002532627.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29758.1| conserved hypothetical protein [Ricinus communis]
Length=514

 Score = 66.2 bits (160),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 2/43 (5%)
 Frame = +1

Query  163  SRGSSQL--LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            +RG S    LAPGFRFHPTDEELV YYL+R+V  KP RFDAI+
Sbjct  2    ARGDSSAASLAPGFRFHPTDEELVRYYLKRKVTNKPFRFDAIA  44


 Score = 28.9 bits (63),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            +DIYK EPWDLP
Sbjct  46   VDIYKTEPWDLP  57



>ref|XP_007218872.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
 gb|EMJ20071.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
Length=590

 Score = 62.8 bits (151),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  6    LAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  39


 Score = 31.2 bits (69),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  41   IDIYKTEPWDLPG  53



>ref|XP_009122853.1| PREDICTED: NAC domain-containing protein 78 [Brassica rapa]
Length=537

 Score = 68.6 bits (166),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  13   LAPGFRFHPTDEELVRYYLKRKICDKPFKFDAIS  46


 Score = 25.4 bits (54),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 8/10 (80%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
 Frame = +3

Query  294  IYKVEPWDLP  323
            +YK EPWDLP
Sbjct  50   VYKSEPWDLP  59



>ref|XP_008232318.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Prunus 
mume]
Length=591

 Score = 62.8 bits (151),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  6    LAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  39


 Score = 31.2 bits (69),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  41   IDIYKTEPWDLPG  53



>ref|XP_008232319.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Prunus 
mume]
Length=590

 Score = 62.8 bits (151),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV+YYL+R+V  K  RFD IS
Sbjct  6    LAPGFRFHPTDEELVWYYLKRKVSGKNFRFDPIS  39


 Score = 31.2 bits (69),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            IDIYK EPWDLPG
Sbjct  41   IDIYKTEPWDLPG  53



>emb|CDY70627.1| BnaAnng34420D, partial [Brassica napus]
Length=165

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (5%)
 Frame = +1

Query  169  GSSQL--LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GSS+   LAPGFRFHPTDEELV YYL+R++C KP +FDAIS
Sbjct  6    GSSETSSLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAIS  46



>ref|XP_010067201.1| PREDICTED: uncharacterized protein LOC104454139 [Eucalyptus grandis]
 ref|XP_010067202.1| PREDICTED: uncharacterized protein LOC104454139 [Eucalyptus grandis]
 gb|KCW65283.1| hypothetical protein EUGRSUZ_G02740 [Eucalyptus grandis]
 gb|KCW65284.1| hypothetical protein EUGRSUZ_G02740 [Eucalyptus grandis]
Length=412

 Score = 65.9 bits (159),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            + SS  LAPGFRFHPTDEELV YYL+R++C K  RFD I+
Sbjct  21   KTSSTALAPGFRFHPTDEELVIYYLKRKMCGKSFRFDVIA  60


 Score = 28.1 bits (61),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +DIYK EPWDL G
Sbjct  62   VDIYKTEPWDLAG  74



>gb|AGL39700.1| NAC transcription factor 044 [Jatropha curcas]
 gb|KDP45077.1| hypothetical protein JCGZ_01577 [Jatropha curcas]
Length=563

 Score = 64.7 bits (156),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SS  LAPGFRFHPTDEELV YYL+R+V  KP RFD I+
Sbjct  6    SSTSLAPGFRFHPTDEELVRYYLKRKVTNKPFRFDPIA  43


 Score = 28.9 bits (63),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            IDIYK EPWDLP
Sbjct  45   IDIYKSEPWDLP  56



>gb|KHG27497.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=442

 Score = 67.8 bits (164),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  160  ESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            E+ GS+  LAPGFRFHPTDEELV YYL+R+V  KP+RF+AI+
Sbjct  18   ETGGSATALAPGFRFHPTDEELVSYYLKRKVTNKPVRFNAIA  59


 Score = 25.8 bits (55),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  60   EVDIYKHEPWDL  71



>gb|KJB74741.1| hypothetical protein B456_012G007000 [Gossypium raimondii]
Length=443

 Score = 67.8 bits (164),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  160  ESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            E+ GS+  LAPGFRFHPTDEELV YYL+R+V  KP+RF+AI+
Sbjct  18   ETGGSATALAPGFRFHPTDEELVSYYLKRKVTNKPVRFNAIA  59


 Score = 25.8 bits (55),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  60   EVDIYKHEPWDL  71



>ref|XP_002311983.2| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|EEE89350.2| NAC domain-containing protein 78 [Populus trichocarpa]
Length=568

 Score = 67.0 bits (162),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M    S+  LAPGFRFHPTDEELV YYL+R+V  KP RFDAIS
Sbjct  1    MGRSDSATSLAPGFRFHPTDEELVRYYLKRKVTNKPFRFDAIS  43


 Score = 26.6 bits (57),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_006379522.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
 gb|ERP57319.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
Length=581

 Score = 67.0 bits (162),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M    S+  LAPGFRFHPTDEELV YYL+R+V  KP RFDAIS
Sbjct  1    MGRSDSATSLAPGFRFHPTDEELVRYYLKRKVTNKPFRFDAIS  43


 Score = 26.6 bits (57),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>gb|AHJ79210.1| NAC domain protein NAC69 [Gossypium hirsutum]
Length=416

 Score = 67.8 bits (164),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  160  ESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            E+ GS+  LAPGFRFHPTDEELV YYL+R+V  KP+RF+AI+
Sbjct  18   ETGGSATALAPGFRFHPTDEELVSYYLKRKVTNKPVRFNAIA  59


 Score = 25.8 bits (55),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  60   EVDIYKHEPWDL  71



>gb|EMT21706.1| NAC domain-containing protein 78 [Aegilops tauschii]
Length=1032

 Score = 61.6 bits (148),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  22   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  55


 Score = 31.6 bits (70),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YKVEPWDLP 
Sbjct  56   EVDLYKVEPWDLPA  69



>ref|XP_006361711.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Solanum 
tuberosum]
Length=563

 Score = 65.1 bits (157),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYLRR+ C KP R +A+S
Sbjct  30   LAPGFRFHPTDEELVRYYLRRKACGKPFRIEAVS  63


 Score = 27.7 bits (60),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +ID+YK EPWDL G
Sbjct  64   EIDVYKSEPWDLRG  77



>ref|XP_010090441.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB39456.1| NAC domain-containing protein 78 [Morus notabilis]
Length=482

 Score = 65.9 bits (159),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC KP RF+AI+
Sbjct  45   LAPGFRFHPTDEELVIYYLKRKVCGKPFRFNAIT  78


 Score = 26.9 bits (58),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++D+YK EPWDL
Sbjct  79   EVDVYKSEPWDL  90



>ref|XP_004496132.1| PREDICTED: NAC domain-containing protein 7-like isoform X2 [Cicer 
arietinum]
Length=458

 Score = 65.5 bits (158),  Expect(2) = 9e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC K  RFDAIS
Sbjct  31   LAPGFRFHPTDEELVIYYLKRKVCGKHFRFDAIS  64


 Score = 27.3 bits (59),  Expect(2) = 9e-11, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  65   EVDIYKSEPWDL  76



>ref|XP_011031618.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=556

 Score = 66.2 bits (160),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M    S+  LAPGFRFHPTDEELV YYL+R+V  KP RFDAIS
Sbjct  1    MGRSDSATSLAPGFRFHPTDEELVRYYLKRKVTNKPFRFDAIS  43


 Score = 26.6 bits (57),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_004496131.1| PREDICTED: NAC domain-containing protein 7-like isoform X1 [Cicer 
arietinum]
Length=462

 Score = 65.1 bits (157),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+VC K  RFDAIS
Sbjct  31   LAPGFRFHPTDEELVIYYLKRKVCGKHFRFDAIS  64


 Score = 27.3 bits (59),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  65   EVDIYKSEPWDL  76



>ref|XP_002444576.1| hypothetical protein SORBIDRAFT_07g023900 [Sorghum bicolor]
 gb|EES14071.1| hypothetical protein SORBIDRAFT_07g023900 [Sorghum bicolor]
Length=670

 Score = 61.2 bits (147),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  32   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  65


 Score = 31.2 bits (69),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YKVEPWDLP 
Sbjct  66   EVDLYKVEPWDLPA  79



