BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018C11

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

tpg|DAA47596.1|  TPA: putative methionine synthase family protein       312   1e-101   
gb|KDO54954.1|  hypothetical protein CISIN_1g0202292mg                  304   1e-101   Citrus sinensis [apfelsine]
gb|KJB80760.1|  hypothetical protein B456_013G114400                    313   4e-101   Gossypium raimondii
ref|XP_006443472.1|  hypothetical protein CICLE_v10018965mg             310   4e-100   
ref|XP_011077750.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    315   2e-99    Sesamum indicum [beniseed]
ref|XP_004960256.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    315   4e-99    
gb|KJB26633.1|  hypothetical protein B456_004G251500                    307   6e-99    Gossypium raimondii
gb|KCW47762.1|  hypothetical protein EUGRSUZ_K015081                    300   1e-98    Eucalyptus grandis [rose gum]
gb|EYU18182.1|  hypothetical protein MIMGU_mgv1a001749mg                313   2e-98    Erythranthe guttata [common monkey flower]
ref|XP_011094156.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    313   2e-98    Sesamum indicum [beniseed]
ref|XP_004136654.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    313   2e-98    Cucumis sativus [cucumbers]
gb|KDO66097.1|  hypothetical protein CISIN_1g0165812mg                  296   2e-98    Citrus sinensis [apfelsine]
gb|KJB44522.1|  hypothetical protein B456_007G257500                    306   2e-98    Gossypium raimondii
ref|XP_006443470.1|  hypothetical protein CICLE_v10018965mg             308   3e-98    
gb|KJB80758.1|  hypothetical protein B456_013G114400                    312   3e-98    Gossypium raimondii
ref|NP_001235794.1|  methionine synthase                                312   4e-98    Glycine max [soybeans]
ref|XP_008662311.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    311   5e-98    
gb|AAL33589.1|  methionine synthase                                     311   6e-98    Zea mays [maize]
gb|KJB82416.1|  hypothetical protein B456_013G195000                    305   6e-98    Gossypium raimondii
tpg|DAA47593.1|  TPA: putative methionine synthase family protein       311   7e-98    
ref|XP_004291976.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    311   7e-98    Fragaria vesca subsp. vesca
gb|ABG22097.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    307   9e-98    Oryza sativa Japonica Group [Japonica rice]
gb|ABI35986.1|  methionine synthase                                     310   1e-97    Phelipanche ramosa
ref|XP_006371191.1|  hypothetical protein POPTR_0019s05430g             308   1e-97    
ref|XP_003554033.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    310   1e-97    
ref|XP_004960257.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    310   2e-97    Setaria italica
ref|XP_007151496.1|  hypothetical protein PHAVU_004G051600g             310   2e-97    Phaseolus vulgaris [French bean]
gb|KHG18658.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    310   3e-97    Gossypium arboreum [tree cotton]
ref|NP_001067314.1|  Os12g0624000                                       310   3e-97    
emb|CDP10525.1|  unnamed protein product                                311   3e-97    Coffea canephora [robusta coffee]
ref|XP_008443293.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    310   3e-97    Cucumis melo [Oriental melon]
ref|XP_011008839.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    310   4e-97    Populus euphratica
ref|XP_011008841.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    310   4e-97    Populus euphratica
gb|KHN20624.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    296   4e-97    Glycine soja [wild soybean]
ref|XP_007030023.1|  Cobalamin-independent synthase family protei...    309   5e-97    
ref|XP_006443469.1|  hypothetical protein CICLE_v10018965mg             309   6e-97    
ref|XP_009629870.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    309   6e-97    Nicotiana tomentosiformis
ref|XP_008237251.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    309   6e-97    Prunus mume [ume]
gb|KJB26632.1|  hypothetical protein B456_004G251500                    306   6e-97    Gossypium raimondii
ref|XP_006371184.1|  hypothetical protein POPTR_0019s05430g             308   8e-97    
emb|CAJ01713.1|  methionine synthase 1 enzyme                           308   8e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT40326.1|  methionine synthase                                     308   9e-97    Nicotiana attenuata
ref|XP_011467399.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...    308   9e-97    Fragaria vesca subsp. vesca
gb|AEO86798.1|  methionine synthase                                     308   9e-97    Camellia sinensis [black tea]
ref|XP_006384691.1|  hypothetical protein POPTR_0004s20220g             310   1e-96    
ref|XP_007015562.1|  Cobalamin-independent synthase family protei...    305   1e-96    
gb|ABS01352.1|  methionine synthase                                     308   1e-96    Carica papaya [mamon]
gb|EYU38730.1|  hypothetical protein MIMGU_mgv1a001746mg                308   1e-96    Erythranthe guttata [common monkey flower]
dbj|BAD34660.1|  methionine synthase                                    308   1e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325856.1|  hypothetical protein POPTR_0019s05430g             308   1e-96    
gb|EPS68005.1|  methionine synthase                                     308   1e-96    Genlisea aurea
gb|ABG22095.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    308   2e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011005896.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    309   2e-96    Populus euphratica
ref|NP_001067313.1|  Os12g0623900                                       308   2e-96    
gb|KJB82419.1|  hypothetical protein B456_013G195000                    303   2e-96    Gossypium raimondii
ref|XP_006664220.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    308   2e-96    Oryza brachyantha
ref|XP_008386852.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    307   2e-96    
ref|XP_010247947.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    307   3e-96    Nelumbo nucifera [Indian lotus]
gb|KJB44523.1|  hypothetical protein B456_007G257500                    304   4e-96    Gossypium raimondii
ref|XP_009615630.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   4e-96    Nicotiana tomentosiformis
gb|KHN28122.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    306   4e-96    Glycine soja [wild soybean]
ref|XP_003551089.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   4e-96    Glycine max [soybeans]
ref|XP_009353101.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   5e-96    Pyrus x bretschneideri [bai li]
gb|KDP39669.1|  hypothetical protein JCGZ_02689                         306   5e-96    Jatropha curcas
gb|KEH25580.1|  cobalamin-independent methionine synthase               306   5e-96    Medicago truncatula
gb|KJB26635.1|  hypothetical protein B456_004G251500                    306   5e-96    Gossypium raimondii
ref|XP_008391707.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   6e-96    Malus domestica [apple tree]
ref|XP_010031619.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    308   6e-96    Eucalyptus grandis [rose gum]
ref|XP_004489678.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   6e-96    
ref|XP_009791486.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   8e-96    Nicotiana sylvestris
ref|XP_009366484.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   8e-96    Pyrus x bretschneideri [bai li]
ref|XP_002319710.1|  hypothetical protein POPTR_0013s05850g             306   8e-96    
ref|XP_009619432.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   9e-96    Nicotiana tomentosiformis
ref|XP_008778953.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    306   1e-95    Phoenix dactylifera
ref|XP_002525709.1|  5-methyltetrahydropteroyltriglutamate--homoc...    306   1e-95    Ricinus communis
dbj|BAP47511.1|  methionine synthase                                    306   1e-95    Gentiana triflora
gb|KHG11135.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    305   1e-95    Gossypium arboreum [tree cotton]
gb|KHG11134.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    306   1e-95    Gossypium arboreum [tree cotton]
ref|XP_007204266.1|  hypothetical protein PRUPE_ppa001783mg             305   1e-95    Prunus persica
ref|XP_009804811.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    305   2e-95    Nicotiana sylvestris
ref|XP_008680958.1|  PREDICTED: LOC100286153 isoform X1                 305   2e-95    Zea mays [maize]
ref|XP_002515852.1|  5-methyltetrahydropteroyltriglutamate--homoc...    306   2e-95    Ricinus communis
dbj|BAN04645.1|  cobalamin-independent methionine synthase              305   2e-95    Senna obtusifolia
ref|XP_010031616.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    305   2e-95    
ref|XP_003542326.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    305   3e-95    Glycine max [soybeans]
ref|XP_007015561.1|  Cobalamin-independent synthase family protei...    306   3e-95    
gb|KJB44524.1|  hypothetical protein B456_007G257500                    305   3e-95    Gossypium raimondii
ref|XP_006650367.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    304   4e-95    
ref|XP_003561625.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    304   4e-95    Brachypodium distachyon [annual false brome]
ref|XP_010236330.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    293   4e-95    Brachypodium distachyon [annual false brome]
gb|KHG18420.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    304   4e-95    Gossypium arboreum [tree cotton]
gb|KHG25606.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    304   4e-95    Gossypium arboreum [tree cotton]
gb|KHG01449.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    304   4e-95    Gossypium arboreum [tree cotton]
ref|XP_010521311.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   4e-95    Tarenaya hassleriana [spider flower]
ref|XP_011034320.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    304   5e-95    Populus euphratica
ref|XP_010908721.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    304   5e-95    Elaeis guineensis
ref|XP_010909224.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   6e-95    
gb|KJB82415.1|  hypothetical protein B456_013G195000                    303   6e-95    Gossypium raimondii
gb|KJB46053.1|  hypothetical protein B456_007G346100                    300   8e-95    Gossypium raimondii
ref|XP_009790020.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   9e-95    Nicotiana sylvestris
ref|NP_001266005.1|  5-methyltetrahydropteroyltriglutamate--homoc...    303   9e-95    Cicer arietinum [garbanzo]
gb|ADO87039.1|  pollen allergen MetE                                    303   9e-95    Amaranthus retroflexus [common amaranth]
ref|XP_010549696.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   9e-95    Tarenaya hassleriana [spider flower]
ref|XP_003522969.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    304   9e-95    Glycine max [soybeans]
gb|KHN41415.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    304   1e-94    Glycine soja [wild soybean]
ref|XP_004982263.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   1e-94    
gb|AIE47233.1|  vitamin B-12-independent methionine synthase            303   1e-94    Pisum sativum [garden pea]
gb|KJB82418.1|  hypothetical protein B456_013G195000                    303   1e-94    Gossypium raimondii
ref|XP_006364490.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   1e-94    
ref|XP_004228469.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    304   1e-94    Solanum lycopersicum
ref|XP_010528749.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_010036239.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   1e-94    
ref|XP_007149180.1|  hypothetical protein PHAVU_005G048200g             294   1e-94    Phaseolus vulgaris [French bean]
ref|NP_001275416.1|  methionine synthase                                303   1e-94    Solanum tuberosum [potatoes]
gb|KJB09182.1|  hypothetical protein B456_001G128200                    297   1e-94    Gossypium raimondii
ref|XP_002276908.2|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   2e-94    Vitis vinifera
ref|XP_010236990.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    302   2e-94    Brachypodium distachyon [annual false brome]
ref|XP_009591564.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    304   2e-94    Nicotiana tomentosiformis
ref|XP_010463840.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    302   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010485733.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    302   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010266670.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    302   2e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010097930.1|  5-methyltetrahydropteroyltriglutamate--homoc...    302   2e-94    Morus notabilis
gb|EMS51950.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    302   2e-94    Triticum urartu
sp|P93263.1|METE_MESCR  RecName: Full=5-methyltetrahydropteroyltr...    302   2e-94    Mesembryanthemum crystallinum
ref|XP_010054791.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    302   2e-94    Eucalyptus grandis [rose gum]
emb|CDY38470.1|  BnaA10g16880D                                          302   2e-94    Brassica napus [oilseed rape]
ref|XP_011044091.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   3e-94    Populus euphratica
ref|XP_006408262.1|  hypothetical protein EUTSA_v10020127mg             299   3e-94    
ref|NP_001288585.1|  LOC541714                                          302   3e-94    Zea mays [maize]
ref|XP_010038792.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    289   3e-94    
ref|XP_006479149.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    302   3e-94    Citrus sinensis [apfelsine]
gb|KDO66311.1|  hypothetical protein CISIN_1g003819mg                   297   3e-94    Citrus sinensis [apfelsine]
sp|Q42699.1|METE_CATRO  RecName: Full=5-methyltetrahydropteroyltr...    301   4e-94    Catharanthus roseus [chatas]
ref|XP_006470414.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    303   4e-94    Citrus sinensis [apfelsine]
ref|NP_001152513.1|  LOC100286153                                       301   4e-94    Zea mays [maize]
ref|XP_010932648.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    301   4e-94    Elaeis guineensis
gb|KJB46054.1|  hypothetical protein B456_007G346100                    301   5e-94    Gossypium raimondii
gb|AFW68110.1|  putative methionine synthase family protein             302   5e-94    
ref|XP_004249374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    301   5e-94    
ref|XP_008778395.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    301   5e-94    Phoenix dactylifera
ref|XP_003624677.1|  Methionine synthase                                302   6e-94    
ref|XP_011090233.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...    302   6e-94    Sesamum indicum [beniseed]
ref|XP_006826346.1|  hypothetical protein AMTR_s00004p00117110          301   7e-94    Amborella trichopoda
ref|XP_010514202.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    301   7e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002313635.2|  hypothetical protein POPTR_0009s15490g             301   8e-94    
ref|XP_008464953.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    301   8e-94    
ref|XP_002882307.1|  hypothetical protein ARALYDRAFT_477628             300   9e-94    
emb|CAJ01714.1|  methionine synthase 2 enzyme                           300   9e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88127.1|  predicted protein                                      300   9e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN70498.1|  hypothetical protein VITISV_028551                     300   1e-93    Vitis vinifera
gb|EMS50887.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    300   1e-93    Triticum urartu
emb|CAE55863.1|  cobalamin-independent methionine synthase              300   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677810.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...    301   1e-93    
gb|AAN31836.1|  putative 5-methyltetrahydropteroyltriglutamate--h...    300   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197294.1|  5-methyltetrahydropteroyltriglutamate--homocyst...    300   1e-93    Arabidopsis thaliana [mouse-ear cress]
gb|AAL09712.1|  AT5g17920/MPI7_60                                       300   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871787.1|  cobalamin-independent methionine synthase          300   1e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_010553797.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    300   1e-93    Tarenaya hassleriana [spider flower]
dbj|BAP47510.1|  methionine synthase                                    300   2e-93    Gentiana triflora
gb|ABI95860.1|  methionine synthase                                     300   2e-93    Nicotiana suaveolens
gb|KJB09183.1|  hypothetical protein B456_001G128200                    296   2e-93    Gossypium raimondii
gb|KCW47764.1|  hypothetical protein EUGRSUZ_K01513                     291   2e-93    Eucalyptus grandis [rose gum]
dbj|BAE07181.1|  methionine synthase                                    300   2e-93    Beta vulgaris [beet]
ref|XP_010541663.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    301   2e-93    Tarenaya hassleriana [spider flower]
ref|XP_006443474.1|  hypothetical protein CICLE_v10018921mg             300   2e-93    
ref|XP_006408261.1|  hypothetical protein EUTSA_v10020127mg             299   2e-93    
ref|XP_010917850.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    300   3e-93    Elaeis guineensis
ref|XP_010909225.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    299   3e-93    Elaeis guineensis
ref|XP_002276438.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    299   3e-93    
emb|CDY25477.1|  BnaC09g39920D                                          299   3e-93    Brassica napus [oilseed rape]
gb|AES80897.2|  cobalamin-independent methionine synthase               296   3e-93    Medicago truncatula
emb|CAN73135.1|  hypothetical protein VITISV_018473                     298   3e-93    Vitis vinifera
ref|XP_009774960.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    301   3e-93    Nicotiana sylvestris
gb|KDP42919.1|  hypothetical protein JCGZ_23861                         299   3e-93    Jatropha curcas
ref|XP_009121037.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    299   3e-93    Brassica rapa
ref|XP_006446418.1|  hypothetical protein CICLE_v10014233mg             300   4e-93    
dbj|BAJ87953.1|  predicted protein                                      299   4e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004141126.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    299   4e-93    Cucumis sativus [cucumbers]
ref|XP_009398996.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    299   4e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003525709.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    299   4e-93    Glycine max [soybeans]
ref|XP_003550102.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    298   5e-93    
gb|EMT31101.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    298   5e-93    
dbj|BAJ89541.1|  predicted protein                                      298   6e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010524993.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    298   6e-93    Tarenaya hassleriana [spider flower]
gb|KDO66309.1|  hypothetical protein CISIN_1g003819mg                   298   6e-93    Citrus sinensis [apfelsine]
ref|XP_010558700.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    298   6e-93    Tarenaya hassleriana [spider flower]
ref|XP_007161979.1|  hypothetical protein PHAVU_001G113800g             298   6e-93    Phaseolus vulgaris [French bean]
emb|CDX74207.1|  BnaA03g28400D                                          298   6e-93    
ref|XP_009126216.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    298   6e-93    Brassica rapa
emb|CDX85436.1|  BnaA02g03770D                                          298   6e-93    
ref|XP_006446419.1|  hypothetical protein CICLE_v10014233mg             300   6e-93    
emb|CDX92051.1|  BnaC03g33530D                                          298   6e-93    
ref|XP_009398356.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    298   8e-93    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY02674.1|  BnaC02g07610D                                          298   8e-93    
ref|XP_006400336.1|  hypothetical protein EUTSA_v10012750mg             298   1e-92    Eutrema salsugineum [saltwater cress]
emb|CDX70785.1|  BnaC03g08690D                                          298   1e-92    
ref|XP_006286451.1|  hypothetical protein CARUB_v10000282mg             298   1e-92    Capsella rubella
gb|KDO66310.1|  hypothetical protein CISIN_1g003819mg                   298   1e-92    Citrus sinensis [apfelsine]
ref|XP_009408488.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    297   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_187028.1|  methionine synthase 2                                 297   2e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AAK64167.1|  putative methionine synthase                            297   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502016.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    298   2e-92    Cicer arietinum [garbanzo]
ref|XP_009398511.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    296   4e-92    
gb|AGV54391.1|  5-methyltetrahydropteroyltriglutamate homocystein...    296   4e-92    Phaseolus vulgaris [French bean]
ref|XP_010420526.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    296   5e-92    
ref|XP_006297040.1|  hypothetical protein CARUB_v10013032mg             296   5e-92    Capsella rubella
gb|KJB09184.1|  hypothetical protein B456_001G128200                    296   5e-92    Gossypium raimondii
ref|XP_009134741.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    296   5e-92    Brassica rapa
ref|XP_008789650.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    296   6e-92    Phoenix dactylifera
emb|CDY50662.1|  BnaC05g48040D                                          295   7e-92    Brassica napus [oilseed rape]
gb|ACO34814.1|  Sal k 3 pollen allergen                                 295   7e-92    Kali turgidum [common saltwort]
ref|XP_008807626.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    295   8e-92    
ref|XP_009131623.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    295   1e-91    Brassica rapa
ref|XP_010492770.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    295   1e-91    Camelina sativa [gold-of-pleasure]
emb|CDX78767.1|  BnaA03g06790D                                          295   1e-91    
gb|EPS74353.1|  methionine synthase                                     296   2e-91    Genlisea aurea
emb|CAA89019.1|  cobalamine-independent methionine synthase             293   7e-91    Plectranthus scutellarioides
ref|XP_008359231.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    284   8e-91    
ref|XP_006400670.1|  hypothetical protein EUTSA_v10012712mg             293   1e-90    Eutrema salsugineum [saltwater cress]
ref|XP_008451024.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    293   2e-90    Cucumis melo [Oriental melon]
ref|XP_004144074.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    293   2e-90    Cucumis sativus [cucumbers]
sp|Q42662.2|METE_PLESU  RecName: Full=5-methyltetrahydropteroyltr...    291   2e-90    Plectranthus scutellarioides
gb|KFK26314.1|  hypothetical protein AALP_AA8G231500                    292   4e-90    Arabis alpina [alpine rockcress]
emb|CDX88830.1|  BnaA03g08190D                                          291   9e-90    
ref|XP_010685496.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    291   1e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006842129.1|  hypothetical protein AMTR_s00078p00112410          290   1e-89    
