BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018B13

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357209.1|  PREDICTED: uncharacterized protein LOC102581459    193   3e-55   Solanum tuberosum [potatoes]
ref|XP_004238724.1|  PREDICTED: uncharacterized protein LOC101243707    190   6e-54   Solanum lycopersicum
emb|CDP00228.1|  unnamed protein product                                186   2e-52   Coffea canephora [robusta coffee]
ref|XP_009605574.1|  PREDICTED: uncharacterized protein LOC104100114    183   2e-51   Nicotiana tomentosiformis
gb|KJB61189.1|  hypothetical protein B456_009G345200                    176   1e-50   Gossypium raimondii
gb|KJB61191.1|  hypothetical protein B456_009G345200                    176   4e-50   Gossypium raimondii
gb|KJB61188.1|  hypothetical protein B456_009G345200                    177   4e-49   Gossypium raimondii
gb|KHG00924.1|  Protein FAM69A                                          176   1e-48   Gossypium arboreum [tree cotton]
ref|XP_009757019.1|  PREDICTED: uncharacterized protein LOC104250177    176   1e-48   Nicotiana sylvestris
ref|XP_002270582.1|  PREDICTED: uncharacterized protein LOC100251...    175   2e-48   Vitis vinifera
ref|XP_007044485.1|  Zinc finger MYND domain-containing protein 1...    172   2e-48   
ref|XP_010113182.1|  hypothetical protein L484_000212                   169   3e-48   
gb|EYU28651.1|  hypothetical protein MIMGU_mgv1a004456mg                173   8e-48   Erythranthe guttata [common monkey flower]
ref|XP_007044484.1|  Zinc finger MYND domain-containing protein 1...    173   1e-47   
ref|XP_002520208.1|  conserved hypothetical protein                     171   7e-47   Ricinus communis
ref|XP_011086470.1|  PREDICTED: uncharacterized protein LOC105168199    171   9e-47   Sesamum indicum [beniseed]
ref|XP_010100527.1|  hypothetical protein L484_027842                   169   1e-46   
ref|XP_003613417.1|  hypothetical protein MTR_5g036420                  169   2e-46   Medicago truncatula
ref|XP_010683317.1|  PREDICTED: uncharacterized protein LOC104898021    168   8e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO82639.1|  hypothetical protein CISIN_1g0101751mg                  164   2e-45   Citrus sinensis [apfelsine]
gb|KDO82638.1|  hypothetical protein CISIN_1g0101751mg                  164   2e-45   Citrus sinensis [apfelsine]
ref|XP_008446261.1|  PREDICTED: uncharacterized protein LOC103489044    166   4e-45   Cucumis melo [Oriental melon]
ref|XP_004135222.1|  PREDICTED: uncharacterized protein LOC101209749    164   2e-44   Cucumis sativus [cucumbers]
gb|AGV54795.1|  hypothetical protein                                    163   4e-44   Phaseolus vulgaris [French bean]
ref|XP_010272087.1|  PREDICTED: uncharacterized protein LOC104607...    162   6e-44   
ref|XP_007153681.1|  hypothetical protein PHAVU_003G055900g             162   8e-44   Phaseolus vulgaris [French bean]
ref|XP_010272086.1|  PREDICTED: uncharacterized protein LOC104607...    162   9e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006438500.1|  hypothetical protein CICLE_v10031248mg             161   1e-43   
gb|KDP21286.1|  hypothetical protein JCGZ_21757                         162   1e-43   Jatropha curcas
ref|XP_006438501.1|  hypothetical protein CICLE_v10031248mg             161   2e-43   Citrus clementina [clementine]
ref|XP_003552001.1|  PREDICTED: uncharacterized protein LOC100815535    160   6e-43   Glycine max [soybeans]
gb|EPS62473.1|  hypothetical protein M569_12317                         153   1e-42   Genlisea aurea
ref|XP_008339979.1|  PREDICTED: uncharacterized protein LOC103402967    156   1e-41   
ref|XP_004297675.1|  PREDICTED: uncharacterized protein LOC101296656    156   1e-41   Fragaria vesca subsp. vesca
dbj|BAJ33873.1|  unnamed protein product                                154   6e-41   Eutrema halophilum
ref|XP_006300446.1|  hypothetical protein CARUB_v10020126mg             154   6e-41   Capsella rubella
ref|XP_011015682.1|  PREDICTED: uncharacterized protein LOC105119255    154   7e-41   Populus euphratica
ref|XP_006856897.1|  hypothetical protein AMTR_s00055p00212390          154   8e-41   Amborella trichopoda
ref|XP_006378188.1|  hypothetical protein POPTR_0010s04630g             154   8e-41   
ref|XP_006390921.1|  hypothetical protein EUTSA_v10018393mg             154   8e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010471012.1|  PREDICTED: uncharacterized protein LOC104750861    154   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010415693.1|  PREDICTED: uncharacterized protein LOC104701657    154   9e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011012739.1|  PREDICTED: uncharacterized protein LOC105116927    154   9e-41   Populus euphratica
ref|XP_010533011.1|  PREDICTED: uncharacterized protein LOC104808873    154   9e-41   Tarenaya hassleriana [spider flower]
ref|XP_010512094.1|  PREDICTED: uncharacterized protein LOC104788107    154   9e-41   Camelina sativa [gold-of-pleasure]
ref|NP_564985.1|  uncharacterized protein                               153   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008244965.1|  PREDICTED: uncharacterized protein LOC103343066    153   1e-40   Prunus mume [ume]
ref|XP_004504499.1|  PREDICTED: uncharacterized protein LOC101510072    153   2e-40   Cicer arietinum [garbanzo]
ref|XP_002887283.1|  hypothetical protein ARALYDRAFT_476140             152   4e-40   