>gb|KFK24891.1| hypothetical protein AALP_AA8G038000 [Arabis alpina]
Length=580

 Score = 65.9 bits (159),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            RGS   LAPGFRFHPTDEELV +YL+R+VC +P + D IS
Sbjct  3    RGSVTSLAPGFRFHPTDEELVRFYLKRKVCNRPFKLDPIS  42


 Score = 26.2 bits (56),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  45   DVYKSEPWDLP  55



>gb|ADE34584.1| NAC transcription factor NTL5 [Triticum aestivum]
Length=646

 Score = 60.8 bits (146),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  22   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  55


 Score = 31.6 bits (70),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YKVEPWDLP 
Sbjct  56   EVDLYKVEPWDLPA  69



>ref|XP_003573214.1| PREDICTED: NAC domain-containing protein 78-like [Brachypodium 
distachyon]
Length=653

 Score = 61.6 bits (148),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  29   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  62


 Score = 30.4 bits (67),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK+EPWDLP 
Sbjct  63   EVDLYKLEPWDLPA  76



>ref|XP_006297543.1| hypothetical protein CARUB_v10013564mg, partial [Capsella rubella]
 gb|EOA30441.1| hypothetical protein CARUB_v10013564mg, partial [Capsella rubella]
Length=484

 Score = 65.5 bits (158),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V AKP+RFDAI
Sbjct  67   LAPGFRFHPTDEELVSYYLKRKVLAKPVRFDAI  99


 Score = 26.6 bits (57),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  101  EVDIYKHEPWDL  112



>gb|KEH43316.1| NAC transcription factor-like protein [Medicago truncatula]
Length=482

 Score = 64.7 bits (156),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  KP RFDAI+
Sbjct  42   LAPGFRFHPTDEELVIYYLKRKVSGKPFRFDAIA  75


 Score = 27.3 bits (59),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  76   EVDIYKSEPWDL  87



>gb|KFK38436.1| hypothetical protein AALP_AA3G113200 [Arabis alpina]
Length=467

 Score = 65.1 bits (157),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V +KP+RFDAI
Sbjct  25   LAPGFRFHPTDEELVSYYLKRKVLSKPVRFDAI  57


 Score = 26.6 bits (57),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  59   EVDIYKNEPWDL  70



>gb|EMS53104.1| NAC domain-containing protein 78 [Triticum urartu]
Length=783

 Score = 60.5 bits (145),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  22   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  55


 Score = 31.2 bits (69),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YKVEPWDLP 
Sbjct  56   EVDLYKVEPWDLPA  69



>gb|KFK38437.1| hypothetical protein AALP_AA3G113200 [Arabis alpina]
Length=470

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V +KP+RFDAI
Sbjct  25   LAPGFRFHPTDEELVSYYLKRKVLSKPVRFDAI  57


 Score = 26.6 bits (57),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  59   EVDIYKNEPWDL  70



>ref|XP_002882675.1| ANAC050 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58934.1| ANAC050 [Arabidopsis lyrata subsp. lyrata]
Length=454

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI  
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGE  61


 Score = 26.2 bits (56),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|NP_001154602.1| NAC domain containing protein 50 [Arabidopsis thaliana]
 gb|AEE74914.1| NAC domain containing protein 50 [Arabidopsis thaliana]
Length=526

 Score = 64.7 bits (156),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 26.9 bits (58),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_011024333.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=558

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M S  S+  LAPGFRFHPTDEELV YYL+R+V  KP R DAIS
Sbjct  1    MGSSDSATSLAPGFRFHPTDEELVRYYLKRKVTNKPFRLDAIS  43


 Score = 25.8 bits (55),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  46   DVYKSEPWDLP  56



>gb|EAZ08024.1| hypothetical protein OsI_30288 [Oryza sativa Indica Group]
Length=656

 Score = 60.5 bits (145),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  21   LAPGFRFHPTDEELVSYYLKRKVHGRPLKVDAIA  54


 Score = 30.8 bits (68),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YKVEPWDLP 
Sbjct  55   EVDLYKVEPWDLPA  68



>ref|XP_010486659.1| PREDICTED: NAC domain-containing protein 8-like [Camelina sativa]
 ref|XP_010486660.1| PREDICTED: NAC domain-containing protein 8-like [Camelina sativa]
Length=450

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 25.8 bits (55),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|NP_001062518.1| Os08g0562200 [Oryza sativa Japonica Group]
 dbj|BAD09611.1| putative NAC2 protein [Oryza sativa Japonica Group]
 dbj|BAD13226.1| putative NAC2 protein [Oryza sativa Japonica Group]
 dbj|BAF24432.1| Os08g0562200 [Oryza sativa Japonica Group]
 gb|EAZ43669.1| hypothetical protein OsJ_28294 [Oryza sativa Japonica Group]
 dbj|BAG94230.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00166.1| unnamed protein product [Oryza sativa Japonica Group]
Length=656

 Score = 60.5 bits (145),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  21   LAPGFRFHPTDEELVSYYLKRKVHGRPLKVDAIA  54


 Score = 30.8 bits (68),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YKVEPWDLP 
Sbjct  55   EVDLYKVEPWDLPA  68



>ref|XP_010464724.1| PREDICTED: NAC domain-containing protein 74-like [Camelina sativa]
 ref|XP_010464725.1| PREDICTED: NAC domain-containing protein 74-like [Camelina sativa]
Length=451

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 25.8 bits (55),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_011024334.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Populus 
euphratica]
Length=556

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M S  S+  LAPGFRFHPTDEELV YYL+R+V  KP R DAIS
Sbjct  1    MGSSDSATSLAPGFRFHPTDEELVRYYLKRKVTNKPFRLDAIS  43


 Score = 25.8 bits (55),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  46   DVYKSEPWDLP  56



>ref|XP_009122861.1| PREDICTED: NAC domain-containing protein 7-like [Brassica rapa]
Length=440

 Score = 65.9 bits (159),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  24   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  60


 Score = 25.8 bits (55),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  62   EVDIYKHEPWDL  73



>ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
 gb|EEF01509.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
Length=556

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M S  S+  LAPGFRFHPTDEELV YYL+R+V  KP R DAIS
Sbjct  1    MGSSDSATSLAPGFRFHPTDEELVRYYLKRKVTNKPFRLDAIS  43


 Score = 25.8 bits (55),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  46   DVYKSEPWDLP  56



>ref|XP_008456548.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cucumis 
melo]
Length=556

 Score = 63.2 bits (152),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SS  LAPGFRFHPTDEE+V YYLRR+V  K LRFD IS
Sbjct  5    SSTSLAPGFRFHPTDEEIVRYYLRRKVSGKSLRFDPIS  42


 Score = 28.1 bits (61),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  291  DIYKVEPWDLPG  326
            +IYK EPWDLPG
Sbjct  45   EIYKSEPWDLPG  56



>ref|XP_006843116.1| hypothetical protein AMTR_s00140p00087970 [Amborella trichopoda]
 gb|ERN04791.1| hypothetical protein AMTR_s00140p00087970 [Amborella trichopoda]
Length=637

 Score = 58.9 bits (141),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            L PGFRFHPTDEE+V YYL+R+VC K L  +AIS+
Sbjct  6    LPPGFRFHPTDEEIVSYYLKRKVCGKSLHCNAISQ  40


 Score = 32.3 bits (72),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            QID+YK EPWDLPG
Sbjct  40   QIDLYKSEPWDLPG  53



>gb|AGV29528.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=86

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRS  291
            LAPGFRFHPTD ELV YYL+R+VC  P+RFDAI+ +
Sbjct  27   LAPGFRFHPTDAELVSYYLKRKVCGMPIRFDAITET  62



>ref|XP_008456549.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cucumis 
melo]
Length=555

 Score = 63.2 bits (152),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SS  LAPGFRFHPTDEE+V YYLRR+V  K LRFD IS
Sbjct  5    SSTSLAPGFRFHPTDEEIVRYYLRRKVSGKSLRFDPIS  42


 Score = 28.1 bits (61),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  291  DIYKVEPWDLPG  326
            +IYK EPWDLPG
Sbjct  45   EIYKSEPWDLPG  56



>ref|XP_006378789.1| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|ERP56586.1| NAC domain-containing protein 78 [Populus trichocarpa]
Length=554