ref|XP_003592244.1|  Methionine synthase                                289   2e-89    
ref|XP_008385717.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    281   3e-89    
ref|XP_010493215.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    290   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006286361.1|  hypothetical protein CARUB_v10000244mg             289   4e-89    Capsella rubella
ref|XP_003601341.1|  Methionine synthase                                289   4e-89    Medicago truncatula
gb|ABR17712.1|  unknown                                                 287   1e-88    Picea sitchensis
gb|ADE75603.1|  unknown                                                 287   1e-88    Picea sitchensis
ref|XP_008775707.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    288   1e-88    Phoenix dactylifera
gb|EYU35999.1|  hypothetical protein MIMGU_mgv1a001741mg                287   1e-88    Erythranthe guttata [common monkey flower]
emb|CDX92419.1|  BnaA10g14580D                                          289   1e-88    
ref|XP_010454417.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    288   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010420946.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    288   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010454416.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    288   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010454415.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    288   2e-88    Camelina sativa [gold-of-pleasure]
emb|CDY16584.1|  BnaC09g36890D                                          289   3e-88    Brassica napus [oilseed rape]
ref|XP_009131831.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    286   4e-88    Brassica rapa
gb|KCW47769.1|  hypothetical protein EUGRSUZ_K015171                    268   6e-88    Eucalyptus grandis [rose gum]
ref|XP_009120746.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    285   2e-87    Brassica rapa
ref|XP_009120742.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    285   2e-87    
ref|XP_010933712.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    284   5e-87    Elaeis guineensis
pdb|1U1H|A  Chain A, A. Thaliana Cobalamine Independent Methionin...    283   6e-87    Arabidopsis thaliana [mouse-ear cress]
gb|ABR16134.1|  unknown                                                 282   7e-87    Picea sitchensis
emb|CCC42221.1|  vitamin-b12 independent methionine synthase            282   1e-86    Pinus pinaster [cluster pine]
ref|XP_009346240.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    282   2e-86    Pyrus x bretschneideri [bai li]
emb|CAE55865.1|  cobalamin-independent methionine synthase              282   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230954.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    282   2e-86    Prunus mume [ume]
gb|AAL73979.1|AF466201_8  methionine synthase protein                   281   3e-86    Sorghum bicolor [broomcorn]
emb|CDX70955.1|  BnaC03g10390D                                          281   3e-86    
ref|NP_197598.2|  methionine synthase 3                                 281   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036242.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    280   6e-86    Eucalyptus grandis [rose gum]
gb|ABR18027.1|  unknown                                                 280   6e-86    Picea sitchensis
ref|XP_007207630.1|  hypothetical protein PRUPE_ppa021650mg             278   2e-85    
ref|XP_003624678.1|  Methionine synthase                                275   5e-85    
ref|XP_002874026.1|  hypothetical protein ARALYDRAFT_489009             278   8e-85    
ref|XP_010038793.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    263   3e-84    
ref|XP_003624679.1|  Methionine synthase                                275   4e-84    
ref|XP_010242374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    276   5e-84    Nelumbo nucifera [Indian lotus]
ref|XP_002969765.1|  hypothetical protein SELMODRAFT_171028             274   1e-83    Selaginella moellendorffii
ref|XP_002993286.1|  hypothetical protein SELMODRAFT_162950             274   1e-83    Selaginella moellendorffii
ref|XP_010036240.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    272   7e-83    Eucalyptus grandis [rose gum]
ref|XP_001757366.1|  predicted protein                                  271   1e-82    
ref|XP_010036243.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    271   2e-82    Eucalyptus grandis [rose gum]
gb|KCW44398.1|  hypothetical protein EUGRSUZ_L021162                    260   2e-82    Eucalyptus grandis [rose gum]
ref|XP_004159344.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    269   9e-82    
ref|XP_004144075.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    268   1e-81    
ref|XP_001758527.1|  predicted protein                                  267   5e-81    
gb|KCW45140.1|  hypothetical protein EUGRSUZ_L01249                     266   1e-80    Eucalyptus grandis [rose gum]
ref|XP_001784286.1|  predicted protein                                  266   1e-80    
ref|XP_010041374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...    261   2e-80    
gb|KCW45141.1|  hypothetical protein EUGRSUZ_L01250                     256   7e-78    Eucalyptus grandis [rose gum]
tpg|DAA47597.1|  TPA: putative methionine synthase family protein       230   4e-74    
gb|KCW47766.1|  hypothetical protein EUGRSUZ_K01515                     223   1e-64    Eucalyptus grandis [rose gum]
gb|AHJ69501.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    208   4e-59    Granulibacter bethesdensis
gb|ABI61681.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    208   4e-59    
ref|WP_043452738.1|  5-methyltetrahydropteroyltriglutamate--homoc...    207   6e-59    
ref|WP_025319249.1|  5-methyltetrahydropteroyltriglutamate--homoc...    207   6e-59    
ref|WP_030431666.1|  5-methyltetrahydropteroyltriglutamate--homoc...    196   7e-55    
gb|AHJ62603.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    195   1e-54    
gb|AHJ66832.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    194   2e-54    
ref|WP_025286299.1|  5-methyltetrahydropteroyltriglutamate--homoc...    194   2e-54    
ref|WP_025320901.1|  5-methyltetrahydropteroyltriglutamate--homoc...    194   2e-54    
gb|ABY60341.1|  At3g03780-like protein                                  181   5e-54    
gb|ABY60333.1|  At3g03780                                               181   5e-54    
ref|WP_042189239.1|  5-methyltetrahydropteroyltriglutamate--homoc...    192   8e-54    
emb|CEL18357.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    192   8e-54    
ref|WP_034492788.1|  5-methyltetrahydropteroyltriglutamate--homoc...    186   2e-53    
gb|ABY60334.1|  At3g03780                                               179   2e-53    
ref|WP_037258238.1|  5-methyltetrahydropteroyltriglutamate--homoc...    190   6e-53    
ref|WP_013933581.1|  5-methyltetrahydropteroyltriglutamate--homoc...    190   8e-53    
gb|ABY60327.1|  At3g03780                                               178   9e-53    
ref|WP_011240849.1|  5-methyltetrahydropteroyltriglutamate--homoc...    189   2e-52    
ref|WP_014500443.1|  5-methyltetrahydropteroyltriglutamate--homoc...    189   2e-52    
ref|WP_012817024.1|  5-methyltetrahydropteroyltriglutamate--homoc...    189   2e-52    
ref|WP_014848375.1|  5-methyltetrahydropteroyltriglutamate--homoc...    189   2e-52    
ref|WP_023432491.1|  5-methyltetrahydropteroyltriglutamate-- homo...    189   3e-52    
dbj|GAK51674.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    187   5e-52    
ref|WP_009949830.1|  5-methyltetrahydropteroyltriglutamate--homoc...    187   6e-52    
ref|WP_033381826.1|  5-methyltetrahydropteroyltriglutamate--homoc...    187   7e-52    
gb|KFX72013.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    186   1e-51    
ref|WP_026234673.1|  5-methyltetrahydropteroyltriglutamate--homoc...    186   1e-51    
ref|WP_017970786.1|  hypothetical protein                               175   2e-51    
ref|WP_010913785.1|  5-methyltetrahydropteroyltriglutamate--homoc...    184   8e-51    
ref|WP_019855266.1|  5-methyltetrahydropteroyltriglutamate--homoc...    184   8e-51    
ref|WP_030855807.1|  hypothetical protein                               176   9e-51    
ref|WP_021051186.1|  5-methyltetrahydropteroyltriglutamate--homoc...    183   2e-50    
ref|WP_027033338.1|  5-methyltetrahydropteroyltriglutamate--homoc...    183   2e-50    
ref|WP_040672419.1|  5-methyltetrahydropteroyltriglutamate--homoc...    183   2e-50    
emb|CCV11472.1|  5-methyltetrahydropteroyltriglutamate-homocystei...    183   2e-50    
ref|WP_029581768.1|  5-methyltetrahydropteroyltriglutamate--homoc...    183   3e-50    
ref|WP_036240889.1|  5-methyltetrahydropteroyltriglutamate--homoc...    183   3e-50    
gb|EKF42565.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    183   3e-50    
ref|WP_036325689.1|  5-methyltetrahydropteroyltriglutamate--homoc...    182   3e-50    
emb|CAD31565.1|  PUTATIVE 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE--...    183   3e-50    
ref|WP_031257112.1|  5-methyltetrahydropteroyltriglutamate--homoc...    182   3e-50    
ref|WP_027163777.1|  5-methyltetrahydropteroyltriglutamate--homoc...    182   5e-50    
ref|WP_010918370.1|  5-methyltetrahydropteroyltriglutamate--homoc...    182   6e-50    
ref|WP_011473935.1|  5-methyltetrahydropteroyltriglutamate--homoc...    182   6e-50    
ref|WP_009359908.1|  5-methyltetrahydropteroyltriglutamate--homoc...    182   7e-50    
ref|WP_019863485.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   9e-50    
ref|WP_019631992.1|  hypothetical protein                               181   9e-50    
ref|WP_019198107.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   1e-49    
ref|WP_002644197.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   1e-49    
ref|WP_018391677.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   1e-49    
ref|WP_017973577.1|  hypothetical protein                               181   1e-49    
ref|WP_021058220.1|  methionine synthase II (cobalamin-independent)     181   1e-49    
ref|WP_016333203.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   1e-49    
ref|WP_024573748.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    181   1e-49    
ref|WP_031212669.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   2e-49    
ref|WP_009946026.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   2e-49    
ref|WP_040999480.1|  5-methyltetrahydropteroyltriglutamate--homoc...    181   2e-49    
ref|WP_014555975.1|  5-methyltetrahydropteroyltriglutamate--homoc...    180   2e-49    
gb|ETK34148.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    180   2e-49    
gb|ESZ01232.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    180   2e-49    
ref|WP_030510603.1|  5-methyltetrahydropteroyltriglutamate--homoc...    180   2e-49    
ref|WP_013216015.1|  5-methyltetrahydropteroyltriglutamate--homoc...    180   3e-49    
ref|WP_005152152.1|  5-methyltetrahydropteroyltriglutamate--homoc...    180   3e-49    
ref|WP_007909831.1|  5-methyltetrahydropteroyltriglutamate--homoc...    180   3e-49    
ref|WP_040581813.1|  5-methyltetrahydropteroyltriglutamate--homoc...    180   3e-49    
ref|WP_021053549.1|  5-methyltetrahydropteroyltriglutamate--homoc...    179   4e-49    
ref|WP_031234559.1|  5-methyltetrahydropteroyltriglutamate--homoc...    169   4e-49    
ref|WP_011571495.1|  5-methyltetrahydropteroyltriglutamate--homoc...    179   5e-49    
ref|WP_037344088.1|  5-methyltetrahydropteroyltriglutamate--homoc...    179   6e-49    
ref|WP_035178289.1|  5-methyltetrahydropteroyltriglutamate--homoc...    179   6e-49    
ref|WP_023721425.1|  5-methyltetrahydropteroyltriglutamate--homoc...    179   8e-49    
gb|KHN02039.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    167   8e-49    
ref|WP_026963023.1|  5-methyltetrahydropteroyltriglutamate--homoc...    179   9e-49    
ref|WP_031245605.1|  5-methyltetrahydropteroyltriglutamate--homoc...    179   9e-49    
gb|AFA36546.1|  methionine synthase 1                                   165   9e-49    
ref|WP_010693201.1|  5-methyltetrahydropteroyltriglutamate--homoc...    178   1e-48    
ref|WP_024520597.1|  5-methyltetrahydropteroyltriglutamate--homoc...    178   1e-48    
gb|ESW77942.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    178   1e-48    
ref|WP_038515445.1|  5-methyltetrahydropteroyltriglutamate--homoc...    178   1e-48    
ref|WP_034311848.1|  5-methyltetrahydropteroyltriglutamate--homoc...    178   1e-48    
ref|WP_040982557.1|  5-methyltetrahydropteroyltriglutamate--homoc...    178   1e-48    
ref|WP_023755992.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    178   2e-48    
ref|WP_035243243.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   2e-48    
gb|EGP55139.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    177   2e-48    
ref|WP_020637128.1|  hypothetical protein                               177   2e-48    
ref|WP_018653971.1|  hypothetical protein                               177   2e-48    
ref|WP_031573625.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   3e-48    
ref|WP_044539472.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   3e-48    
ref|WP_044590264.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   3e-48    
ref|WP_031194147.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   3e-48    
ref|WP_030980215.1|  hypothetical protein                               172   3e-48    
ref|WP_007029737.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   3e-48    
ref|WP_031200785.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   4e-48    
ref|WP_011389408.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   4e-48    
ref|WP_027841346.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   5e-48    
ref|WP_019814692.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   5e-48    
ref|WP_023671846.1|  5-methyltetrahydropteroyltriglutamate--homoc...    177   5e-48    
ref|WP_043576918.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   5e-48    
ref|WP_020544333.1|  hypothetical protein                               176   5e-48    
gb|ESY33171.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    176   5e-48    
ref|WP_034271759.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   6e-48    
ref|WP_031234464.1|  5-methyltetrahydropteroyltriglutamate--homoc...    166   6e-48    
ref|WP_031250155.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   7e-48    
ref|WP_007023727.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   8e-48    
ref|WP_031356299.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   8e-48    
ref|WP_031210616.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   8e-48    
ref|WP_031251506.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   8e-48    
ref|WP_031214283.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   8e-48    
ref|WP_031213554.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   9e-48    
ref|WP_040970512.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   9e-48    
ref|WP_041009164.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   9e-48    
ref|WP_010641368.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   1e-47    
gb|KJF73247.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    176   1e-47    
ref|WP_031246657.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   1e-47    
ref|WP_024894698.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   1e-47    
ref|WP_031194851.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    176   1e-47    
ref|WP_031204423.1|  5-methyltetrahydropteroyltriglutamate--homoc...    176   1e-47    
ref|WP_034240533.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   1e-47    
ref|WP_031240990.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   1e-47    
ref|WP_031248543.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   1e-47    
ref|WP_023737106.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   2e-47    
ref|WP_024896950.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   2e-47    
ref|WP_024580266.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    175   2e-47    
ref|WP_028924984.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   2e-47    
ref|WP_021592118.1|  hypothetical protein                               175   2e-47    
ref|WP_026066250.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   2e-47    
ref|WP_044850312.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   2e-47    
gb|ESZ30843.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    175   2e-47    
ref|WP_024919717.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    175   2e-47    
ref|WP_043833278.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   2e-47    
gb|ABJ07105.1|  methionine synthase (B12-independent)                   175   2e-47    
ref|WP_041799807.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   2e-47    
ref|WP_029167051.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   2e-47    
ref|WP_031258584.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   3e-47    
gb|ADU51737.1|  methionine synthase (B12-independent)                   175   3e-47    
ref|WP_037321082.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   3e-47    
ref|WP_039506570.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   3e-47    
ref|WP_030534032.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   3e-47    
ref|WP_041711270.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   3e-47    
gb|AEO48235.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    174   3e-47    
ref|WP_042061100.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   3e-47    
ref|WP_036793096.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   3e-47    
ref|WP_042501931.1|  5-methyltetrahydropteroyltriglutamate--homoc...    175   4e-47    
ref|WP_031238629.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   4e-47    
ref|WP_029205760.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   4e-47    
ref|WP_029207120.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   4e-47    
ref|WP_023747666.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   4e-47    
gb|EKS41790.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    174   5e-47    
gb|ESY79421.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    174   5e-47    
ref|WP_031252634.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   5e-47    
ref|WP_027146727.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   5e-47    
ref|WP_037103251.1|  5-methyltetrahydropteroyltriglutamate--homoc...    174   5e-47    
gb|ESZ24024.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    174   5e-47    
gb|ESZ01137.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    174   5e-47    
gb|ESX84874.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    174   6e-47    
gb|ESX10182.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    174   6e-47    
ref|WP_029207099.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   6e-47    
ref|WP_013061793.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   6e-47    
ref|WP_011404021.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   6e-47    
gb|ESX00583.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    173   7e-47    
ref|WP_031203398.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   8e-47    
ref|WP_012536066.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   8e-47    
ref|WP_020401013.1|  hypothetical protein                               173   8e-47    
ref|WP_031205853.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   8e-47    
ref|WP_035578536.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   8e-47    
ref|WP_031197364.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   8e-47    
ref|WP_035728278.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   9e-47    
ref|WP_031204787.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   9e-47    
gb|ESX09677.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    173   9e-47    
gb|ESY12540.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    173   9e-47    
ref|WP_030112459.1|  5-methyltetrahydropteroyltriglutamate--homoc...    169   9e-47    
ref|WP_023723603.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    173   9e-47    
gb|ESW63443.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    173   9e-47    
gb|ESX66086.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    173   9e-47    
ref|WP_036259525.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   1e-46    
ref|WP_030121850.1|  5-methyltetrahydropteroyltriglutamate--homoc...    169   1e-46    
ref|XP_005966092.1|  PREDICTED: probable 5-methyltetrahydropteroy...    174   1e-46    
ref|WP_027765038.1|  5-methyltetrahydropteroyltriglutamate--homoc...    173   1e-46    
ref|WP_039737673.1|  5-methyltetrahydropteroyltriglutamate--homoc...    168   1e-46    
gb|ESY89504.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    172   1e-46    
gb|ESY84750.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    172   1e-46    
gb|ESY63096.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    172   2e-46    
ref|WP_027555274.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
ref|WP_007661722.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
ref|WP_024441149.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
ref|WP_029168044.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
ref|WP_010500751.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
ref|WP_011027494.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
ref|WP_031209093.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
ref|WP_030105984.1|  5-methyltetrahydropteroyltriglutamate--homoc...    168   2e-46    
ref|WP_035222808.1|  5-methyltetrahydropteroyltriglutamate--homoc...    172   2e-46    
gb|ESX98083.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    172   3e-46    
ref|WP_030952777.1|  5-methyltetrahydropteroyltriglutamate--homoc...    164   3e-46    
ref|WP_037234711.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   3e-46    
ref|WP_030999649.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   3e-46    
ref|WP_028441028.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   3e-46    
gb|KIZ26964.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    167   3e-46    
gb|AEN72368.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    171   4e-46    
gb|ESY89272.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    171   4e-46    
ref|WP_018290363.1|  hypothetical protein                               171   4e-46    
ref|WP_005441622.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   5e-46    
ref|XP_010094122.1|  5-methyltetrahydropteroyltriglutamate--homoc...    157   5e-46    
ref|WP_028233871.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   5e-46    
gb|KIO32801.1|  hypothetical protein M407DRAFT_95971                    171   5e-46    
gb|ESW79021.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    171   5e-46    
ref|WP_018550962.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   5e-46    
gb|KAI95639.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    171   5e-46    
ref|WP_030455417.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   5e-46    
ref|WP_012842941.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   6e-46    
gb|ESZ70074.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    171   6e-46    
gb|ESZ29599.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    171   6e-46    
ref|WP_029015824.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   6e-46    
gb|ESZ54430.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    171   6e-46    
ref|WP_030830316.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   6e-46    
ref|WP_003520856.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   6e-46    
ref|WP_040407650.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   6e-46    
ref|WP_030562869.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   7e-46    
ref|WP_030623621.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    171   7e-46    
ref|WP_030211308.1|  5-methyltetrahydropteroyltriglutamate--homoc...    171   7e-46    
ref|WP_020012133.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    171   7e-46    
ref|WP_042637286.1|  5-methyltetrahydropteroyltriglutamate--homoc...    168   7e-46    