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            M S  S+  LAPGFRFHPTDEELV YYL+R+V  KP R DAIS
Sbjct  1    MGSSDSATSLAPGFRFHPTDEELVRYYLKRKVTNKPFRLDAIS  43


 Score = 25.8 bits (55),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            D+YK EPWDLP
Sbjct  46   DVYKSEPWDLP  56



>ref|XP_010484780.1| PREDICTED: NAC domain-containing protein 74-like [Camelina sativa]
 ref|XP_010484822.1| PREDICTED: NAC domain-containing protein 74-like [Camelina sativa]
Length=450

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 25.8 bits (55),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_006297669.1| hypothetical protein CARUB_v10013694mg [Capsella rubella]
 gb|EOA30567.1| hypothetical protein CARUB_v10013694mg [Capsella rubella]
Length=447

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI  
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGE  61


 Score = 25.8 bits (55),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>dbj|BAD09612.1| putative NAC2 protein [Oryza sativa Japonica Group]
 dbj|BAD13227.1| putative NAC2 protein [Oryza sativa Japonica Group]
 dbj|BAG91576.1| unnamed protein product [Oryza sativa Japonica Group]
Length=618

 Score = 60.1 bits (144),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  21   LAPGFRFHPTDEELVSYYLKRKVHGRPLKVDAIA  54


 Score = 30.8 bits (68),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YKVEPWDLP 
Sbjct  55   EVDLYKVEPWDLPA  68



>emb|CDY41353.1| BnaA01g31660D [Brassica napus]
Length=441

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  24   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  60


 Score = 25.4 bits (54),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  62   EVDIYKHEPWDL  73



>ref|NP_974272.1| NAC domain containing protein 50 [Arabidopsis thaliana]
 gb|AEE74913.1| NAC domain containing protein 50 [Arabidopsis thaliana]
Length=446

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI  
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGE  61


 Score = 25.8 bits (55),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|NP_566374.1| NAC domain containing protein 50 [Arabidopsis thaliana]
 gb|AAG51394.1|AC011560_26 unknown protein; 82947-80576 [Arabidopsis thaliana]
 gb|AAF76349.1| unknown protein [Arabidopsis thaliana]
 gb|AAL24143.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74912.1| NAC domain containing protein 50 [Arabidopsis thaliana]
Length=447

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            S+  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI  
Sbjct  23   SATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGE  61


 Score = 25.8 bits (55),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>emb|CDY08601.1| BnaA05g28370D [Brassica napus]
Length=455

 Score = 64.7 bits (156),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  32   LAPGFRFHPTDEELVSYYLKRKVMGKPVRFDAI  64


 Score = 26.2 bits (56),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  288  IDIYKVEPWDL  320
            +DIYK EPWDL
Sbjct  67   VDIYKHEPWDL  77



>ref|XP_004974231.1| PREDICTED: uncharacterized protein LOC101754925 [Setaria italica]
Length=661

 Score = 61.6 bits (148),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  24   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  57


 Score = 29.3 bits (64),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            ++D+YK+EPWDLP
Sbjct  58   EVDLYKLEPWDLP  70



>gb|KDO47587.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=536

 Score = 62.4 bits (150),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 28.5 bits (62),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_010484887.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Camelina 
sativa]
Length=462

 Score = 64.3 bits (155),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 26.6 bits (57),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_004150380.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
 ref|XP_004164210.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
 gb|KGN62198.1| hypothetical protein Csa_2G327500 [Cucumis sativus]
Length=555

 Score = 62.8 bits (151),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SS  LAPGFRFHPTDEE+V YYLRR+V  K LRFD IS
Sbjct  5    SSTSLAPGFRFHPTDEEIVRYYLRRKVSGKSLRFDPIS  42


 Score = 27.7 bits (60),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  291  DIYKVEPWDLPG  326
            +IYK EPWDLPG
Sbjct  45   EIYKSEPWDLPG  56



>ref|XP_006436536.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485307.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Citrus 
sinensis]
 gb|ESR49776.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=549

 Score = 62.4 bits (150),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 28.1 bits (61),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_010484932.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Camelina 
sativa]
Length=459

 Score = 63.9 bits (154),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 26.6 bits (57),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_006436535.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485308.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Citrus 
sinensis]
 gb|ESR49775.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=548

 Score = 62.4 bits (150),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 28.1 bits (61),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>gb|AAM34767.1|AF509867_1 nam-like protein 4 [Petunia x hybrida]
Length=406

 Score = 66.2 bits (160),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+ CAKP RF A+S 
Sbjct  35   LAPGFRFHPTDEELVRYYLRRKACAKPFRFQAVSE  69


 Score = 24.6 bits (52),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  69   EIDVYKSEPWEL  80



>gb|EYU32440.1| hypothetical protein MIMGU_mgv1a007979mg [Erythranthe guttata]
Length=389

 Score = 65.9 bits (159),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+VC KP RF+A++ 
Sbjct  27   LAPGFRFHPTDEELVRYYLRRKVCGKPFRFEAVTE  61


 Score = 24.6 bits (52),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  61   EIDVYKSEPWEL  72



>gb|KDO47583.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=596

 Score = 62.8 bits (151),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 27.7 bits (60),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>gb|AGV29495.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=189

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRS  291
            LAPGFRFHPTD ELV YYL+++VC KP+RFDAI+ +
Sbjct  30   LAPGFRFHPTDTELVSYYLKKKVCGKPIRFDAIAET  65



>ref|XP_010486661.1| PREDICTED: NAC domain-containing protein 74-like [Camelina sativa]
 ref|XP_010486662.1| PREDICTED: NAC domain-containing protein 74-like [Camelina sativa]
Length=461

 Score = 63.9 bits (154),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 26.6 bits (57),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>gb|KDO47584.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=549

 Score = 62.4 bits (150),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 28.1 bits (61),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>gb|KDO47585.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=548

 Score = 62.4 bits (150),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 28.1 bits (61),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>gb|KDO47586.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=528

 Score = 62.4 bits (150),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 28.1 bits (61),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 10/11 (91%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  291  DIYKVEPWDLP  323
            DIYK EPWDLP
Sbjct  46   DIYKSEPWDLP  56



>ref|XP_010464721.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Camelina 
sativa]
 ref|XP_010464722.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Camelina 
sativa]
Length=462

 Score = 63.9 bits (154),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 26.6 bits (57),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_010464723.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Camelina 
sativa]
Length=459

 Score = 63.9 bits (154),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 26.6 bits (57),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|NP_001168544.1| uncharacterized protein LOC100382324 [Zea mays]
 gb|ACN28614.1| unknown [Zea mays]
 gb|AFW61675.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|AIB05510.1| NAC transcription factor, partial [Zea mays]
Length=665

 Score = 61.2 bits (147),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  26   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  59


 Score = 28.9 bits (63),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +D+YK+EPWDLP 
Sbjct  61   VDLYKLEPWDLPA  73



>ref|XP_009346645.1| PREDICTED: filaggrin-2-like isoform X1 [Pyrus x bretschneideri]
Length=725

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  39   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  69


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  70   EVDIYKSEPWDL  81



>ref|XP_009346646.1| PREDICTED: uncharacterized protein LOC103938368 isoform X2 [Pyrus 
x bretschneideri]
Length=708

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  39   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  69


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  70   EVDIYKSEPWDL  81



>ref|XP_009346647.1| PREDICTED: uncharacterized protein LOC103938368 isoform X3 [Pyrus 
x bretschneideri]
Length=689

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  39   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  69


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  70   EVDIYKSEPWDL  81



>ref|XP_008345404.1| PREDICTED: uncharacterized protein LOC103408324 [Malus domestica]
Length=687

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  39   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  69


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  70   EVDIYKSEPWDL  81



>ref|XP_009346648.1| PREDICTED: uncharacterized protein LOC103938368 isoform X4 [Pyrus 
x bretschneideri]
Length=671

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  39   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  69


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  70   EVDIYKSEPWDL  81



>ref|XP_008375621.1| PREDICTED: uncharacterized protein LOC103438860 [Malus domestica]
Length=654

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  38   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  68


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  69   EVDIYKSEPWDL  80



>ref|XP_009361440.1| PREDICTED: uncharacterized protein LOC103951718 [Pyrus x bretschneideri]
Length=647

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  38   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  68


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  69   EVDIYKSEPWDL  80



>ref|XP_008232317.1| PREDICTED: uncharacterized protein LOC103331477 [Prunus mume]
Length=640

 Score = 62.0 bits (149),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  31   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  61


 Score = 28.1 bits (61),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  62   EVDIYKSEPWDL  73



>ref|XP_009780872.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=405

 Score = 65.9 bits (159),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYLRR+ CAKP RF A+S
Sbjct  32   LAPGFRFHPTDEELVRYYLRRKACAKPFRFQAVS  65


 Score = 24.6 bits (52),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  66   EIDVYKSEPWEL  77



>emb|CDY41351.1| BnaA01g31680D [Brassica napus]
Length=167

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            ++  LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI 
Sbjct  21   AATALAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIG  58



>ref|XP_009146834.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Brassica 
rapa]
Length=455

 Score = 64.3 bits (155),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  30   LAPGFRFHPTDEELVSYYLKRKVMGKPVRFDAI  62


 Score = 25.8 bits (55),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  288  IDIYKVEPWDL  320
            +DIYK EPWDL
Sbjct  65   VDIYKHEPWDL  75



>ref|XP_006660391.1| PREDICTED: uncharacterized protein LOC102710047 [Oryza brachyantha]
Length=665

 Score = 60.5 bits (145),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  23   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  56


 Score = 29.6 bits (65),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK+EPWDLP 
Sbjct  57   EVDLYKLEPWDLPA  70



>dbj|BAJ91676.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=671

 Score = 60.5 bits (145),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  22   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  55


 Score = 29.6 bits (65),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK+EPWDLP 
Sbjct  56   EVDLYKLEPWDLPA  69



>gb|AFK39979.1| unknown [Medicago truncatula]
Length=216

 Score = 64.3 bits (155),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  KP RFDAI+
Sbjct  42   LAPGFRFHPTDEELVIYYLKRKVSGKPFRFDAIA  75


 Score = 25.8 bits (55),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  76   EVDIYKSEPWDL  87



>gb|KHG28963.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=407

 Score = 64.7 bits (156),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            GS+  LAPGFRFHPTDEELV YYL+R+V  KP+RF+A++ 
Sbjct  27   GSATALAPGFRFHPTDEELVSYYLKRKVSNKPVRFNAMAE  66


 Score = 25.4 bits (54),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  66   EVDIYKHEPWDL  77



>ref|XP_009383926.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score = 61.2 bits (147),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            L+PGFRFHPTDEELV YYL+R+VC + LR DA++
Sbjct  21   LSPGFRFHPTDEELVSYYLKRKVCGRSLRVDAVA  54


 Score = 28.9 bits (63),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            ++D+YK EPWDLP
Sbjct  55   EVDLYKHEPWDLP  67



>ref|XP_010940544.1| PREDICTED: uncharacterized protein LOC105059077 [Elaeis guineensis]
Length=688

 Score = 60.1 bits (144),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTD+ELV YYL+R+V  K LR DAI+
Sbjct  23   LAPGFRFHPTDDELVSYYLKRKVAGKSLRVDAIA  56


 Score = 29.6 bits (65),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +ID+YK EPWDLP
Sbjct  57   EIDLYKCEPWDLP  69



>ref|XP_008677550.1| PREDICTED: uncharacterized protein LOC100382324 isoform X1 [Zea 
mays]
Length=506

 Score = 61.6 bits (148),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +PL+ DAI+
Sbjct  26   LAPGFRFHPTDEELVSYYLKRKVLGRPLKVDAIA  59


 Score = 28.5 bits (62),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +D+YK+EPWDLP 
Sbjct  61   VDLYKLEPWDLPA  73



>gb|KJB73469.1| hypothetical protein B456_011G234200 [Gossypium raimondii]
Length=449

 Score = 64.3 bits (155),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            GS+  LAPGFRFHPTDEELV YYL+R++  KP+RF+A++ 
Sbjct  27   GSATALAPGFRFHPTDEELVSYYLKRKISNKPVRFNAMAE  66


 Score = 25.4 bits (54),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  66   EVDIYKHEPWDL  77



>ref|XP_009383919.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=672

 Score = 61.2 bits (147),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            L+PGFRFHPTDEELV YYL+R+VC + LR DA++
Sbjct  21   LSPGFRFHPTDEELVSYYLKRKVCGRSLRVDAVA  54


 Score = 28.5 bits (62),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            ++D+YK EPWDLP
Sbjct  55   EVDLYKHEPWDLP  67



>ref|XP_002882676.1| ANAC051/ANAC052 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58935.1| ANAC051/ANAC052 [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score = 64.3 bits (155),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAI  59


 Score = 25.4 bits (54),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>gb|AFU61114.1| NAC domain class transcription factor [Capsicum annuum]
Length=409

 Score = 65.1 bits (157),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+ CAKP RF A++ 
Sbjct  31   LAPGFRFHPTDEELVRYYLRRKACAKPFRFQAVAE  65


 Score = 24.6 bits (52),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  65   EIDVYKSEPWEL  76



>ref|XP_010935813.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Elaeis 
guineensis]
Length=668

 Score = 60.1 bits (144),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTD+ELV YYL+R+V  K LR DAI+
Sbjct  25   LAPGFRFHPTDDELVSYYLKRKVSGKSLRIDAIA  58


 Score = 29.3 bits (64),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +ID+YK EPWDLP
Sbjct  59   EIDLYKCEPWDLP  71



>ref|XP_011024336.1| PREDICTED: NAC transcription factor NAM-A1 [Populus euphratica]
Length=440

 Score = 63.9 bits (154),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  KP RF+AIS 
Sbjct  39   LAPGFRFHPTDEELVIYYLKRKVSNKPFRFNAISE  73


 Score = 25.8 bits (55),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  73   EVDIYKNEPWDL  84



>ref|XP_010935812.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Elaeis 
guineensis]
Length=689

 Score = 60.5 bits (145),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTD+ELV YYL+R+V  K LR DAI+
Sbjct  25   LAPGFRFHPTDDELVSYYLKRKVSGKSLRIDAIA  58


 Score = 29.3 bits (64),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +ID+YK EPWDLP
Sbjct  59   EIDLYKCEPWDLP  71



>emb|CDY41352.1| BnaA01g31670D [Brassica napus]
Length=421

 Score = 63.9 bits (154),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI  
Sbjct  25   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGE  59


 Score = 25.4 bits (54),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  59   EVDIYKHEPWDL  70



>ref|XP_004239709.1| PREDICTED: NAC domain-containing protein 78 [Solanum lycopersicum]
Length=386

 Score = 65.5 bits (158),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 34/51 (67%), Gaps = 7/51 (14%)
 Frame = +1

Query  157  MESRGSSQL-------LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            ME  GS          LAPGFRFHPTDEELV YYLRR+VC KP RF A++ 
Sbjct  1    MEQEGSKGAVTVAPTSLAPGFRFHPTDEELVRYYLRRKVCGKPFRFQAVTE  51


 Score = 24.3 bits (51),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +ID+YK EP DL G
Sbjct  51   EIDVYKSEPCDLAG  64



>ref|XP_004307019.1| PREDICTED: uncharacterized protein LOC101300663 [Fragaria vesca 
subsp. vesca]
Length=668

 Score = 62.0 bits (149),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC KP +F+AIS
Sbjct  27   GFRFHPTDEELVIYYLKRKVCRKPFKFNAIS  57


 Score = 27.3 bits (59),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  288  IDIYKVEPWDL  320
            +DIYK EPWDL
Sbjct  59   VDIYKSEPWDL  69



>ref|XP_009122872.1| PREDICTED: NAC domain-containing protein 7-like [Brassica rapa]
Length=421

 Score = 63.9 bits (154),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI  
Sbjct  25   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGE  59


 Score = 25.4 bits (54),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  59   EVDIYKHEPWDL  70



>gb|AHN60141.1| NAC transcription factor 51 [Brassica napus]
Length=418

 Score = 63.9 bits (154),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI  
Sbjct  24   LAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGE  58


 Score = 25.4 bits (54),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  58   EVDIYKHEPWDL  69



>gb|EPS65704.1| nam-like protein 4, partial [Genlisea aurea]
Length=224

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYLRR+ CAKP RF A++
Sbjct  23   LAPGFRFHPTDEELVRYYLRRKACAKPFRFQAVA  56