>tpg|DAA47596.1| TPA: putative methionine synthase family protein [Zea mays]
Length=458

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|KDO54954.1| hypothetical protein CISIN_1g0202292mg, partial [Citrus sinensis]
Length=222

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVL  155



>gb|KJB80760.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
Length=538

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRYNWTGGEIG+DTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYNWTGGEIGYDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+E+KEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVDTVPVL  155



>ref|XP_006443472.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56712.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=521

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVL  155



>ref|XP_011077750.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Sesamum indicum]
Length=765

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAE+L+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEELEKVATDLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_004960256.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Setaria italica]
Length=774

 Score =   315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIP
Sbjct  8    RKMASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIP  67

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH
Sbjct  68   SNTFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  127

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            FIVPELGP+ KF+Y+SHKAVNEYKEAKALGVDTVPVL
Sbjct  128  FIVPELGPNTKFTYSSHKAVNEYKEAKALGVDTVPVL  164



>gb|KJB26633.1| hypothetical protein B456_004G251500 [Gossypium raimondii]
Length=511

 Score =   307 bits (787),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIW+QMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDNKSSAEDLQKVAADLRSSIWQQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTIPVL  155



>gb|KCW47762.1| hypothetical protein EUGRSUZ_K015081, partial [Eucalyptus grandis]
Length=319

 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRSSIWKQMSHAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKA+ EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAITEYKEAKALGVDTVPVL  155



>gb|EYU18182.1| hypothetical protein MIMGU_mgv1a001749mg [Erythranthe guttata]
Length=765

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRSSIWKQMSDVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALG+DTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGIDTVPVL  155



>ref|XP_011094156.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Sesamum indicum]
Length=765

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAE+L+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEELEKVATDLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_004136654.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 ref|XP_004170195.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 gb|KGN59474.1| Methionine synthase [Cucumis sativus]
Length=765

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSCYDQVLDTTALLGAVPPRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGVDTVPVL  155



>gb|KDO66097.1| hypothetical protein CISIN_1g0165812mg, partial [Citrus sinensis]
Length=222

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNA+V AMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAK  GV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVL  155



>gb|KJB44522.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
Length=511

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVL  155



>ref|XP_006443470.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56710.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=586

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVL  155



>gb|KJB80758.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
 gb|KJB80759.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
 gb|KJB80761.1| hypothetical protein B456_013G114400 [Gossypium raimondii]
Length=765

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRYNWTGGEIG+DTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYNWTGGEIGYDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+E+KEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVDTVPVL  155



>ref|NP_001235794.1| methionine synthase [Glycine max]
 gb|AAQ08403.1| methionine synthase [Glycine max]
Length=763

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+SDLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSSDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSHYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F+YASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFTYASHKAVDEYKEAKALGVDTVPVL  155



>ref|XP_008662311.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Zea mays]
 gb|ACN28399.1| unknown [Zea mays]
 tpg|DAA47594.1| TPA: putative methionine synthase family protein isoform 1 [Zea 
mays]
 tpg|DAA47595.1| TPA: putative methionine synthase family protein isoform 2 [Zea 
mays]
Length=766

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|AAL33589.1| methionine synthase [Zea mays]
Length=766

 Score =   311 bits (798),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|KJB82416.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=538

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVL  155



>tpg|DAA47593.1| TPA: putative methionine synthase family protein [Zea mays]
Length=781

 Score =   311 bits (798),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_004291976.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Fragaria vesca subsp. vesca]
Length=765

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRCSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSHYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVKEYKEAKALGVDTVPVL  155



>gb|ABG22097.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=607

 Score =   307 bits (786),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT AMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVL  155



>gb|ABI35986.1| methionine synthase [Orobanche ramosa]
Length=765

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DL+ASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLKASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFATYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEY EAKALGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYNEAKALGVNTVPVL  155



>ref|XP_006371191.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48988.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=655

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVL  155



>ref|XP_003554033.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform 1 [Glycine max]
Length=763

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSFYDQLLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F+YASHKAV+EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFTYASHKAVDEYKEAKALGVDTIPVL  155



>ref|XP_004960257.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Setaria italica]
Length=765

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KF+Y+SHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFTYSSHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_007151496.1| hypothetical protein PHAVU_004G051600g [Phaseolus vulgaris]
 gb|ESW23490.1| hypothetical protein PHAVU_004G051600g [Phaseolus vulgaris]
Length=763

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY WTGGEIGFDT+FSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPARYGWTGGEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPD+ F+YASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDMTFTYASHKAVNEYKEAKALGVDTVPVL  155



>gb|KHG18658.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=770

 Score =   310 bits (794),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRYNWTGGEIG DTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYNWTGGEIGDDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+E+KEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVDTVPVL  155



>ref|NP_001067314.1| Os12g0624000 [Oryza sativa Japonica Group]
 sp|Q2QLY4.1|METE2_ORYSJ RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2; AltName: Full=Cobalamin-independent 
methionine synthase 2 [Oryza sativa Japonica Group]
 gb|ABA99428.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABA99429.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30333.1| Os12g0624000 [Oryza sativa Japonica Group]
 dbj|BAG90565.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69709.1| hypothetical protein OsI_39180 [Oryza sativa Indica Group]
 gb|EEE53643.1| hypothetical protein OsJ_36927 [Oryza sativa Japonica Group]
 gb|AFI71268.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 
[Oryza sativa Japonica Group]
Length=766

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVL  155



>emb|CDP10525.1| unnamed protein product [Coffea canephora]
Length=813

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWD KSSAE+L+KVA+DLRASIWKQMA AGIKYIP
Sbjct  47   RIMASHIVGYPRMGPKRELKFALESFWDKKSSAEELEKVAADLRASIWKQMADAGIKYIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
             NTFS YDQVLDT A+LGAVPPRYNW+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  GNTFSYYDQVLDTIALLGAVPPRYNWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  167  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  203