>emb|CDY00946.1| BnaC05g42540D [Brassica napus]
Length=451

 Score = 64.7 bits (156),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 4/44 (9%)
 Frame = +1

Query  163  SRGSSQL----LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +RG++ +    LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  17   ARGTATVAATSLAPGFRFHPTDEELVSYYLKRKVMGKPVRFDAI  60


 Score = 24.6 bits (52),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  288  IDIYKVEPWDL  320
            +DIYK EPWDL
Sbjct  63   VDIYKHEPWDL  73



>ref|XP_007010047.1| NAC domain protein, IPR003441 [Theobroma cacao]
 gb|EOY18857.1| NAC domain protein, IPR003441 [Theobroma cacao]
Length=442

 Score = 65.5 bits (158),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            GS+  LAPGFRFHPTDEELV YYL+R+V  KP+RF+AI+ 
Sbjct  28   GSATALAPGFRFHPTDEELVSYYLKRKVLNKPVRFNAIAE  67


 Score = 23.9 bits (50),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPW+L
Sbjct  67   EVDIYKQEPWEL  78



>ref|XP_002315336.1| no apical meristem family protein [Populus trichocarpa]
 gb|ABK93555.1| unknown [Populus trichocarpa]
 gb|EEF01507.1| no apical meristem family protein [Populus trichocarpa]
Length=440

 Score = 63.5 bits (153),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  KP RF+AIS 
Sbjct  39   LAPGFRFHPTDEELVIYYLKRKVSNKPFRFNAISE  73


 Score = 25.8 bits (55),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  73   EVDIYKNEPWDL  84



>ref|XP_008779162.1| PREDICTED: uncharacterized protein LOC103698888 [Phoenix dactylifera]
Length=688

 Score = 60.5 bits (145),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  K LR DAI+
Sbjct  29   LAPGFRFHPTDEELVRYYLKRKVARKSLRVDAIA  62


 Score = 28.9 bits (63),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +ID+YK EPWDLP
Sbjct  63   EIDLYKCEPWDLP  75



>ref|XP_009146835.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=452

 Score = 64.3 bits (155),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  30   LAPGFRFHPTDEELVSYYLKRKVMGKPVRFDAI  62


 Score = 24.6 bits (52),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  288  IDIYKVEPWDL  320
            +DIYK EPWDL
Sbjct  65   VDIYKHEPWDL  75



>ref|XP_009418629.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score = 62.8 bits (151),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            ++ LLAPGFRFHPTDEELV YYL+R+V  +PLR D I+ 
Sbjct  17   AASLLAPGFRFHPTDEELVGYYLKRKVSGRPLRIDVIAE  55


 Score = 26.6 bits (57),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 8/14 (57%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+ K EPW+LPG
Sbjct  55   EVDLCKCEPWELPG  68



>ref|XP_003556303.1| PREDICTED: NAC transcription factor NAM-B2-like [Glycine max]
Length=465

 Score = 62.8 bits (151),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRSISTRS  306
            LAPGFRFHPTDEELV YYL+R+V  K  RFDAIS     RS
Sbjct  34   LAPGFRFHPTDEELVIYYLKRKVSGKSFRFDAISEVDIYRS  74


 Score = 26.6 bits (57),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIY+ EPWDL
Sbjct  68   EVDIYRSEPWDL  79



>gb|KJB60510.1| hypothetical protein B456_009G309300 [Gossypium raimondii]
Length=450

 Score = 65.1 bits (157),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            S+  LAPGFRFHPTDEELV YYL+R+V  KP RFDAI+ 
Sbjct  29   SATALAPGFRFHPTDEELVSYYLKRKVTNKPARFDAIAE  67


 Score = 24.3 bits (51),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPW+L
Sbjct  67   EVDIYKHEPWNL  78



>ref|XP_009619467.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=404

 Score = 64.7 bits (156),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+ C+KP RF A+S 
Sbjct  32   LAPGFRFHPTDEELVRYYLRRKACSKPFRFQAVSE  66


 Score = 24.6 bits (52),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  66   EIDVYKSEPWEL  77



>gb|KJB60511.1| hypothetical protein B456_009G309300 [Gossypium raimondii]
Length=451

 Score = 65.1 bits (157),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            S+  LAPGFRFHPTDEELV YYL+R+V  KP RFDAI+ 
Sbjct  29   SATALAPGFRFHPTDEELVSYYLKRKVTNKPARFDAIAE  67


 Score = 24.3 bits (51),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPW+L
Sbjct  67   EVDIYKHEPWNL  78



>gb|KHN00952.1| NAC domain-containing protein 78 [Glycine soja]
Length=465

 Score = 62.8 bits (151),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRSISTRS  306
            LAPGFRFHPTDEELV YYL+R+V  K  RFDAIS     RS
Sbjct  34   LAPGFRFHPTDEELVIYYLKRKVSGKSFRFDAISEVDIYRS  74


 Score = 26.6 bits (57),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIY+ EPWDL
Sbjct  68   EVDIYRSEPWDL  79



>ref|XP_009418630.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score = 62.4 bits (150),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            ++ LLAPGFRFHPTDEELV YYL+R+V  +PLR D I+ 
Sbjct  17   AASLLAPGFRFHPTDEELVGYYLKRKVSGRPLRIDVIAE  55


 Score = 26.6 bits (57),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 8/14 (57%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+ K EPW+LPG
Sbjct  55   EVDLCKCEPWELPG  68



>gb|AFP93563.1| NAC [Cestrum nocturnum]
Length=414

 Score = 64.3 bits (155),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+ C KP RF A+S 
Sbjct  28   LAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVSE  62


 Score = 24.6 bits (52),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  62   EIDVYKSEPWEL  73



>ref|XP_006345842.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=391

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+VC KP RF A++ 
Sbjct  22   LAPGFRFHPTDEELVRYYLRRKVCGKPFRFQAVTE  56



>ref|XP_006407563.1| hypothetical protein EUTSA_v10020745mg [Eutrema salsugineum]
 gb|ESQ49016.1| hypothetical protein EUTSA_v10020745mg [Eutrema salsugineum]
Length=440

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVQNKPVRFDAI  59


 Score = 25.4 bits (54),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_006407562.1| hypothetical protein EUTSA_v10020745mg [Eutrema salsugineum]
 gb|ESQ49015.1| hypothetical protein EUTSA_v10020745mg [Eutrema salsugineum]
Length=437

 Score = 63.2 bits (152),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  KP+RFDAI 
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVQNKPVRFDAIG  60


 Score = 25.4 bits (54),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_009625487.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=398

 Score = 63.9 bits (154),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+ C KP RF A++ 
Sbjct  28   LAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTE  62


 Score = 24.6 bits (52),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  62   EIDVYKSEPWEL  73



>ref|XP_009796718.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=399

 Score = 63.9 bits (154),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+ C KP RF A++ 
Sbjct  29   LAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTE  63


 Score = 24.6 bits (52),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  63   EIDVYKSEPWEL  74



>ref|NP_850554.1| NAC domain containing protein 52 [Arabidopsis thaliana]
 gb|AAG51391.1|AC011560_23 unknown protein; 79282-76749 [Arabidopsis thaliana]
 gb|AAF76350.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74916.1| NAC domain containing protein 52 [Arabidopsis thaliana]
Length=451

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  +P+RFDAI  
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGQPVRFDAIGE  61


 Score = 25.4 bits (54),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>ref|XP_010543579.1| PREDICTED: NAC domain-containing protein 4-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543580.1| PREDICTED: NAC domain-containing protein 4-like isoform X2 [Tarenaya 
hassleriana]
Length=459

 Score = 63.2 bits (152),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            S  S+  LAPGFRFHPTDEELV YYL+R+V  KP+RF+AI
Sbjct  19   SAASATALAPGFRFHPTDEELVSYYLKRKVQNKPVRFNAI  58


 Score = 25.0 bits (53),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPW+L
Sbjct  60   EVDIYKHEPWEL  71



>ref|XP_011076898.1| PREDICTED: NAC domain-containing protein 78-like [Sesamum indicum]
Length=397

 Score = 63.5 bits (153),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR+ C KP RF A++ 
Sbjct  27   LAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTE  61


 Score = 24.6 bits (52),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  61   EIDVYKSEPWEL  72



>ref|XP_008446812.1| PREDICTED: NAC domain-containing protein 77-like [Cucumis melo]
Length=449

 Score = 59.3 bits (142),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            GFRFHPTDEELV YYL+R+VC K  RF+AIS 
Sbjct  32   GFRFHPTDEELVIYYLKRKVCGKSFRFNAISE  63


 Score = 28.5 bits (62),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++DIYK EPWDL G
Sbjct  63   EVDIYKSEPWDLAG  76



>ref|XP_009135112.1| PREDICTED: NAC domain-containing protein 78-like [Brassica rapa]
 ref|XP_009135113.1| PREDICTED: NAC domain-containing protein 78-like [Brassica rapa]
Length=421

 Score = 63.2 bits (152),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYL+R+V  +P+RFDAI
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGRPVRFDAI  59


 Score = 25.0 bits (53),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  288  IDIYKVEPWDL  320
            +DIYK EPWDL
Sbjct  62   VDIYKYEPWDL  72



>ref|XP_007144246.1| hypothetical protein PHAVU_007G140300g [Phaseolus vulgaris]
 gb|ESW16240.1| hypothetical protein PHAVU_007G140300g [Phaseolus vulgaris]
Length=178

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  K  RFDAIS
Sbjct  32   LAPGFRFHPTDEELVIYYLKRKVSGKSFRFDAIS  65



>ref|XP_004142442.1| PREDICTED: uncharacterized protein LOC101210923 [Cucumis sativus]
 ref|XP_004168805.1| PREDICTED: uncharacterized LOC101210923 [Cucumis sativus]
 gb|KGN52231.1| hypothetical protein Csa_5G622480 [Cucumis sativus]
Length=450

 Score = 59.3 bits (142),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            GFRFHPTDEELV YYL+R+VC K  RF+AIS 
Sbjct  33   GFRFHPTDEELVIYYLKRKVCGKSFRFNAISE  64


 Score = 28.5 bits (62),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++DIYK EPWDL G
Sbjct  64   EVDIYKSEPWDLAG  77



>ref|XP_002265550.1| PREDICTED: NAC domain-containing protein 77-like isoform X1 [Vitis 
vinifera]
Length=432

 Score = 62.0 bits (149),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHP+DEELV YYL+R+VC K + FDAI+ 
Sbjct  13   LAPGFRFHPSDEELVQYYLKRKVCGKAIAFDAIAE  47


 Score = 25.8 bits (55),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++DIYK EPW+L G
Sbjct  47   EVDIYKKEPWNLGG  60



>emb|CDO99813.1| unnamed protein product [Coffea canephora]
Length=406

 Score = 63.2 bits (152),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTDEELV YYLRR+ C KP RF A+
Sbjct  37   LAPGFRFHPTDEELVRYYLRRKACGKPFRFQAV  69


 Score = 24.6 bits (52),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  71   EIDVYKSEPWEL  82



>gb|AGL39699.1| NAC transcription factor 043 [Jatropha curcas]
 gb|KDP30502.1| hypothetical protein JCGZ_16181 [Jatropha curcas]
Length=428

 Score = 62.0 bits (149),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  KP+RF+AI+ 
Sbjct  20   LAPGFRFHPTDEELVSYYLKRKVSNKPVRFNAIAE  54


 Score = 25.4 bits (54),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  54   EVDIYKNEPWDL  65



>ref|XP_011101541.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Sesamum 
indicum]
Length=399

 Score = 63.2 bits (152),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR VC KP RF A++ 
Sbjct  29   LAPGFRFHPTDEELVRYYLRRIVCGKPFRFQAVTE  63


 Score = 24.6 bits (52),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  63   EIDVYKSEPWEL  74



>ref|XP_011101542.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Sesamum 
indicum]
Length=398

 Score = 63.2 bits (152),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR VC KP RF A++ 
Sbjct  29   LAPGFRFHPTDEELVRYYLRRIVCGKPFRFQAVTE  63


 Score = 24.6 bits (52),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +ID+YK EPW+L
Sbjct  63   EIDVYKSEPWEL  74



>ref|NP_566375.1| NAC domain containing protein 52 [Arabidopsis thaliana]
 gb|AEE74915.1| NAC domain containing protein 52 [Arabidopsis thaliana]
Length=238

 Score = 62.4 bits (150),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  +P+RFDAI  
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGQPVRFDAIGE  61


 Score = 25.4 bits (54),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  61   EVDIYKHEPWDL  72



>emb|CDY61662.1| BnaCnng38230D [Brassica napus]
Length=292

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +APGFRFHPTDEEL+ YYL+R+V  KP+RFDAI
Sbjct  14   IAPGFRFHPTDEELITYYLKRKVQGKPMRFDAI  46



>ref|XP_007144247.1| hypothetical protein PHAVU_007G140300g, partial [Phaseolus vulgaris]
 gb|ESW16241.1| hypothetical protein PHAVU_007G140300g, partial [Phaseolus vulgaris]
Length=246

 Score = 62.4 bits (150),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  K  RFDAIS
Sbjct  32   LAPGFRFHPTDEELVIYYLKRKVSGKSFRFDAIS  65


 Score = 25.0 bits (53),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIY+ EPWDL
Sbjct  66   EVDIYRSEPWDL  77



>ref|XP_007010050.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18860.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
Length=590

 Score = 60.5 bits (145),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SR S+  LAPGFRFHPTDEELV YYL+R+V  KP  FDAIS
Sbjct  2    SRHSATSLAPGFRFHPTDEELVRYYLKRKVLNKP-SFDAIS  41


 Score = 26.9 bits (58),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            +D+Y+ EPWDLP
Sbjct  43   VDVYRSEPWDLP  54



>gb|AAM34771.1|AF509871_1 nam-like protein 8 [Petunia x hybrida]
Length=392

 Score = 60.8 bits (146),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYLRR++  KP RF A++ 
Sbjct  23   LAPGFRFHPTDEELVRYYLRRKIIGKPFRFQAVTE  57


 Score = 26.6 bits (57),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +ID+YK EPW+L G
Sbjct  57   EIDVYKSEPWELAG  70



>gb|KDO47588.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=433

 Score = 60.5 bits (145),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            +S  LAPGFRFHPTDEELV YYL+R+VC + LRF+ I
Sbjct  6    ASTSLAPGFRFHPTDEELVRYYLKRKVCHRSLRFNPI  42


 Score = 26.6 bits (57),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
             DIYK EPWDLP
Sbjct  45   TDIYKSEPWDLP  56



>gb|KJB60503.1| hypothetical protein B456_009G309000 [Gossypium raimondii]
Length=591

 Score = 58.5 bits (140),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            R S+  LAPGFRFHPTDEELV YYL+R++  +P  FDAIS
Sbjct  3    RDSATSLAPGFRFHPTDEELVRYYLKRKILNRP-SFDAIS  41


 Score = 28.5 bits (62),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            IDIY+ EPWDLP
Sbjct  43   IDIYRSEPWDLP  54



>ref|XP_009145146.1| PREDICTED: uncharacterized protein LOC103868845 [Brassica rapa]
 ref|XP_009145148.1| PREDICTED: uncharacterized protein LOC103868845 [Brassica rapa]
 ref|XP_009145149.1| PREDICTED: uncharacterized protein LOC103868845 [Brassica rapa]
 ref|XP_009145150.1| PREDICTED: uncharacterized protein LOC103868845 [Brassica rapa]
 ref|XP_009145151.1| PREDICTED: uncharacterized protein LOC103868845 [Brassica rapa]
 emb|CDY28397.1| BnaA05g18430D [Brassica napus]
Length=578

 Score = 61.2 bits (147),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +1

Query  151  CVMESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            C+ E R S    APGFRFHPTDEELV YYL+R++C + LR +AI
Sbjct  5    CLKEGRFS----APGFRFHPTDEELVVYYLKRKICGRKLRINAI  44


 Score = 25.8 bits (55),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 8/13 (62%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +D+YKV+P +LPG
Sbjct  47   VDVYKVDPTELPG  59



>ref|XP_002532631.1| hypothetical protein RCOM_0351490 [Ricinus communis]
 gb|EEF29762.1| hypothetical protein RCOM_0351490 [Ricinus communis]
Length=389

 Score = 62.8 bits (151),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEELV YYL+R+V  KP+RF+AIS 
Sbjct  34   LAPGFRFHPTDEELVSYYLKRKVSNKPVRFNAISE  68