>ref|XP_008443293.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis melo]
Length=765

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY+WTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYSWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGVDTVPVL  155



>ref|XP_011008839.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X1 [Populus euphratica]
 ref|XP_011008840.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X1 [Populus euphratica]
Length=779

 Score =   310 bits (793),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVL  155



>ref|XP_011008841.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X2 [Populus euphratica]
Length=779

 Score =   310 bits (793),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVL  155



>gb|KHN20624.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=325

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVA DLRASIWKQM  AGIKYIP+N
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVAFDLRASIWKQMIDAGIKYIPNN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W   EIGFDT+FSMARGNA+VP MEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNSEEIGFDTFFSMARGNASVPTMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_007030023.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007030024.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10525.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10526.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
Length=765

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTT+MLGAVPPRY+W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTSMLGAVPPRYSWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTVPVL  155



>ref|XP_006443469.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 ref|XP_006443471.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 ref|XP_006479148.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Citrus sinensis]
 gb|ESR56709.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56711.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=765

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAK LGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVL  155



>ref|XP_009629870.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
 ref|XP_009629878.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
Length=765

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVL  155



>ref|XP_008237251.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Prunus mume]
Length=765

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTIPVL  155



>gb|KJB26632.1| hypothetical protein B456_004G251500 [Gossypium raimondii]
Length=651

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIW+QMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDNKSSAEDLQKVAADLRSSIWQQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTIPVL  155



>ref|XP_006371184.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48981.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=738

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVL  155



>emb|CAJ01713.1| methionine synthase 1 enzyme [Hordeum vulgare subsp. vulgare]
Length=765

 Score =   308 bits (790),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPD KFSY+SHKA+NEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDTKFSYSSHKAINEYKEAKALGVDTVPVL  155



>gb|AGT40326.1| methionine synthase [Nicotiana attenuata]
Length=765

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMAEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVL  155



>ref|XP_011467399.1| PREDICTED: LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR SIWKQM+ AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSNAEDLQKVSADLRCSIWKQMSDAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSHYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPD+KFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDIKFSYASHKAVEEYKEAKALGVDTVPVL  155



>gb|AEO86798.1| methionine synthase [Camellia sinensis]
Length=765

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMASAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY WTGGEIGFDTYFSMARGNA+VPAMEM KWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWTGGEIGFDTYFSMARGNASVPAMEMAKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP++KFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEIKFSYASHKAVDEYKEAKALGVDTVPVL  155



>ref|XP_006384691.1| hypothetical protein POPTR_0004s20220g [Populus trichocarpa]
 gb|ERP62488.1| hypothetical protein POPTR_0004s20220g [Populus trichocarpa]
Length=817

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQM+ AGIK+IP
Sbjct  51   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMSDAGIKFIP  110

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  111  SNTFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  170

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  171  YIVPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  207



>ref|XP_007015562.1| Cobalamin-independent synthase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33181.1| Cobalamin-independent synthase family protein isoform 2 [Theobroma 
cacao]
Length=632

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR+SIW+QM+ AGIKYIP
Sbjct  55   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWRQMSEAGIKYIP  114

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LD TAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  115  SNTFSYYDQMLDNTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  174

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  175  YIVPELGPDVKFSYASHKAVDEYKEAKALGVDTVPVL  211



>gb|ABS01352.1| methionine synthase [Carica papaya]
Length=765

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQM+ A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMSDARIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVTFSYASHKAVTEYKEAKALGVDTVPVL  155



>gb|EYU38730.1| hypothetical protein MIMGU_mgv1a001746mg [Erythranthe guttata]
Length=765

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTA+LGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTALLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEY EAKALG+DTVPVL
Sbjct  121  VPELGPDVTFSYASHKAVNEYNEAKALGIDTVPVL  155



>dbj|BAD34660.1| methionine synthase [Hordeum vulgare subsp. vulgare]
Length=765

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPD KFSY+SHKA+NEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDTKFSYSSHKAINEYKEAKALGVDTVPVL  155



>ref|XP_002325856.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371179.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 ref|XP_006371180.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371181.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371182.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371183.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371185.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371186.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371187.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371188.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371189.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371190.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|EEF00238.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48976.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 gb|ERP48977.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48978.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48979.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48980.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48982.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48983.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48984.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48985.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48986.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48987.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=765

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVL  155



>gb|EPS68005.1| methionine synthase [Genlisea aurea]
Length=765

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPR+GPKRELKFALESFWDGKSSAE+L+KVA D+R SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRVGPKRELKFALESFWDGKSSAEELEKVAKDIRTSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA LGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAFLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALG+DTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGIDTVPVL  155



>gb|ABG22095.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22096.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=766

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT AMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_011005896.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
Length=814

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQ+VA+DLR+SIWKQM+ AGIK+IP
Sbjct  48   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQRVAADLRSSIWKQMSDAGIKFIP  107

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  108  SNTFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  167

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  168  YIVPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  204



>ref|NP_001067313.1| Os12g0623900 [Oryza sativa Japonica Group]
 sp|Q2QLY5.1|METE1_ORYSJ RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1; AltName: Full=Cobalamin-independent 
methionine synthase 1 [Oryza sativa Japonica Group]
 gb|ABA99427.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22094.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30332.1| Os12g0623900 [Oryza sativa Japonica Group]
 gb|EAY83957.1| hypothetical protein OsI_39179 [Oryza sativa Indica Group]
 gb|EAZ21274.1| hypothetical protein OsJ_36926 [Oryza sativa Japonica Group]
 gb|AFI71269.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 
[Oryza sativa Japonica Group]
Length=766

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT AMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVL  155



>gb|KJB82419.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=578

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVL  155



>ref|XP_006664220.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Oryza brachyantha]
Length=766

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGF TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPNTKFSYSSHKAVNEYKEAKALGVETVPVL  155



>ref|XP_008386852.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
 ref|XP_008386853.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
Length=765

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVL  155



>ref|XP_010247947.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nelumbo nucifera]
Length=765

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLRASIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRASIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPDRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAVNEYKEAK LGV+TVPV+
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKELGVNTVPVI  155



>gb|KJB44523.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
Length=664

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVL  155



>ref|XP_009615630.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009615631.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009615632.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
Length=765

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK LGV+TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVNTVPVL  155



>gb|KHN28122.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=765

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVASDLRASIWKQMIDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W G EIGFDT+FSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGEEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_003551089.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Glycine max]
 ref|XP_006601025.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Glycine max]
Length=765

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVASDLRASIWKQMIDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W G EIGFDT+FSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGEEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_009353101.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
 ref|XP_009353102.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
Length=765

 Score =   306 bits (785),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM  AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMTDAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVL  155



>gb|KDP39669.1| hypothetical protein JCGZ_02689 [Jatropha curcas]
Length=765

 Score =   306 bits (784),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVA +LR SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLEKVAFELRESIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGIDTVPVL  155



>gb|KEH25580.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=765

 Score =   306 bits (784),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLEKVAADLRASIWKQMSSAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVL+TTAM+GAVPPRY WTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLNTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKF+YASHKAVNEYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVKFTYASHKAVNEYKEAKALGVDTIPVL  155



>gb|KJB26635.1| hypothetical protein B456_004G251500 [Gossypium raimondii]
Length=765

 Score =   306 bits (784),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIW+QMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDNKSSAEDLQKVAADLRSSIWQQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTIPVL  155



>ref|XP_008391707.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Malus domestica]
 ref|XP_008391708.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Malus domestica]
Length=765

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM  AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMTDAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVL  155



>ref|XP_010031619.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
 gb|KCW50983.1| hypothetical protein EUGRSUZ_J00612 [Eucalyptus grandis]
Length=827

 Score =   308 bits (788),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  84   P*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKY  263
            P R MASHIVGYPRMGPKRELKFALESFWD KSSAE+LQKVA+DLRASIWKQMA AGIKY
Sbjct  59   PVRAMASHIVGYPRMGPKRELKFALESFWDRKSSAEELQKVAADLRASIWKQMASAGIKY  118

Query  264  IPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTN  443
            IPSNTFS YDQVLDTTAMLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTN
Sbjct  119  IPSNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDTYFSMARGNASVPAMEMTKWFDTN  178

Query  444  YHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            YH+IVPELGPDVKFSYASHKAV+E+KEA+ALGVDTVPVL
Sbjct  179  YHYIVPELGPDVKFSYASHKAVDEFKEARALGVDTVPVL  217



>ref|XP_004489678.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Cicer arietinum]
 ref|XP_004489679.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Cicer arietinum]
 ref|XP_004489680.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X3 [Cicer arietinum]
Length=765

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV++DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRASIWKQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY WTGGEIGFDTYFSM RGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFAYYDQVLDTTAMLGAVPTRYGWTGGEIGFDTYFSMGRGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F+YASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFTYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_009791486.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana sylvestris]
 ref|XP_009791487.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana sylvestris]
Length=765

 Score =   306 bits (783),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNW GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPARYNWAGGEIAFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVL  155



>ref|XP_009366484.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
 ref|XP_009366485.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
Length=765

 Score =   306 bits (783),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVETVPVL  155



>ref|XP_002319710.1| hypothetical protein POPTR_0013s05850g [Populus trichocarpa]
 ref|XP_006375907.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 gb|EEE95633.1| hypothetical protein POPTR_0013s05850g [Populus trichocarpa]
 gb|ERP53704.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
Length=765

 Score =   306 bits (783),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVTEYKEAKALGVDTIPVL  155



>ref|XP_009619432.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009619433.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
Length=765

 Score =   306 bits (783),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNW GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPARYNWAGGEIAFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVL  155



>ref|XP_008778953.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Phoenix dactylifera]
Length=766

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVATDLRRSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY WTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYGWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP  KFSYASHKAV+EYKEA ALGVDTVPVL
Sbjct  121  VPELGPSTKFSYASHKAVSEYKEANALGVDTVPVL  155



>ref|XP_002525709.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
 gb|EEF36692.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
Length=765

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLR SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLEKVASDLRESIWKQMAAAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKA GVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVTEYKEAKAHGVDTVPVL  155



>dbj|BAP47511.1| methionine synthase [Gentiana triflora]
Length=765

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA++LRASIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVATELRASIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT  MLGAVPPRYN+ GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTATMLGAVPPRYNYGGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAK LGVDTVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKELGVDTVPVL  155



>gb|KHG11135.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EY+EAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYEEAKALGVDTIPVL  155



>gb|KHG11134.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=778

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMAAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EY+EAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYEEAKALGVDTIPVL  155



>ref|XP_007204266.1| hypothetical protein PRUPE_ppa001783mg [Prunus persica]
 gb|EMJ05465.1| hypothetical protein PRUPE_ppa001783mg [Prunus persica]
Length=765

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK+SAEDLQKVA+DLR+SIWKQMA AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTSAEDLQKVAADLRSSIWKQMADAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDHVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVEEYKEAKALGVDTIPVL  155



>ref|XP_009804811.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009804812.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009804813.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=765

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK LGV+T PVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVNTAPVL  155



>ref|XP_008680958.1| PREDICTED: LOC100286153 isoform X1 [Zea mays]
Length=793

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLR+SIWKQM+ AGIKYIP
Sbjct  27   RKMASHIVGYPRMGPKRELKFALESFWDGKSSADDLEKVASDLRSSIWKQMSEAGIKYIP  86

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYH
Sbjct  87   SNTFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYH  146

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            FIVPELGP  KF+YASHKAV+EYKEAKALG+DTVPVL
Sbjct  147  FIVPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVL  183



>ref|XP_002515852.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
 gb|EEF46521.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
Length=815

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  72   LASTP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGA  251
            L+ST  R MASHI GYPRMGPKRELKFALESFWDGKSSAEDLQKVA++LRASIWKQMA A
Sbjct  43   LSSTSFRAMASHIAGYPRMGPKRELKFALESFWDGKSSAEDLQKVAAELRASIWKQMADA  102

Query  252  GIKYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKW  431
            G K+IPSNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKW
Sbjct  103  GTKFIPSNTFSYYDQVLDTTAMLGAVPPRYGWDGGEIGFDVYFSMARGNASVPAMEMTKW  162

Query  432  FDTNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            FDTNYH+IVPELGP+VKFSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  163  FDTNYHYIVPELGPEVKFSYASHKAVDEYKEAKALGVETVPVL  205



>dbj|BAN04645.1| cobalamin-independent methionine synthase [Senna obtusifolia]
Length=765

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIP N
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRASIWKQMSDAGIKYIPCN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+E+KEAKALGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEAKALGVNTVPVL  155



>ref|XP_010031616.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010031617.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010031618.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Eucalyptus grandis]
 gb|KCW50984.1| hypothetical protein EUGRSUZ_J00613 [Eucalyptus grandis]
Length=765

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAE+LQKVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDRKSSAEELQKVAADLRASIWKQMASAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+E+KEA+ALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVDEFKEARALGVDTVPVL  155



>ref|XP_003542326.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Glycine max]
 gb|KHN46660.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=803

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR++IWKQMA AGI
Sbjct  33   ATSSRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSAIWKQMADAGI  92

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  93   KYIPSNTFSLYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFD  152

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPELGPDVKFSYASHKAV+E+KEAK LGV+TVPVL
Sbjct  153  TNYHYIVPELGPDVKFSYASHKAVDEFKEAKVLGVNTVPVL  193



>ref|XP_007015561.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33180.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
Length=821

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR+SIW+QM+ AGIKYIP
Sbjct  55   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWRQMSEAGIKYIP  114

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LD TAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  115  SNTFSYYDQMLDNTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  174

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  175  YIVPELGPDVKFSYASHKAVDEYKEAKALGVDTVPVL  211



>gb|KJB44524.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
 gb|KJB44525.1| hypothetical protein B456_007G257500 [Gossypium raimondii]
Length=765

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVL  155



>ref|XP_006650367.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Oryza brachyantha]
Length=766

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPNTKFSYASHKAVSEYKEAKALGVETVPVL  155



>ref|XP_003561625.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brachypodium distachyon]
 ref|XP_010231869.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brachypodium distachyon]
Length=766

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPETKFSYASHKAVSEYKEAKALGVDTVPVL  155



>ref|XP_010236330.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Brachypodium distachyon]
Length=388

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYP MG KRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIP N
Sbjct  1    MASHIVGYPCMGAKRELKFALESFWDGKSSAEDLKKVATDLRASIWKQMASAGIKYIPGN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEI   TYF MARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFLMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKA+NEYKEAKALG+DTVPVL
Sbjct  121  VPELGPNTKFSYSSHKAINEYKEAKALGIDTVPVL  155



>gb|KHG18420.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSS EDLQKVA+ LR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSGEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV+FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVL  155



>gb|KHG25606.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   304 bits (778),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR++IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK+LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKSLGVDTVPVL  155