 Score = 24.3 bits (51),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPGTR  332
            ++DIYK EPW+L   +
Sbjct  68   EVDIYKNEPWELAAMK  83



>emb|CDY00677.1| BnaC03g36610D [Brassica napus]
Length=445

 Score = 61.6 bits (148),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            LAPGFRFHPTD+ELV YYL+R+V  +P+RFDAI
Sbjct  27   LAPGFRFHPTDDELVSYYLKRKVLGRPVRFDAI  59


 Score = 25.0 bits (53),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 9/11 (82%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = +3

Query  288  IDIYKVEPWDL  320
            +DIYK EPWDL
Sbjct  62   VDIYKYEPWDL  72



>emb|CDX73920.1| BnaA03g31270D [Brassica napus]
Length=447

 Score = 62.8 bits (151),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEELV YYL+R+V  +P+RFDAI 
Sbjct  27   LAPGFRFHPTDEELVSYYLKRKVLGRPVRFDAIG  60


 Score = 23.9 bits (50),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 9/10 (90%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
 Frame = +3

Query  291  DIYKVEPWDL  320
            DIYK EPWDL
Sbjct  63   DIYKYEPWDL  72



>ref|XP_011026224.1| PREDICTED: transcription factor JUNGBRUNNEN 1 isoform X1 [Populus 
euphratica]
Length=301

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR-SISTRSSLGISQVPA  333
            ++     +L+ PGFRFHPTDEELV +YLRR+V  KPLRF+ I +  I       + +V  
Sbjct  12   IDHNEDEELMLPGFRFHPTDEELVGFYLRRKVEKKPLRFELIKQIDIYKYDPWDLPKVSN  71

Query  334  SRTFFFLFPCIHARDYQS  387
            +    + F CI  R Y++
Sbjct  72   AGDREWYFFCIRGRKYRN  89



>gb|KGN54941.1| hypothetical protein Csa_4G608170 [Cucumis sativus]
Length=383

 Score = 58.2 bits (139),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  154  VMESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            V++     Q++ PGFRFHPTDEELV++YLRR+V  KP+  + I +
Sbjct  11   VVDQEDDDQVILPGFRFHPTDEELVWFYLRRKVEKKPIAIEIIKQ  55


 Score = 28.5 bits (62),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            QIDIYK +PWDLP
Sbjct  55   QIDIYKYDPWDLP  67



>emb|CBI31390.3| unnamed protein product [Vitis vinifera]
Length=385

 Score = 60.8 bits (146),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHP+DEELV YYL+R+VC K + FDAI+ 
Sbjct  13   LAPGFRFHPSDEELVQYYLKRKVCGKAIAFDAIAE  47


 Score = 25.4 bits (54),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++DIYK EPW+L G
Sbjct  47   EVDIYKKEPWNLGG  60



>ref|XP_006849894.1| hypothetical protein AMTR_s00022p00094930 [Amborella trichopoda]
 gb|ERN11475.1| hypothetical protein AMTR_s00022p00094930 [Amborella trichopoda]
Length=613

 Score = 58.9 bits (141),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            L PGFRFHPTDEELV +YL+RR+C +P+  D I+
Sbjct  6    LPPGFRFHPTDEELVLFYLKRRICGRPVPLDVIA  39


 Score = 27.3 bits (59),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +3

Query  267  PL*CHLQIDIYKVEPWDLP  323
            PL     IDIYK EPWDLP
Sbjct  34   PLDVIADIDIYKCEPWDLP  52



>ref|XP_010424782.1| PREDICTED: NAC domain-containing protein 78-like, partial [Camelina 
sativa]
Length=203

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            LAPGFRFHPTDEEL+ YYL+R+V  KP+R DAI 
Sbjct  28   LAPGFRFHPTDEELITYYLKRKVQGKPMRLDAIG  61



>ref|XP_007010051.1| NAC domain containing protein 2, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18861.1| NAC domain containing protein 2, putative isoform 2 [Theobroma 
cacao]
Length=423

 Score = 60.1 bits (144),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +1

Query  163  SRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            SR S+  LAPGFRFHPTDEELV YYL+R+V  KP  FDAIS
Sbjct  2    SRHSATSLAPGFRFHPTDEELVRYYLKRKVLNKP-SFDAIS  41


 Score = 26.2 bits (56),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLP  323
            +D+Y+ EPWDLP
Sbjct  43   VDVYRSEPWDLP  54



>ref|XP_006436533.1| hypothetical protein CICLE_v10031606mg [Citrus clementina]
 ref|XP_006485309.1| PREDICTED: NAC domain-containing protein 7-like [Citrus sinensis]
 gb|ESR49773.1| hypothetical protein CICLE_v10031606mg [Citrus clementina]
 gb|KDO47582.1| hypothetical protein CISIN_1g014130mg [Citrus sinensis]
Length=430

 Score = 60.1 bits (144),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  166  RGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            + ++  LAPGFRFHPTDEELV YYL+R+V  +P RF+AI
Sbjct  23   KKNTAALAPGFRFHPTDEELVSYYLKRKVYNRPFRFNAI  61


 Score = 25.8 bits (55),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  63   EVDIYKNEPWDL  74



>gb|AIA57527.1| NAC domain-containing protein [Boehmeria nivea]
Length=495

 Score = 57.8 bits (138),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+VC K  RF+AI+
Sbjct  50   GFRFHPTDEELVIYYLKRKVCGKSFRFNAIT  80


 Score = 27.7 bits (60),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++D+YK EPWDL
Sbjct  81   EVDVYKCEPWDL  92



>emb|CAN70405.1| hypothetical protein VITISV_021987 [Vitis vinifera]
Length=433

 Score = 59.7 bits (143),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHP+DE LV YYL+R+VC K + FDAI+ 
Sbjct  13   LAPGFRFHPSDEXLVQYYLKRKVCGKAIAFDAIAE  47


 Score = 25.8 bits (55),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++DIYK EPW+L G
Sbjct  47   EVDIYKKEPWNLGG  60



>ref|XP_010316553.1| PREDICTED: NAC domain-containing protein 86 isoform X1 [Solanum 
lycopersicum]
Length=651

 Score = 54.3 bits (129),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            L PGFRFHPTDEELV YYL+R++ AK +  D I
Sbjct  6    LPPGFRFHPTDEELVAYYLKRKINAKKIELDII  38


 Score = 31.2 bits (69),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK EPWDLPG
Sbjct  40   EVDLYKCEPWDLPG  53



>ref|XP_011026226.1| PREDICTED: transcription factor JUNGBRUNNEN 1 isoform X2 [Populus 
euphratica]
Length=300

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 6/80 (8%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRSISTR---SSLGISQV  327
            ++     +L+ PGFRFHPTDEELV +YLRR+V  KPLRF+ I +    +     L IS  
Sbjct  12   IDHNEDEELMLPGFRFHPTDEELVGFYLRRKVEKKPLRFELIKQIDIYKYDPWDLPISNA  71

Query  328  PASRTFFFLFPCIHARDYQS  387
                 +FF   CI  R Y++
Sbjct  72   GDREWYFF---CIRGRKYRN  88



>gb|KHN00769.1| NAC domain-containing protein 78 [Glycine soja]
Length=67

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +1

Query  175  SQLLA--PGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRS  291
            SQ+++  PGFRFHPTDEELV YYL+R++C K L+ D I  +
Sbjct  14   SQMMSSMPGFRFHPTDEELVMYYLKRKICGKRLKLDVIHET  54



>ref|XP_010260495.1| PREDICTED: NAC domain-containing protein 78-like [Nelumbo nucifera]
Length=577

 Score = 59.3 bits (142),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            L PGFRFHPTD ELV YYL+R+V  KPLRF+AIS 
Sbjct  6    LPPGFRFHPTDGELVQYYLKRKVLGKPLRFEAISE  40


 Score = 25.8 bits (55),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            +IDIYK  PWDL
Sbjct  40   EIDIYKFAPWDL  51



>ref|XP_010456393.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=386

 Score = 62.0 bits (149),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEEL+ YYL+R+V  KP+R DAI  
Sbjct  28   LAPGFRFHPTDEELITYYLKRKVQGKPMRLDAIGE  62


 Score = 23.1 bits (48),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 7/13 (54%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            ++D Y+ EPW+LP
Sbjct  62   EVDFYEHEPWNLP  74