>gb|KHG01449.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =   304 bits (778),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVL  155



>ref|XP_010521311.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=727

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQK A++LR+SIWKQMA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKAAAELRSSIWKQMADADIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVKFSYASHKAVTEYKEAKALGVDTVPVL  155



>ref|XP_011034320.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Populus euphratica]
 ref|XP_011034321.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Populus euphratica]
Length=765

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFA ESFWDGKSSAEDLQKVA+DLR SIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFASESFWDGKSSAEDLQKVAADLRESIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALGVDT+PVL
Sbjct  121  VPELGPDVNFSYASHKAVAEYKEAKALGVDTIPVL  155



>ref|XP_010908721.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Elaeis guineensis]
Length=766

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVATDLRCSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSFYDQVLDTTAMLGAVPDRYRWNGVEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAV+EYKEAKALG+DTVPVL
Sbjct  121  VPELGPNTKFSYASHKAVSEYKEAKALGIDTVPVL  155



>ref|XP_010909224.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X1 [Elaeis guineensis]
Length=770

 Score =   303 bits (777),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKVA+DLR SIWKQMA AGIKYIP
Sbjct  3    RKMASHIVGYPRMGPKRELKFALESFWDGKTSAQDLQKVAADLRCSIWKQMADAGIKYIP  62

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  63   SNTFSYYDQVLDTTAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYH  122

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            FIVPELGP+ KFSYASHKAV EY EAKALG+DTVPVL
Sbjct  123  FIVPELGPNTKFSYASHKAVAEYNEAKALGIDTVPVL  159



>gb|KJB82415.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
 gb|KJB82417.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
 gb|KJB82420.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=765

 Score =   303 bits (777),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVL  155



>gb|KJB46053.1| hypothetical protein B456_007G346100 [Gossypium raimondii]
Length=655

 Score =   300 bits (769),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR++IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIRFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK+LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKSLGVDTVPVL  155



>ref|XP_009790020.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009790021.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=765

 Score =   303 bits (776),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWT GEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTSGEIGFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVL  155



>ref|NP_001266005.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase-like 
[Cicer arietinum]
 gb|ACL14488.1| methionine synthase [Cicer arietinum]
Length=763

 Score =   303 bits (776),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            M SHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MGSHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGE+GFDTYFSMARGNAT+PAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEVGFDTYFSMARGNATIPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F+YASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFTYASHKAVEEYKEAKALGVDTVPVL  155



>gb|ADO87039.1| pollen allergen MetE [Amaranthus retroflexus]
Length=757

 Score =   303 bits (776),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA  GIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVDTVPVL  155



>ref|XP_010549696.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Tarenaya hassleriana]
Length=765

 Score =   303 bits (776),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGVETVPVL  155



>ref|XP_003522969.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Glycine max]
Length=799

 Score =   304 bits (778),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR++IWKQMA AGI
Sbjct  33   ATSSRAMASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRSAIWKQMADAGI  92

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGN++VPAMEMTKWFD
Sbjct  93   KYIPSNTFSYYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNSSVPAMEMTKWFD  152

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPELGPDVKFSYASHK V+EYKEAK LG++TVPVL
Sbjct  153  TNYHYIVPELGPDVKFSYASHKVVDEYKEAKVLGINTVPVL  193



>gb|KHN41415.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=799

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR++IWKQMA AGI
Sbjct  33   ATSSRAMASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRSAIWKQMADAGI  92

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGN++VPAMEMTKWFD
Sbjct  93   KYIPSNTFSYYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNSSVPAMEMTKWFD  152

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPELGPDVKFSYASHK V+EYKEAK LG++TVPVL
Sbjct  153  TNYHYIVPELGPDVKFSYASHKVVDEYKEAKVLGINTVPVL  193



>ref|XP_004982263.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Setaria italica]
Length=765

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP  KFSYASHKAV+EYKEAKALG+DTVPVL
Sbjct  121  VPELGPSTKFSYASHKAVSEYKEAKALGIDTVPVL  155



>gb|AIE47233.1| vitamin B-12-independent methionine synthase [Pisum sativum]
Length=763

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRASIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F Y+SHKAV EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVNFVYSSHKAVEEYKEAKALGVETVPVL  155



>gb|KJB82418.1| hypothetical protein B456_013G195000 [Gossypium raimondii]
Length=793

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVL  155



>ref|XP_006364490.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Solanum tuberosum]
Length=765

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKS++EDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSNSEDLEKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YF MARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFPMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+EYKEAK+LG+DTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVSEYKEAKSLGIDTVPVL  155



>ref|XP_004228469.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
Length=817

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKS++EDL+KVA+DLR SIWKQMA AGIKYIP
Sbjct  51   RTMASHVVGYPRMGPKRELKFALESFWDGKSNSEDLEKVAADLRLSIWKQMADAGIKYIP  110

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YF MARGNA+VPAMEMTKWFDTNYH
Sbjct  111  SNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFPMARGNASVPAMEMTKWFDTNYH  170

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV+EYKEAK+LG+DTVPVL
Sbjct  171  YIVPELGPDVKFSYASHKAVSEYKEAKSLGIDTVPVL  207



>ref|XP_010528749.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010528750.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=762

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQK A++LR+SIWKQMA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKAAAELRSSIWKQMADADIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVKFSYASHKAVTEYKEAKALGVDTVPVL  155



>ref|XP_010036239.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=768

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRSSIWKQMSHAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKA+ EYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAITEYKEAKALGVDTVPVL  155



>ref|XP_007149180.1| hypothetical protein PHAVU_005G048200g [Phaseolus vulgaris]
 gb|ESW21174.1| hypothetical protein PHAVU_005G048200g [Phaseolus vulgaris]
Length=451

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R MASHIVGYPR+GPKRELKFALESFWDGKSSAE+LQKVA+DLR++I  QMA AG 
Sbjct  32   ATSSRAMASHIVGYPRIGPKRELKFALESFWDGKSSAEELQKVAADLRSAILMQMAEAGT  91

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            KYIPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  92   KYIPSNTFSYYDQVLDTTAMLGAVPARYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFD  151

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPELGPDVKFSY+SHKAV EYKEAK LG++TVPVL
Sbjct  152  TNYHYIVPELGPDVKFSYSSHKAVLEYKEAKVLGINTVPVL  192



>ref|NP_001275416.1| methionine synthase [Solanum tuberosum]
 gb|AAF74983.1|AF082893_1 methionine synthase [Solanum tuberosum]
Length=765

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMSDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEI F TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIEFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEYKEAKA GVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKAQGVDTVPVL  155



>gb|KJB09182.1| hypothetical protein B456_001G128200 [Gossypium raimondii]
Length=547

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M SHIVGYPR+GPKRELKFALESFW+GKSSAE+L++VA+DLR SIWKQMA  GIKYIP
Sbjct  35   RAMTSHIVGYPRIGPKRELKFALESFWEGKSSAEELKQVAADLRFSIWKQMAEVGIKYIP  94

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  95   SNTFSYYDHVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  154

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL
Sbjct  155  YIVPELGPDVKFSYASHKAVEEYKEAKALGLDTVPVL  191



>ref|XP_002276908.2| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Vitis vinifera]
 emb|CBI24392.3| unnamed protein product [Vitis vinifera]
Length=804

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA++LRASIWKQMA AGIKYIP
Sbjct  38   RAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAAELRASIWKQMADAGIKYIP  97

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+V AMEMTKWFDTNYH
Sbjct  98   SNTFSYYDQVLDTTAMLGAVPERYGWNGGEIGFDAYFSMARGNASVTAMEMTKWFDTNYH  157

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            FIVPELGP+VKFSYASHKAVNE+KEAKALG++TVPV+
Sbjct  158  FIVPELGPNVKFSYASHKAVNEFKEAKALGIETVPVI  194



>ref|XP_010236990.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brachypodium distachyon]
Length=765

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMATTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKA+NEYKEAKALG+DTVPVL
Sbjct  121  VPELGPNTKFSYSSHKAINEYKEAKALGIDTVPVL  155



>ref|XP_009591564.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
Length=829

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGK+S+EDL+KVA+DLR+SIWKQMA AG+KYIP
Sbjct  63   RTMASHVVGYPRMGPKRELKFALESFWDGKNSSEDLEKVAADLRSSIWKQMAEAGVKYIP  122

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W G EIGFD YF MARGNA+VPAMEMTKWFDTNYH
Sbjct  123  SNTFSYYDQVLDTTAMLGAVPPRYSWNGSEIGFDVYFPMARGNASVPAMEMTKWFDTNYH  182

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKF YASHKAVNEYKEAK+LGVDTVPVL
Sbjct  183  YIVPELGPDVKFCYASHKAVNEYKEAKSLGVDTVPVL  219



>ref|XP_010463840.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Camelina sativa]
Length=765

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_010485733.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Camelina sativa]
 ref|XP_010485734.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Camelina sativa]
Length=765

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_010266670.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nelumbo nucifera]
Length=765

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQM   GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMDSVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNW GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNWAGGEIGFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAVNEYKEAK LG+DTVPV+
Sbjct  121  VPELGPNTKFSYASHKAVNEYKEAKELGIDTVPVI  155



>ref|XP_010097930.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
 gb|EXB73286.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
Length=765

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPR+GPKRELKFALESFWDGKSSAEDLQKVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRVGPKRELKFALESFWDGKSSAEDLQKVAADLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P++KFSYASHKAV EYKEAKALGV+TVPVL
Sbjct  121  VPELSPEIKFSYASHKAVEEYKEAKALGVETVPVL  155



>gb|EMS51950.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Triticum urartu]
 gb|EMT07372.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Aegilops tauschii]
Length=765

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEI   TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KFSY+SHKA+NEYKEAKALGVDTVPVL
Sbjct  121  VPELAPSTKFSYSSHKAINEYKEAKALGVDTVPVL  155



>sp|P93263.1|METE_MESCR RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Mesembryanthemum crystallinum]
 gb|AAB41896.1| methionine synthase [Mesembryanthemum crystallinum]
Length=765

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY WTGGEI FD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVLEYKEAKALGVDTVPVL  155



>ref|XP_010054791.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Eucalyptus grandis]
 gb|KCW89900.1| hypothetical protein EUGRSUZ_A02126 [Eucalyptus grandis]
Length=765

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWKQMA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMADASIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWKGGEIGHDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVSEYKEAKALGVNTVPVL  155



>emb|CDY38470.1| BnaA10g16880D [Brassica napus]
Length=765

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLRA+IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRANIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_011044091.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
 ref|XP_011044098.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
Length=813

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSAEDLQ VA+DLR+SIWKQM+ AGIK+IP
Sbjct  47   RAMASHVVGYPRMGPKRELKFALESFWDGKSSAEDLQNVAADLRSSIWKQMSDAGIKFIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  SNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP+V FSYASHKAV EYKEAKALGVDTVPVL
Sbjct  167  YIVPELGPEVNFSYASHKAVIEYKEAKALGVDTVPVL  203



>ref|XP_006408262.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 ref|XP_006408263.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 ref|XP_006408264.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49715.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49716.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49717.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
Length=652

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>ref|NP_001288585.1| LOC541714 [Zea mays]
 ref|XP_008644635.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Zea mays]
 gb|ACL54117.1| unknown [Zea mays]
 gb|AFW68108.1| putative methionine synthase family protein isoform 1 [Zea mays]
 gb|AFW68109.1| putative methionine synthase family protein isoform 2 [Zea mays]
Length=765

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP  KF+YASHKAV+EYKEAKALG+DTVPVL
Sbjct  121  VPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVL  155



>ref|XP_010038792.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=325

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MAS IVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DL++SIWKQMA AGIKYIPSN
Sbjct  1    MASRIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLKSSIWKQMANAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMA+GNA+VPAMEMTKWFDTNYH+ 
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYRWNGGEIGFDVYFSMAKGNASVPAMEMTKWFDTNYHYT  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FS+AS KAVNEYK+AK LGVDTVPVL
Sbjct  121  VPELGPDVNFSFASPKAVNEYKDAKRLGVDTVPVL  155



>ref|XP_006479149.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X1 [Citrus sinensis]
Length=795

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +3

Query  93   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPS  272
            KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPS
Sbjct  3    KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPS  62

Query  273  NTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHF  452
            NTFS YDQVLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNA+V AMEMTKWFDTNYHF
Sbjct  63   NTFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHF  122

Query  453  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            IVPELGPDVKFSYASHKAV EYKEAK  GV+TVPVL
Sbjct  123  IVPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVL  158



>gb|KDO66311.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=595

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALG++TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVL  155



>sp|Q42699.1|METE_CATRO RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Catharanthus roseus]
 emb|CAA58474.1| methionine synthase [Catharanthus roseus]
Length=765

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT  MLGAVPPRYN+ GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTATMLGAVPPRYNFAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAK LGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKELGVDTVPVL  155



>ref|XP_006470414.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Citrus sinensis]
Length=811

 Score =   303 bits (775),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  63   QCFLASTP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQM  242
            +C    T  R MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIWKQM
Sbjct  36   RCSFRRTRFRAMASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWKQM  95

Query  243  AGAGIKYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEM  422
            A AGIK+IPS+TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEM
Sbjct  96   ADAGIKFIPSSTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEM  155

Query  423  TKWFDTNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TKWFDTNYH+IVPELGPDV FSYASHKAV EYKEAKALG++TVPVL
Sbjct  156  TKWFDTNYHYIVPELGPDVNFSYASHKAVQEYKEAKALGMETVPVL  201



>ref|NP_001152513.1| LOC100286153 [Zea mays]
 gb|ACG47988.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Zea mays]
 tpg|DAA50626.1| TPA: putative methionine synthase family protein isoform 1 [Zea 
mays]
 tpg|DAA50627.1| TPA: putative methionine synthase family protein isoform 2 [Zea 
mays]
 tpg|DAA50628.1| TPA: putative methionine synthase family protein isoform 3 [Zea 
mays]
Length=765

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVASDLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLEKVASDLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP  KF+YASHKAV+EYKEAKALG+DTVPVL
Sbjct  121  VPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVL  155



>ref|XP_010932648.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Elaeis guineensis]
Length=766

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRFSIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W+G EIGFDTYFSMARGNA VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPQRYGWSGAEIGFDTYFSMARGNALVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL PD KF+YASHKAV+EYKEAKALG+DTVPVL
Sbjct  121  VPELAPDTKFTYASHKAVSEYKEAKALGIDTVPVL  155



>gb|KJB46054.1| hypothetical protein B456_007G346100 [Gossypium raimondii]
Length=765

 Score =   301 bits (771),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLR++IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD T+MLGAVPPRY W GGEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATSMLGAVPPRYGWNGGEIRFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV+EYKEAK+LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVDEYKEAKSLGVDTVPVL  155



>gb|AFW68110.1| putative methionine synthase family protein [Zea mays]
Length=812

 Score =   302 bits (774),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +3

Query  93   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPS  272
            +MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIKYIPS
Sbjct  47   RMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPS  106

Query  273  NTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHF  452
            NTFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHF
Sbjct  107  NTFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHF  166

Query  453  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            IVPELGP  KF+YASHKAV+EYKEAKALG+DTVPVL
Sbjct  167  IVPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVL  202



>ref|XP_004249374.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
 ref|XP_010312196.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
Length=765

 Score =   301 bits (771),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQM   GIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMCDTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWTGGEI F TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTGGEIEFATYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEYKEAKA GVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKAQGVDTVPVL  155



>ref|XP_008778395.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
 ref|XP_008778396.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=766

 Score =   301 bits (771),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR SIWKQMAGAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLQKVAADLRCSIWKQMAGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT+AMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTSAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAV EYK+AKALG+DTVPV+
Sbjct  121  VPELGPNTKFSYASHKAVAEYKDAKALGIDTVPVI  155



>ref|XP_003624677.1| Methionine synthase [Medicago truncatula]
 gb|AES80895.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=803

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  81   TP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIK  260
            TP  KMASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KV++DLRASIWKQM+  GIK
Sbjct  36   TPQEKMASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIK  95

Query  261  YIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDT  440
            YIPSNTF+ YD VLDTTA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDT
Sbjct  96   YIPSNTFTYYDHVLDTTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDT  155

Query  441  NYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            NYHFIVPELGP+V F Y+SHKAV EYKEAKALGVDTVPVL
Sbjct  156  NYHFIVPELGPEVNFVYSSHKAVEEYKEAKALGVDTVPVL  195



>ref|XP_011090233.1| PREDICTED: LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Sesamum indicum]
Length=811

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPR+GPKRELKFALESFWDGKSSAE+LQKVA+ LR SIWKQMA AGIKYIP
Sbjct  39   RSMASHIVGYPRVGPKRELKFALESFWDGKSSAEELQKVAAGLRVSIWKQMADAGIKYIP  98

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  99   SNTFSYYDQVLDTTAMLGAVPSRYGWGGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYH  158

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL
Sbjct  159  YIVPELGPDVKFSYASHKAVQEYKEAKALGIDTVPVL  195



>ref|XP_006826346.1| hypothetical protein AMTR_s00004p00117110 [Amborella trichopoda]
 gb|ERM93583.1| hypothetical protein AMTR_s00004p00117110 [Amborella trichopoda]
Length=765

 Score =   301 bits (770),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS A DL+KVA DL+A+IWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSGAHDLEKVAKDLKAAIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNA++PAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAKALGV+TVPV+
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVI  155



>ref|XP_010514202.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Camelina sativa]
Length=765

 Score =   301 bits (770),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_002313635.2| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 ref|XP_006379333.1| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 gb|EEE87590.2| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 gb|ERP57130.1| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
Length=813

 Score =   301 bits (772),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSAEDLQ VA++LR+SIWKQM+ AGIK+IP
Sbjct  47   RAMASHVVGYPRMGPKRELKFALESFWDGKSSAEDLQNVAAELRSSIWKQMSDAGIKFIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  SNTFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP+V FSYASHKAV EYKEAKALGVDTVPVL
Sbjct  167  YIVPELGPEVNFSYASHKAVIEYKEAKALGVDTVPVL  203



>ref|XP_008464953.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis melo]
Length=765

 Score =   301 bits (770),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP++KFSYASHKAV EYKEAKALGV+TVPVL
Sbjct  121  VPELGPEMKFSYASHKAVEEYKEAKALGVETVPVL  155



>ref|XP_002882307.1| hypothetical protein ARALYDRAFT_477628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58566.1| hypothetical protein ARALYDRAFT_477628 [Arabidopsis lyrata subsp. 
lyrata]
Length=765

 Score =   300 bits (769),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>emb|CAJ01714.1| methionine synthase 2 enzyme [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   300 bits (769),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVL  155



>dbj|BAJ88127.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   300 bits (769),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVL  155



>emb|CAN70498.1| hypothetical protein VITISV_028551 [Vitis vinifera]
Length=765

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA DLQKVA++LRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAXDLQKVATELRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYGWNGGEIGFDAYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNE+KEAK+LG++TVPV+
Sbjct  121  VPELGPNVKFSYASHKAVNEFKEAKSLGIETVPVI  155



>gb|EMS50887.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Triticum urartu]
Length=740

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVL  155



>emb|CAE55863.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
Length=765

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_010677810.1| PREDICTED: LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Beta vulgaris subsp. 
vulgaris]
Length=794

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLR+SIWKQM+ AGIKYIPSNTF+
Sbjct  13   HIVGYPRMGPKRELKFALESFWDGKSSADDLKKVSADLRSSIWKQMSDAGIKYIPSNTFA  72

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVPPRY WTGGEI FD YFSMARGNATVPAMEMTKWFDTNYH+IVPE
Sbjct  73   YYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNATVPAMEMTKWFDTNYHYIVPE  132

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  133  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  164



>gb|AAN31836.1| putative 5-methyltetrahydropteroyltriglutamate--homocysteine 
S-methyltransferase [Arabidopsis thaliana]
Length=765

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|NP_197294.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 ref|NP_001078599.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 sp|O50008.1|METE1_ARATH RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1; AltName: Full=Cobalamin-independent 
methionine synthase 1; Short=AtMS1; AltName: Full=Vitamin-B12-independent 
methionine synthase 1 [Arabidopsis thaliana]
 gb|AAK43899.1|AF370522_1 cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AAC50037.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 dbj|BAB11226.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AAK82464.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL06986.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL09740.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL47432.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL50108.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAM10291.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AED92486.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 gb|AED92487.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
Length=765

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|AAL09712.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
Length=765

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_002871787.1| cobalamin-independent methionine synthase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48046.1| cobalamin-independent methionine synthase [Arabidopsis lyrata 
subsp. lyrata]
Length=765

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_010553797.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010553799.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DLR+SIWK+MA A IKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKRMADAEIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV EYKEA ALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVTEYKEAMALGVETVPVL  155



>dbj|BAP47510.1| methionine synthase [Gentiana triflora]
Length=765

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA++LRASIWKQM+GAGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVATELRASIWKQMSGAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDT  MLGAVPPRYN+ GGEIG D YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTVTMLGAVPPRYNFNGGEIGHDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSY+SHKAVNEYKEAK LG+DTVPVL
Sbjct  121  VPELGPEVNFSYSSHKAVNEYKEAKELGIDTVPVL  155



>gb|ABI95860.1| methionine synthase [Nicotiana suaveolens]
Length=765

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV++DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYNWT GEIGFDTYF MARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYNWTRGEIGFDTYFFMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAV+EYKE K LGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVDEYKEGKGLGVDTVPVL  155



>gb|KJB09183.1| hypothetical protein B456_001G128200 [Gossypium raimondii]
Length=629

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M SHIVGYPR+GPKRELKFALESFW+GKSSAE+L++VA+DLR SIWKQMA  GIKYIP
Sbjct  35   RAMTSHIVGYPRIGPKRELKFALESFWEGKSSAEELKQVAADLRFSIWKQMAEVGIKYIP  94

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  95   SNTFSYYDHVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  154

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL
Sbjct  155  YIVPELGPDVKFSYASHKAVEEYKEAKALGLDTVPVL  191



>gb|KCW47764.1| hypothetical protein EUGRSUZ_K01513 [Eucalyptus grandis]
Length=463

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MAS IVGYPRMGPKRELKFALESFWDGKSSAEDLQKVA+DL++SIWKQMA AGIKYIPSN
Sbjct  1    MASRIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLKSSIWKQMANAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMA+GNA+VPAMEMTKWFDTNYH+ 
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYRWNGGEIGFDVYFSMAKGNASVPAMEMTKWFDTNYHYT  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FS+AS KAVNEYK+AK LGVDTVPVL
Sbjct  121  VPELGPDVNFSFASPKAVNEYKDAKRLGVDTVPVL  155



>dbj|BAE07181.1| methionine synthase [Beta vulgaris]
Length=794

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLR+SIWKQM+ AGIKYIPSNTF+
Sbjct  13   HIVGYPRMGPKRELKFALESFWDGKSSADDLKKVSADLRSSIWKQMSDAGIKYIPSNTFA  72

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVPPRY WTGGEI FD YFSMARGNATVPAMEMTKWFDTNYH+IVPE
Sbjct  73   YYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNATVPAMEMTKWFDTNYHYIVPE  132

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  133  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  164



>ref|XP_010541663.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Tarenaya hassleriana]
Length=859

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGKSSA++LQKVA+DLRASIWKQMA AGIKYIP
Sbjct  93   RTMSSHIVGYPRIGPKRELKFALESFWDGKSSADELQKVAADLRASIWKQMAEAGIKYIP  152

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGE+GFD YFSMARGNA+ PAMEMTKWFDTNYH
Sbjct  153  SNTFSYYDQVLDTTAMLGAVPPRYDWEGGEVGFDIYFSMARGNASAPAMEMTKWFDTNYH  212

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV+E+ EAKALG+DT+PVL
Sbjct  213  YIVPELGPDVKFSYASHKAVSEFMEAKALGIDTIPVL  249



>ref|XP_006443474.1| hypothetical protein CICLE_v10018921mg [Citrus clementina]
 gb|ESR56714.1| hypothetical protein CICLE_v10018921mg [Citrus clementina]
Length=792

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLR+SIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNA+V AMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV EYKEAK  GV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVL  155



>ref|XP_006408261.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 dbj|BAJ33898.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49714.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
Length=765

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>ref|XP_010917850.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Elaeis guineensis]
Length=803

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            RKMASH+VGYPRMGPKRELKFALESFWDGKSSA DLQKV+ DLR SIWKQM+ AG+KYIP
Sbjct  36   RKMASHVVGYPRMGPKRELKFALESFWDGKSSAADLQKVSQDLRCSIWKQMSDAGVKYIP  95

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLD TAMLGAVP RY W+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  96   SNTFSYYDQVLDATAMLGAVPQRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH  155

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPEL PD KF+YASHKAV+EYKEAKALG+DTVPVL
Sbjct  156  YIVPELAPDTKFTYASHKAVSEYKEAKALGIDTVPVL  192



>ref|XP_010909225.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X2 [Elaeis guineensis]
Length=766

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTSAQDLQKVAADLRCSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W G EIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSYASHKAV EY EAKALG+DTVPVL
Sbjct  121  VPELGPNTKFSYASHKAVAEYNEAKALGIDTVPVL  155



>ref|XP_002276438.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Vitis vinifera]
Length=765

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLRASIWKQMA AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRASIWKQMADAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEI FD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV EY+EAKALGVDTVPV 
Sbjct  121  VPELGPEVKFSYASHKAVKEYQEAKALGVDTVPVF  155



>emb|CDY25477.1| BnaC09g39920D [Brassica napus]
Length=765

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|AES80897.2| cobalamin-independent methionine synthase [Medicago truncatula]
Length=650

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KV++DLRASIWKQM+  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YD VLDTTA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFTYYDHVLDTTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V F Y+SHKAV EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFVYSSHKAVEEYKEAKALGVDTVPVL  155



>emb|CAN73135.1| hypothetical protein VITISV_018473 [Vitis vinifera]
Length=734

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVA+DLRASIWKQMA AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRASIWKQMADAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEI FD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV EY+EAKALGVDTVPV 
Sbjct  121  VPELGPEVKFSYASHKAVKEYQEAKALGVDTVPVF  155



>ref|XP_009774960.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=830

 Score =   301 bits (770),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSS+EDL+KVA+DLR+SIWKQMA  GIKYIP
Sbjct  64   RTMASHVVGYPRMGPKRELKFALESFWDGKSSSEDLEKVAADLRSSIWKQMAEGGIKYIP  123

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YF MARGN +VPAMEMTKWFDTNYH
Sbjct  124  SNTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFPMARGNDSVPAMEMTKWFDTNYH  183

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKF YA HKAVNEYKEAK+LGVDTVPVL
Sbjct  184  YIVPELGPDVKFCYAYHKAVNEYKEAKSLGVDTVPVL  220



>gb|KDP42919.1| hypothetical protein JCGZ_23861 [Jatropha curcas]
Length=765

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKVA+DLR+SIWKQMA + IK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWKQMADSDIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV+EYKEAKALG++TVPV+
Sbjct  121  VPELGPEVKFSYASHKAVDEYKEAKALGIETVPVI  155



>ref|XP_009121037.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brassica rapa]
Length=765

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_006446418.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
 gb|ESR59658.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
Length=836

 Score =   300 bits (769),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IP
Sbjct  70   RAMASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIP  129

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  130  SNTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  189

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV FSYASHKAV EYKEAKALG++TVPVL
Sbjct  190  YIVPELGPDVNFSYASHKAVQEYKEAKALGMETVPVL  226



>dbj|BAJ87953.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KFSYASH+AV+EYKEAKALGVDTVPVL
Sbjct  121  VPELSPATKFSYASHEAVSEYKEAKALGVDTVPVL  155



>ref|XP_004141126.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 ref|XP_004158333.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 gb|KGN59730.1| hypothetical protein Csa_3G842030 [Cucumis sativus]
Length=765

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA  GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADTGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LD T  LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDATTTLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAV EYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVEEYKEAKALGVETVPVL  155



>ref|XP_009398996.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Musa acuminata subsp. malaccensis]
Length=766

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVATDLRCSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYN+TG EIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNYTGAEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KF+Y+SHKA++EYKEAKALG++TVPVL
Sbjct  121  VPELGPNTKFTYSSHKALSEYKEAKALGIETVPVL  155



>ref|XP_003525709.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Glycine max]
 ref|XP_006579821.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Glycine max]
 gb|KHN36957.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=765

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFW+GKSSA+DLQKVA+DLRASIWKQM  AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWEGKSSADDLQKVAADLRASIWKQMTDAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVPPRY    GEI FDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQMLDTTAMLGAVPPRYGLNNGEIEFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F+YASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFTYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_003550102.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Glycine max]
Length=765

 Score =   298 bits (764),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVA DLRASIWKQM  AGIKYIP+N
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVAFDLRASIWKQMIDAGIKYIPNN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY W   EIGFDT+FSMARGNA+VP MEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYGWNSEEIGFDTFFSMARGNASVPTMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|EMT31101.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Aegilops tauschii]
Length=766

 Score =   298 bits (764),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFS+ARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSIARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVL  155



>dbj|BAJ89541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLRASIWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY+WTGGEIG  TYFSMARGNA VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNAAVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KFSYASHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVL  155



>ref|XP_010524993.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPSRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPDVKFSYASHKAVDEYKEAKALGVETVPVL  155



>gb|KDO66309.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=765

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALG++TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVL  155



>ref|XP_010558700.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010558701.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010558702.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQM+ AGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSY+SHKAV+EYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVTFSYSSHKAVDEYKEAKALGVETVPVL  155



>ref|XP_007161979.1| hypothetical protein PHAVU_001G113800g [Phaseolus vulgaris]
 gb|ESW33973.1| hypothetical protein PHAVU_001G113800g [Phaseolus vulgaris]
Length=763