>ref|NP_001077648.1| NAC domain containing protein 16 [Arabidopsis thaliana]
 gb|AAD39614.1|AC007454_13 Similar to gb|X92204 NAM gene product from Petunia hybrida [Arabidopsis 
thaliana]
 gb|AEE31683.1| NAC domain containing protein 16 [Arabidopsis thaliana]
Length=576

 Score = 59.3 bits (142),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            + +  APGFRFHPTDEELV YYL+R++C K LR +AI
Sbjct  12   AGKFSAPGFRFHPTDEELVVYYLKRKICCKKLRVNAI  48


 Score = 25.4 bits (54),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 8/13 (62%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +D+YKV+P +LPG
Sbjct  51   VDVYKVDPSELPG  63



>ref|XP_006348211.1| PREDICTED: uncharacterized protein LOC102601721 [Solanum tuberosum]
Length=631

 Score = 53.9 bits (128),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            L PGFRFHPTDEELV YYL+R++ AK +  D I
Sbjct  6    LPPGFRFHPTDEELVAYYLKRKINAKKIELDII  38


 Score = 31.2 bits (69),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK EPWDLPG
Sbjct  40   EVDLYKCEPWDLPG  53



>gb|AAM34765.1|AF509865_1 nam-like protein 2 [Petunia x hybrida]
Length=487

 Score = 56.2 bits (134),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            L PGFRFHPTD ELV YYL+R++  K L FDAI+
Sbjct  4    LPPGFRFHPTDVELVMYYLKRKIMGKKLHFDAIT  37


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            +++IYKV PWDLPG
Sbjct  38   ELNIYKVSPWDLPG  51



>gb|AGL39698.1| NAC transcription factor 042 [Jatropha curcas]
Length=473

 Score = 55.8 bits (133),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  178  QLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            + L PGFRFHPTD ELV YYL+R+V  K L FDAI+
Sbjct  4    KTLPPGFRFHPTDVELVKYYLKRKVLGKNLHFDAIA  39


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +IDIYK  PWDLP
Sbjct  40   EIDIYKYAPWDLP  52



>ref|XP_009121977.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Brassica 
rapa]
Length=205

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
             S + + PGFRFHPTDEEL+ YYL+R+V  KP+RFD I
Sbjct  12   ASGKPIGPGFRFHPTDEELITYYLKRKVEGKPMRFDVI  49



>gb|KDP42610.1| hypothetical protein JCGZ_24384 [Jatropha curcas]
Length=474

 Score = 55.8 bits (133),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  178  QLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            + L PGFRFHPTD ELV YYL+R+V  K L FDAI+
Sbjct  4    KTLPPGFRFHPTDVELVKYYLKRKVLGKNLHFDAIA  39


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +IDIYK  PWDLP
Sbjct  40   EIDIYKYAPWDLP  52



>emb|CDX69774.1| BnaA10g21230D [Brassica napus]
Length=329

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
             S + + PGFRFHPTDEEL+ YYL+R+V  KP+RFD I
Sbjct  12   ASGKPIGPGFRFHPTDEELITYYLKRKVEGKPMRFDVI  49



>ref|XP_009121976.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=213

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
             S + + PGFRFHPTDEEL+ YYL+R+V  KP+RFD I
Sbjct  12   ASGKPIGPGFRFHPTDEELITYYLKRKVEGKPMRFDVI  49



>ref|XP_006407561.1| hypothetical protein EUTSA_v10020717mg [Eutrema salsugineum]
 gb|ESQ49014.1| hypothetical protein EUTSA_v10020717mg [Eutrema salsugineum]
Length=451

 Score = 58.9 bits (141),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            GFRFHPTDEELV YYL+R+V +KP+RFDAI
Sbjct  29   GFRFHPTDEELVSYYLKRKVLSKPVRFDAI  58


 Score = 25.4 bits (54),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDL  320
            ++DIYK EPWDL
Sbjct  60   EVDIYKHEPWDL  71



>ref|XP_009121975.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=225

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
             S + + PGFRFHPTDEEL+ YYL+R+V  KP+RFD I
Sbjct  12   ASGKPIGPGFRFHPTDEELITYYLKRKVEGKPMRFDVI  49



>emb|CDX73304.1| BnaC05g28020D [Brassica napus]
Length=583

 Score = 58.9 bits (141),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  187  APGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            APGFRFHPTDEELV YYL+R++C + LR +AI
Sbjct  13   APGFRFHPTDEELVVYYLKRKICGRKLRINAI  44


 Score = 25.4 bits (54),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 8/13 (62%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +D+YKV+P +LPG
Sbjct  47   VDVYKVDPTELPG  59



>ref|XP_010499958.1| PREDICTED: uncharacterized protein LOC104777407 [Camelina sativa]
Length=628

 Score = 58.5 bits (140),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  172  SSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            + +  APGFRFHPTDEELV YYL+R++C + LR +AI
Sbjct  8    AGKFSAPGFRFHPTDEELVVYYLKRKICGRKLRINAI  44


 Score = 25.4 bits (54),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 8/13 (62%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  288  IDIYKVEPWDLPG  326
            +D+YKV+P +LPG
Sbjct  47   VDVYKVDPSELPG  59



>ref|XP_008787444.1| PREDICTED: NAC domain-containing protein 78 [Phoenix dactylifera]
Length=661

 Score = 54.3 bits (129),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  193  GFRFHPTDEELVFYYLRRRVCAKPLRFDAIS  285
            GFRFHPTDEELV YYL+R+V  K LR D+I+
Sbjct  25   GFRFHPTDEELVSYYLKRKVAGKSLRIDSIA  55


 Score = 29.6 bits (65),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            +ID+YK EPWDLP
Sbjct  56   EIDLYKCEPWDLP  68



>ref|XP_002300866.2| hypothetical protein POPTR_0002s05820g [Populus trichocarpa]
 gb|EEE80139.2| hypothetical protein POPTR_0002s05820g [Populus trichocarpa]
Length=382

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +1

Query  157  MESRGSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR-SISTRSSLGISQVPA  333
            ++     +++ PGFRFHPTDEELV +YLRR+V  KPLRF+ I +  I       + +V  
Sbjct  95   IDHNEDEEVMLPGFRFHPTDEELVGFYLRRKVEKKPLRFELIKQIDIYKYDPWDLPKVSN  154

Query  334  SRTFFFLFPCIHARDYQS  387
            +    + F CI  R Y++
Sbjct  155  AGDREWYFFCIRGRKYRN  172



>gb|KJB28924.1| hypothetical protein B456_005G076200 [Gossypium raimondii]
Length=528

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRS  291
            G  Q+  PGFRFHPTDEELV YYL+R++C K L+ D I  +
Sbjct  15   GDDQVWPPGFRFHPTDEELVLYYLKRKICKKRLKLDIIRET  55



>ref|XP_010495071.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=398

 Score = 58.9 bits (141),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISR  288
            LAPGFRFHPTDEEL+ YYL+R+V  K +R DAI  
Sbjct  28   LAPGFRFHPTDEELITYYLKRKVQGKSMRLDAIGE  62


 Score = 24.6 bits (52),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 8/13 (62%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLP  323
            ++D YK EPW+LP
Sbjct  62   EVDFYKHEPWNLP  74



>gb|KJB28926.1| hypothetical protein B456_005G076200 [Gossypium raimondii]
Length=555

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  169  GSSQLLAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAISRS  291
            G  Q+  PGFRFHPTDEELV YYL+R++C K L+ D I  +
Sbjct  15   GDDQVWPPGFRFHPTDEELVLYYLKRKICKKRLKLDIIRET  55



>ref|XP_007146987.1| hypothetical protein PHAVU_006G087000g [Phaseolus vulgaris]
 gb|ESW18981.1| hypothetical protein PHAVU_006G087000g [Phaseolus vulgaris]
Length=671

 Score = 51.2 bits (121),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  184  LAPGFRFHPTDEELVFYYLRRRVCAKPLRFDAI  282
            L PGFRFHPTDEELV YYLRR++  + +  + I
Sbjct  8    LPPGFRFHPTDEELVSYYLRRKINGRKIELEII  40


 Score = 32.3 bits (72),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 10/14 (71%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +3

Query  285  QIDIYKVEPWDLPG  326
            ++D+YK EPWDLPG
Sbjct  42   EVDLYKCEPWDLPG  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105