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AE LQ VA+ LRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEALQLVAAGLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F+YASHKAV EYKEAKALGV+T+PVL
Sbjct  121  VPELGPDVNFTYASHKAVEEYKEAKALGVETIPVL  155



>emb|CDX74207.1| BnaA03g28400D [Brassica napus]
Length=765

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK++AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>ref|XP_009126216.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brassica rapa]
Length=765

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVL  155



>emb|CDX85436.1| BnaA02g03770D [Brassica napus]
Length=765

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVL  155



>ref|XP_006446419.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
 gb|ESR59659.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
Length=864

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IP
Sbjct  70   RAMASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIP  129

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  130  SNTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  189

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV FSYASHKAV EYKEAKALG++TVPVL
Sbjct  190  YIVPELGPDVNFSYASHKAVQEYKEAKALGMETVPVL  226



>emb|CDX92051.1| BnaC03g33530D [Brassica napus]
Length=765

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK++AEDL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>ref|XP_009398356.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Musa acuminata subsp. malaccensis]
Length=766

 Score =   298 bits (763),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+A+DLQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTADDLQKVATDLRHSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYN+TGGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNFTGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHK V+EYKEAKALG++TVPVL
Sbjct  121  VPELGPNTKFSYSSHKPVSEYKEAKALGIETVPVL  155



>emb|CDY02674.1| BnaC02g07610D [Brassica napus]
Length=765

 Score =   298 bits (763),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVL  155



>ref|XP_006400336.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 ref|XP_006400337.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 gb|ESQ41789.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 gb|ESQ41790.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
Length=765

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>emb|CDX70785.1| BnaC03g08690D [Brassica napus]
Length=765

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_006286451.1| hypothetical protein CARUB_v10000282mg [Capsella rubella]
 gb|EOA19349.1| hypothetical protein CARUB_v10000282mg [Capsella rubella]
Length=765

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|KDO66310.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=793

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ VA+DLRASIW QMA AGIK+IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYASHKAV EYKEAKALG++TVPVL
Sbjct  121  VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVL  155



>ref|XP_009408488.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Musa acuminata subsp. malaccensis]
Length=766

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KSSA+DLQKVA+DLR SIWKQMAGAGIK+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSSADDLQKVATDLRHSIWKQMAGAGIKHIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RYN+TGGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPERYNFTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP  KFSY+SHK V+EYKEAK+LG++TVPVL
Sbjct  121  VPELGPTTKFSYSSHKPVSEYKEAKSLGIETVPVL  155



>ref|NP_187028.1| methionine synthase 2 [Arabidopsis thaliana]
 ref|NP_850507.1| methionine synthase 2 [Arabidopsis thaliana]
 ref|NP_001118564.1| methionine synthase 2 [Arabidopsis thaliana]
 sp|Q9SRV5.1|METE2_ARATH RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2; AltName: Full=Cobalamin-independent 
methionine synthase 2; Short=AtMS2 [Arabidopsis thaliana]
 gb|AAF00639.1|AC009540_16 putative methionine synthase [Arabidopsis thaliana]
 gb|AAM61126.1| putative methionine synthase [Arabidopsis thaliana]
 gb|AAN12930.1| putative methionine synthase [Arabidopsis thaliana]
 emb|CAE55864.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AEE73989.1| methionine synthase 2 [Arabidopsis thaliana]
 gb|AEE73990.1| methionine synthase 2 [Arabidopsis thaliana]
 gb|AEE73991.1| methionine synthase 2 [Arabidopsis thaliana]
Length=765

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVP RY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>gb|AAK64167.1| putative methionine synthase [Arabidopsis thaliana]
Length=765

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVP RY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>ref|XP_004502016.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cicer arietinum]
Length=806

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R M SHIVGYPR+GPKRELKFALESFWDGKSSA++L+KVA+DLR++IWKQMA AGI
Sbjct  36   ATSSRAMTSHIVGYPRVGPKRELKFALESFWDGKSSADELKKVAADLRSAIWKQMAEAGI  95

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            ++IPSNTFS YDQVLDTTAMLGAVP RYNW GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  96   QHIPSNTFSYYDQVLDTTAMLGAVPDRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFD  155

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYHFIVPELGPDVKFSYASHKAV+EY EAKALGV+TVPVL
Sbjct  156  TNYHFIVPELGPDVKFSYASHKAVDEYNEAKALGVNTVPVL  196



>ref|XP_009398511.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Musa acuminata subsp. malaccensis]
Length=766

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRE+KFALESFWDGKSSA+DLQKVA+DLR SIWKQM   GIKYIPSN
Sbjct  1    MASHIVGYPRMGPKREIKFALESFWDGKSSADDLQKVATDLRCSIWKQMTDVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TAMLGAVP RYN+TGGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATAMLGAVPERYNYTGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+ KFSY+SHKAV+EYKEAKALG++T+PVL
Sbjct  121  VPELGPNTKFSYSSHKAVSEYKEAKALGIETIPVL  155



>gb|AGV54391.1| 5-methyltetrahydropteroyltriglutamate homocysteine methyltransferase 
like isoform 1 [Phaseolus vulgaris]
Length=763

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AE LQ VA+ LRASIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEALQLVAAGLRASIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD TA LGAVPPRY WTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV F+YASHKAV EYKEAKALGV+T+PVL
Sbjct  121  VPELGPDVNFTYASHKAVEEYKEAKALGVETIPVL  155



>ref|XP_010420526.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Camelina sativa]
Length=765

 Score =   296 bits (758),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSA++LQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSADNLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YDQVLDTTAMLGAVPPRY +T GEIG D +FSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V F+YASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFTYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_006297040.1| hypothetical protein CARUB_v10013032mg [Capsella rubella]
 gb|EOA29938.1| hypothetical protein CARUB_v10013032mg [Capsella rubella]
Length=765

 Score =   296 bits (758),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKTSADDLQKVSADLRSDIWKQMSSAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS+YD VLDTTAM+GAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSHYDHVLDTTAMIGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALGV+TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVL  155



>gb|KJB09184.1| hypothetical protein B456_001G128200 [Gossypium raimondii]
Length=801

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M SHIVGYPR+GPKRELKFALESFW+GKSSAE+L++VA+DLR SIWKQMA  GIKYIP
Sbjct  35   RAMTSHIVGYPRIGPKRELKFALESFWEGKSSAEELKQVAADLRFSIWKQMAEVGIKYIP  94

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  95   SNTFSYYDHVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  154

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV EYKEAKALG+DTVPVL
Sbjct  155  YIVPELGPDVKFSYASHKAVEEYKEAKALGLDTVPVL  191



>ref|XP_009134741.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Brassica rapa]
Length=765

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+A+DL+KV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTADDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKFSYASHKAVNEYKEAKALG +TVPVL
Sbjct  121  VPELGPEVKFSYASHKAVNEYKEAKALGAETVPVL  155



>ref|XP_008789650.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=766

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKR+LKFALESFWDGKSSA+DLQKVA DLR SIWKQM+ AG+KYIPSN
Sbjct  1    MASHVVGYPRMGPKRQLKFALESFWDGKSSADDLQKVAQDLRCSIWKQMSDAGVKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W+GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61   TFSYYDQVLDTTAMLGAVPQRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL P  KF+YASHKAV+EYKEAKALG+DT+PVL
Sbjct  121  VPELSPVSKFTYASHKAVSEYKEAKALGIDTIPVL  155



>emb|CDY50662.1| BnaC05g48040D [Brassica napus]
Length=753

 Score =   295 bits (756),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR+ IWKQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSDIWKQMSSAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VK SY+SHKAVNEYKE KALGV+TVPVL
Sbjct  121  VPELGPEVKLSYSSHKAVNEYKETKALGVETVPVL  155



>gb|ACO34814.1| Sal k 3 pollen allergen [Salsola kali]
Length=757

 Score =   295 bits (756),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KVA+DLR+SIWKQMA AGIKYIPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF+ YDQVLDTTAMLGAVP RY + GGEIGFD YFSMARGNA++PAMEMTKWFDTNYH+I
Sbjct  61   TFAYYDQVLDTTAMLGAVPARYGFNGGEIGFDLYFSMARGNASLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+VKF+Y+SHKAV+EYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVKFAYSSHKAVDEYKEAKALGVDTVPVL  155



>ref|XP_008807626.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Phoenix dactylifera]
Length=766

 Score =   295 bits (756),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPR+GPKRELKFALESFWDGKSSA++LQKVA+DLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHIVGYPRIGPKRELKFALESFWDGKSSADNLQKVAADLRRSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQ+LDTTAMLGAVP RY W+GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSCYDQMLDTTAMLGAVPQRYGWSGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPEL PD KF+YASHKAV+EYKEAKALG+DTVPVL
Sbjct  121  VPELAPDSKFTYASHKAVSEYKEAKALGIDTVPVL  155



>ref|XP_009131623.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brassica rapa]
Length=765

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>ref|XP_010492770.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Camelina sativa]
Length=765

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKV++DLR++IWKQM+ AG K+IPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKFIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +T GEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V F+YASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFTYASHKAVNEYKEAKALGVDTVPVL  155



>emb|CDX78767.1| BnaA03g06790D [Brassica napus]
Length=765

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWD KS+AEDLQKV++D+R+ IWKQM+ AG KYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDKKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TF++YDQVLDTTAMLGAVPPRY +TGGEIG D YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  121  VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|EPS74353.1| methionine synthase [Genlisea aurea]
Length=829

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            H+VGYPR+GPKRELKFALESFWDGKS+AE+L+KVA+DLRASIWKQM+ AGIKYIPSNTFS
Sbjct  60   HVVGYPRIGPKRELKFALESFWDGKSTAEELEKVAADLRASIWKQMSDAGIKYIPSNTFS  119

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVPPRY WTGGEIGF TYFSMARGNA+ PAMEMTKWFDTNYHFIVPE
Sbjct  120  FYDQVLDTTAMLGAVPPRYGWTGGEIGFGTYFSMARGNASAPAMEMTKWFDTNYHFIVPE  179

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            LGPDVKFSYASHKAV+EY+EAKALGV+TVPVL
Sbjct  180  LGPDVKFSYASHKAVDEYQEAKALGVETVPVL  211



>emb|CAA89019.1| cobalamine-independent methionine synthase [Solenostemon scutellarioides]
Length=784

 Score =   293 bits (751),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 145/156 (93%), Gaps = 1/156 (1%)
 Frame = +3

Query  93   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPS  272
            KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+K    L   + KQM+ AGIKYIPS
Sbjct  20   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKCQLILGIHL-KQMSDAGIKYIPS  78

Query  273  NTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHF  452
            NTFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHF
Sbjct  79   NTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHF  138

Query  453  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  139  IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  174



>ref|XP_008359231.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
Length=439

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R +ASHIVG PRMGPKRELKF+LESFWDGKSSAE+LQK A+ LR+SIWKQ+A AGI
Sbjct  51   TTSTRAVASHIVGLPRMGPKRELKFSLESFWDGKSSAEELQKAAAGLRSSIWKQLADAGI  110

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            +YIPSNTFS YDQ+LDTTAMLGAVPPRY W   EIGF+TYFSMARGNA VPAMEMTKWFD
Sbjct  111  QYIPSNTFSYYDQMLDTTAMLGAVPPRYGWKHSEIGFETYFSMARGNANVPAMEMTKWFD  170

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPELGP ++FSYASHKAV+E+KEAKALGVDT+PVL
Sbjct  171  TNYHYIVPELGPHIRFSYASHKAVDEFKEAKALGVDTIPVL  211



>ref|XP_006400670.1| hypothetical protein EUTSA_v10012712mg [Eutrema salsugineum]
 gb|ESQ42123.1| hypothetical protein EUTSA_v10012712mg [Eutrema salsugineum]
Length=812

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AE+LQ VA++LR SIWK MA AGIKYIP
Sbjct  47   RAMSSHIVGYPRIGPKRELKFALESFWDGKTGAEELQNVAANLRNSIWKHMADAGIKYIP  106

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVPPRY W  GEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  107  SNTFSYYDQMLDTTAMLGAVPPRYGWESGEIGFDIYFSMARGNASVPAMEMTKWFDTNYH  166

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV+E+KEAKALG+DTVPVL
Sbjct  167  YIVPELGPDVKFSYASHKAVDEFKEAKALGIDTVPVL  203



>ref|XP_008451024.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis melo]
Length=829

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            ST  R MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKVA+DLR+SIWKQMA AGI
Sbjct  59   STVVRAMASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMADAGI  118

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            K+IPSNTFS YDQVLDT  MLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  119  KFIPSNTFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKWFD  178

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPEL P+ KF+YASHKAVNE+KEAKALGV+TVPVL
Sbjct  179  TNYHYIVPELSPEDKFTYASHKAVNEFKEAKALGVETVPVL  219



>ref|XP_004144074.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform 1 [Cucumis sativus]
 gb|KGN66367.1| hypothetical protein Csa_1G599580 [Cucumis sativus]
Length=827

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            ST  R MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKVA+DLR+SIWKQMA AGI
Sbjct  57   STVVRAMASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMAEAGI  116

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            K+IPSNTFS YDQVLDT  MLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFD
Sbjct  117  KFIPSNTFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKWFD  176

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPEL P+ KF+YASHKAVNE+KEAKALGV+TVPVL
Sbjct  177  TNYHYIVPELSPEDKFTYASHKAVNEFKEAKALGVETVPVL  217



>sp|Q42662.2|METE_PLESU RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Solenostemon scutellarioides]
Length=764

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+K    L   + KQM+ AGIKYIPSN
Sbjct  1    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKCQLILGIHL-KQMSDAGIKYIPSN  59

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRYNWTGGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  60   TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  119

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  120  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  154



>gb|KFK26314.1| hypothetical protein AALP_AA8G231500 [Arabis alpina]
Length=837

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S E+LQ VA++LR SIWK M+ AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVEELQNVAANLRKSIWKHMSDAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNATVPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDNYFSMARGNATVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDVKFSYASHKAV E+KEAKALG+DTVPVL
Sbjct  166  YIVPELGPDVKFSYASHKAVVEFKEAKALGIDTVPVL  202



>emb|CDX88830.1| BnaA03g08190D [Brassica napus]
Length=815

 Score =   291 bits (745),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK++A+DLQ VA++LR SIWK MA AGIKYIP
Sbjct  50   RAMSSHIVGYPRIGPKRELKFALESFWDGKTAADDLQTVAANLRNSIWKHMADAGIKYIP  109

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVPPRY W  GEIGFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  110  SNTFSYYDQMLDTTAMLGAVPPRYGWKSGEIGFDVYFSMARGNESVPAMEMTKWFDTNYH  169

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV+E+KEAKALG+DTVPVL
Sbjct  170  YIVPELGPDVEFSYASHKAVDEFKEAKALGIDTVPVL  206



>ref|XP_010685496.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Beta vulgaris subsp. vulgaris]
Length=817

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASHIVGYPRMGPKRELKFALESFWDGK +AE+LQ VA  LR SIWKQM+ AGIKYIP
Sbjct  51   RTMASHIVGYPRMGPKRELKFALESFWDGKINAEELQNVAHSLRTSIWKQMSDAGIKYIP  110

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQVLDTTAMLGAVPPRY W GGEIG D YFSMARGNA VPAMEMTKWFDTNYH
Sbjct  111  SNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGNDVYFSMARGNADVPAMEMTKWFDTNYH  170

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPD+KF+YASHKAV+EYKEAKALGV+TVPV+
Sbjct  171  YIVPELGPDMKFTYASHKAVDEYKEAKALGVETVPVI  207



>ref|XP_006842129.1| hypothetical protein AMTR_s00078p00112410 [Amborella trichopoda]
 gb|ERN03804.1| hypothetical protein AMTR_s00078p00112410 [Amborella trichopoda]
Length=804

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R MASH+VGYPR+GPKRELKFALESFWDG+SSAEDLQKVA +LR S+WKQM+  GIKYIP
Sbjct  37   RSMASHVVGYPRIGPKRELKFALESFWDGRSSAEDLQKVAKELRHSMWKQMSDVGIKYIP  96

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
             NTFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNAT+PAMEMTKWFDTNYH
Sbjct  97   CNTFSYYDHVLDTTAMLGAVPPRYGWMGGEIGFDVYFSMARGNATLPAMEMTKWFDTNYH  156

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            ++VPELGPD+KFSY+SHKAV+EYKEAK LG +TVPVL
Sbjct  157  YLVPELGPDIKFSYSSHKAVSEYKEAKELGFETVPVL  193



>ref|XP_003592244.1| Methionine synthase [Medicago truncatula]
Length=765

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSAE+L++VA++LR++IWKQMA AGI++IPSNTFS
Sbjct  52   HIVGYPRMGPKRELKFALESFWDGKSSAEELKQVAANLRSAIWKQMADAGIQHIPSNTFS  111

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFIVPE
Sbjct  112  YYDQVLDTTAMLGAVPDRYKWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFIVPE  171

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            LGPDVKFSYASHKAV+EY EAKALGV+TVPVL
Sbjct  172  LGPDVKFSYASHKAVDEYNEAKALGVNTVPVL  203



>ref|XP_008385717.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
Length=466

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R +ASHIVG PR GPKRELKF+LESFWDGKSSAE+LQK A+ LR+SIWKQ+A AGI
Sbjct  35   TTSTRAVASHIVGLPRXGPKRELKFSLESFWDGKSSAEELQKAAAGLRSSIWKQLADAGI  94

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            +YIPSNTFS YDQ+LDTTAMLGAVPPRY W   EIGF+TYFSMARGNA VPAMEMTKWFD
Sbjct  95   QYIPSNTFSYYDQMLDTTAMLGAVPPRYGWKHSEIGFETYFSMARGNANVPAMEMTKWFD  154

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPELGP ++FSYASHKAV+E+KEAKALGVDT+PVL
Sbjct  155  TNYHYIVPELGPHIRFSYASHKAVDEFKEAKALGVDTIPVL  195



>ref|XP_010493215.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like [Camelina sativa]
Length=811

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DTVPVL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVL  202



>ref|XP_006286361.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 ref|XP_006286362.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 gb|EOA19259.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 gb|EOA19260.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
Length=814

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  49   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  108

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  109  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  168

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DTVPVL
Sbjct  169  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVL  205



>ref|XP_003601341.1| Methionine synthase [Medicago truncatula]
 gb|AES71592.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=813

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +3

Query  105  HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNTFS  284
            HIVGYPRMGPKRELKFALESFWDGKSSAE+L++VA++LR++IWKQMA AGI++IPSNTFS
Sbjct  52   HIVGYPRMGPKRELKFALESFWDGKSSAEELKQVAANLRSAIWKQMADAGIQHIPSNTFS  111

Query  285  NYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPE  464
             YDQVLDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYHFIVPE
Sbjct  112  YYDQVLDTTAMLGAVPDRYKWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFIVPE  171

Query  465  LGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            LGPDVKFSYASHKAV+EY EAKALGV+TVPVL
Sbjct  172  LGPDVKFSYASHKAVDEYNEAKALGVNTVPVL  203



>gb|ABR17712.1| unknown [Picea sitchensis]
Length=766

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA DL+ VA  LRASIWKQM  AG+K IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAADLEAVAKGLRASIWKQMVAAGVKLIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY++ GGEIGFDTYFSMARGNAT+PAMEMTKWFDTNYH+I
Sbjct  61   TFSFYDQVLDTTAMLGAVPPRYSFAGGEIGFDTYFSMARGNATLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP++KF+Y+SHKAV EYKEAK LG+DTVPV+
Sbjct  121  VPELGPEIKFAYSSHKAVAEYKEAKELGIDTVPVI  155



>gb|ADE75603.1| unknown [Picea sitchensis]
Length=766

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGPKRELKFALESFWDGKSSA DL+ VA  LRASIWKQM  AG+K IPSN
Sbjct  1    MASHVVGYPRMGPKRELKFALESFWDGKSSAADLEAVAKGLRASIWKQMVAAGVKLIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVPPRY++ GGEIGFDTYFSMARGNAT+PAMEMTKWFDTNYH+I
Sbjct  61   TFSFYDQVLDTTAMLGAVPPRYSFVGGEIGFDTYFSMARGNATLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP++KF+Y+SHKAV EYKEAK LG+DTVPV+
Sbjct  121  VPELGPEIKFAYSSHKAVAEYKEAKELGIDTVPVI  155



>ref|XP_008775707.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=819

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R +ASHIVGYPR+GPKRELKFALESFWDG+SSAEDL+KVA DLR SIWKQMA AG K+IP
Sbjct  52   RAVASHIVGYPRIGPKRELKFALESFWDGRSSAEDLEKVAKDLRMSIWKQMADAGTKFIP  111

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD +LDTT MLGAVP RY WTGGEIGFD YFSMARG+AT+PAMEMTKWFDTNYH
Sbjct  112  SNTFSYYDHILDTTVMLGAVPHRYGWTGGEIGFDVYFSMARGDATLPAMEMTKWFDTNYH  171

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPD+KFS ASHKAVNEYKEAK LG++T+PVL
Sbjct  172  YIVPELGPDLKFSCASHKAVNEYKEAKELGIETIPVL  208



>gb|EYU35999.1| hypothetical protein MIMGU_mgv1a001741mg [Erythranthe guttata]
Length=766

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+GPKRELKFALESFWDGKS+AE+L KVASDLR SIWKQMA AGIKYIPSN
Sbjct  1    MASHVVGYPRIGPKRELKFALESFWDGKSNAEELHKVASDLRVSIWKQMADAGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAMLGAVP RY W+GG+IGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMLGAVPSRYGWSGGDIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELG + +FSYAS KAV EYKEA+ALG+DTVPVL
Sbjct  121  VPELGLETEFSYASRKAVQEYKEARALGIDTVPVL  155



>emb|CDX92419.1| BnaA10g14580D [Brassica napus]
Length=876

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG GIKYIP
Sbjct  111  RPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGIKYIP  170

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  171  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  230

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL
Sbjct  231  YIVPELGPSVKFSYASHKAVEEFKEAKALGIDTVPVL  267



>ref|XP_010454417.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X3 [Camelina sativa]
Length=811

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DT PVL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVL  202



>ref|XP_010420946.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like [Camelina sativa]
Length=811

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+ PAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASAPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DTVPVL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVL  202



>ref|XP_010454416.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X2 [Camelina sativa]
Length=812

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DT PVL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVL  202



>ref|XP_010454415.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X1 [Camelina sativa]
Length=813

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ VA++LR SIW+ MA AGIKYIP
Sbjct  46   RAMSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIP  105

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  106  SNTFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYH  165

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV E+KEAKALG+DT PVL
Sbjct  166  YIVPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVL  202



>emb|CDY16584.1| BnaC09g36890D [Brassica napus]
Length=945

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG GIKYIP
Sbjct  180  RAMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGIKYIP  239

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  240  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  299

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL
Sbjct  300  YIVPELGPSVKFSYASHKAVEEFKEAKALGIDTVPVL  336



>ref|XP_009131831.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic [Brassica rapa]
Length=815

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK++A DLQ VA++LR SIWK MA AGIKYIP
Sbjct  50   RAMSSHIVGYPRIGPKRELKFALESFWDGKTAANDLQTVAANLRNSIWKHMADAGIKYIP  109

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GEIGFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  110  SNTFSYYDQMLDTTAMLGAVPSRYGWKSGEIGFDVYFSMARGNDSVPAMEMTKWFDTNYH  169

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPDV+FSYASHKAV+E+KEAKALG+DTVPVL
Sbjct  170  YIVPELGPDVEFSYASHKAVDEFKEAKALGIDTVPVL  206



>gb|KCW47769.1| hypothetical protein EUGRSUZ_K015171, partial [Eucalyptus grandis]
Length=188

 Score =   268 bits (685),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPRMGP RELKFALESFW G S+A+DLQKV +DL++SIWKQMA  GIKYIPSN
Sbjct  1    MASHVVGYPRMGPMRELKFALESFWHGNSTAKDLQKVGADLKSSIWKQMAAVGIKYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLD+TAMLGA+P RY W GGEI FD YFSMARG  +VPAMEMT+WFDTNYH+ 
Sbjct  61   TFSYYDQVLDSTAMLGAIPTRYGWNGGEIWFDVYFSMARGTTSVPAMEMTRWFDTNYHYT  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGPDV FSYAS KAV EYKEA+ LGVDTVPVL
Sbjct  121  VPELGPDVNFSYASRKAVTEYKEAQQLGVDTVPVL  155



>ref|XP_009120746.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X2 [Brassica 
rapa]
Length=808

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG G KYIP
Sbjct  43   RPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGNKYIP  102

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  103  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  162

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL
Sbjct  163  YIVPELGPHVKFSYASHKAVEEFKEAKALGIDTVPVL  199



>ref|XP_009120742.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120743.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120744.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120745.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
Length=833

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ VA+DLR SIWK MAG G KYIP
Sbjct  68   RPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGNKYIP  127

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YDQ+LDTTAMLGAVP RY W  GE+GFD YFSMARGN +VPAMEMTKWFDTNYH
Sbjct  128  SNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFDTNYH  187

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGP VKFSYASHKAV E+KEAKALG+DTVPVL
Sbjct  188  YIVPELGPHVKFSYASHKAVEEFKEAKALGIDTVPVL  224



>ref|XP_010933712.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Elaeis guineensis]
Length=838

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  90   RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIP  269
            R +ASHIVGYPR+GP+RELKFALESFWDG+SSAEDL+KVA+DLR S+WKQMA AG K+IP
Sbjct  72   RAVASHIVGYPRIGPRRELKFALESFWDGRSSAEDLEKVANDLRLSVWKQMADAGTKFIP  131

Query  270  SNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  449
            SNTFS YD +LDTT+MLGAVP RY WTGGEIGFD YFSMARGNAT+ AMEMTKWFDTNYH
Sbjct  132  SNTFSYYDHILDTTSMLGAVPHRYGWTGGEIGFDVYFSMARGNATLRAMEMTKWFDTNYH  191

Query  450  FIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            +IVPELGPD+KFSYASHK V EYKEAK LG++T+PVL
Sbjct  192  YIVPELGPDLKFSYASHKTVAEYKEAKELGIETIPVL  228



>pdb|1U1H|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U1J|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U1U|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U22|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
Length=765

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  99   ASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSNT  278
            ASHIVGYPR GPKRELKFALESFWDGKS+AEDLQKV++DLR+SIWKQ + AG K+IPSNT
Sbjct  2    ASHIVGYPRXGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQXSAAGTKFIPSNT  61

Query  279  FSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIV  458
            F++YDQVLDTTA LGAVPPRY +TGGEIG D YFS ARGNA+VPA E TKWFDTNYH+IV
Sbjct  62   FAHYDQVLDTTAXLGAVPPRYGYTGGEIGLDVYFSXARGNASVPAXEXTKWFDTNYHYIV  121

Query  459  PELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            PELGP+V FSYASHKAVNEYKEAKALGVDTVPVL
Sbjct  122  PELGPEVNFSYASHKAVNEYKEAKALGVDTVPVL  155



>gb|ABR16134.1| unknown [Picea sitchensis]
Length=766

 Score =   282 bits (722),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+ PKRELKFALESFWDGKSSA +LQ VA DLR + WKQMA AG+ YIPSN
Sbjct  1    MASHVVGYPRIAPKRELKFALESFWDGKSSAAELQNVAKDLRVATWKQMADAGLTYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAM+GAVPPRY WTGGEIGFDTYFSMARGNA +PAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNAKLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP++KF Y+SHKAV+EYKEAK +G++TVPV+
Sbjct  121  VPELGPEIKFKYSSHKAVDEYKEAKKIGIETVPVI  155



>emb|CCC42221.1| vitamin-b12 independent methionine synthase [Pinus pinaster]
Length=766

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  96   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGIKYIPSN  275
            MASH+VGYPR+ PKRELKFALESFWDGKSSA +LQ VA +LRA+ WKQMA AG+ YIPSN
Sbjct  1    MASHVVGYPRIAPKRELKFALESFWDGKSSATELQNVAKNLRAATWKQMADAGLTYIPSN  60

Query  276  TFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  455
            TFS YDQVLDTTAM+GAVPPRY WTGGEIGFDTYFSMARGNA +PAMEMTKWFDTNYH+I
Sbjct  61   TFSYYDQVLDTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNAKLPAMEMTKWFDTNYHYI  120

Query  456  VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            VPELGP++KF Y+SHKAV+EYKEAK +G++TVPV+
Sbjct  121  VPELGPEIKFKYSSHKAVDEYKEAKEIGIETVPVI  155



>ref|XP_009346240.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Pyrus x bretschneideri]
Length=808

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  78   STP*RKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMAGAGI  257
            +T  R +ASHIVG PR+GPKRELKFALESFWDGKSSAE+LQK A+ LR+SIWKQ+A AGI
Sbjct  35   TTSTRAVASHIVGLPRIGPKRELKFALESFWDGKSSAEELQKAAAGLRSSIWKQLADAGI  94

Query  258  KYIPSNTFSNYDQVLDTTAMLGAVPPRYNWTGGEIGFDTYFSMARGNATVPAMEMTKWFD  437
            +YIPSNTFS YDQ+LDTTAMLGAVPPRY W   EIGF+TYFSMARGN  VPAMEMTKWFD
Sbjct  95   QYIPSNTFSYYDQMLDTTAMLGAVPPRYGWKHSEIGFETYFSMARGNVNVPAMEMTKWFD  154

Query  438  TNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVL  560
            TNYH+IVPELGP ++FSYASHKAV+E+KEAKALGVDT+PVL
Sbjct  155  TNYHYIVPELGPHIRFSYASHKAVDEFKEAKALGVDTIPVL  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920