ref|XP_008389573.1|  PREDICTED: uncharacterized protein LOC103451910    150   2e-39   
ref|XP_009360447.1|  PREDICTED: uncharacterized protein LOC103950916    150   2e-39   
ref|XP_009419908.1|  PREDICTED: uncharacterized protein LOC103999...    147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419909.1|  PREDICTED: uncharacterized protein LOC103999...    147   2e-38   
ref|XP_007222590.1|  hypothetical protein PRUPE_ppa004148mg             147   3e-38   Prunus persica
ref|XP_010043827.1|  PREDICTED: uncharacterized protein LOC104432932    146   5e-38   Eucalyptus grandis [rose gum]
ref|XP_003517865.1|  PREDICTED: uncharacterized protein LOC100805887    146   6e-38   Glycine max [soybeans]
ref|XP_003519794.1|  PREDICTED: uncharacterized protein LOC100779863    145   1e-37   Glycine max [soybeans]
ref|XP_010913435.1|  PREDICTED: uncharacterized protein LOC105039...    144   1e-37   
ref|XP_010913432.1|  PREDICTED: uncharacterized protein LOC105039...    144   4e-37   Elaeis guineensis
ref|XP_008798032.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   5e-37   
gb|KHN01126.1|  hypothetical protein glysoja_008028                     142   1e-36   Glycine soja [wild soybean]
emb|CDY38797.1|  BnaA07g28690D                                          140   6e-36   Brassica napus [oilseed rape]
ref|XP_010545218.1|  PREDICTED: uncharacterized protein LOC104817662    140   7e-36   Tarenaya hassleriana [spider flower]
ref|XP_006858155.1|  hypothetical protein AMTR_s00062p00137330          140   7e-36   Amborella trichopoda
gb|ABR17461.1|  unknown                                                 140   8e-36   Picea sitchensis
ref|XP_006378189.1|  hypothetical protein POPTR_0010s04630g             140   8e-36   
gb|KDO62609.1|  hypothetical protein CISIN_1g009605mg                   137   1e-35   Citrus sinensis [apfelsine]
emb|CDY06624.1|  BnaC02g13480D                                          140   2e-35   
ref|XP_010267678.1|  PREDICTED: uncharacterized protein LOC104604833    138   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009127775.1|  PREDICTED: uncharacterized protein LOC103852633    138   4e-35   Brassica rapa
gb|KFK41436.1|  hypothetical protein AALP_AA2G130200                    138   4e-35   Arabis alpina [alpine rockcress]
gb|ABK24649.1|  unknown                                                 138   6e-35   Picea sitchensis
ref|XP_010433417.1|  PREDICTED: uncharacterized protein LOC104717532    138   6e-35   Camelina sativa [gold-of-pleasure]
emb|CDY03761.1|  BnaA02g14760D                                          137   6e-35   
ref|XP_010448183.1|  PREDICTED: uncharacterized protein LOC104730687    138   7e-35   
emb|CDY42991.1|  BnaC02g19650D                                          137   8e-35   Brassica napus [oilseed rape]
ref|XP_007020906.1|  Inositol-1,4,5-trisphosphate 5-phosphatase 4...    137   9e-35   
ref|XP_006280251.1|  hypothetical protein CARUB_v10026167mg             137   1e-34   
gb|AAK68839.1|  Unknown protein                                         134   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105692.1|  PREDICTED: uncharacterized protein LOC103831561    136   2e-34   Brassica rapa
ref|XP_010448765.1|  PREDICTED: uncharacterized protein LOC104731172    136   2e-34   Camelina sativa [gold-of-pleasure]
gb|AAL09800.1|  AT4g27020/F10M23_360                                    131   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020905.1|  Inositol-1,4,5-trisphosphate 5-phosphatase 4...    136   2e-34   
ref|XP_010276049.1|  PREDICTED: uncharacterized protein LOC104610902    136   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006475148.1|  PREDICTED: uncharacterized protein LOC102609098    136   3e-34   Citrus sinensis [apfelsine]
ref|XP_002867528.1|  hypothetical protein ARALYDRAFT_913846             135   3e-34   Arabidopsis lyrata subsp. lyrata
emb|CDY11612.1|  BnaC06g31270D                                          135   4e-34   Brassica napus [oilseed rape]
ref|XP_006283454.1|  hypothetical protein CARUB_v10004499mg             135   4e-34   
gb|EYU33635.1|  hypothetical protein MIMGU_mgv1a018256mg                135   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_006401517.1|  hypothetical protein EUTSA_v10013232mg             135   4e-34   Eutrema salsugineum [saltwater cress]
ref|XP_010482896.1|  PREDICTED: uncharacterized protein LOC104761505    135   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010644433.1|  PREDICTED: uncharacterized protein LOC100267...    135   5e-34   Vitis vinifera
emb|CDP05764.1|  unnamed protein product                                135   5e-34   Coffea canephora [robusta coffee]
ref|XP_009607397.1|  PREDICTED: uncharacterized protein LOC104101619    134   7e-34   Nicotiana tomentosiformis
ref|XP_007211818.1|  hypothetical protein PRUPE_ppa004230mg             134   7e-34   Prunus persica
ref|XP_002280959.1|  PREDICTED: uncharacterized protein LOC100267...    134   1e-33   Vitis vinifera
ref|XP_010438669.1|  PREDICTED: uncharacterized protein LOC104722227    134   1e-33   Camelina sativa [gold-of-pleasure]
ref|NP_200298.1|  uncharacterized protein                               134   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41291.1|  unknown                                                 132   2e-33   Medicago truncatula
ref|XP_006346228.1|  PREDICTED: uncharacterized protein LOC102585922    134   2e-33   Solanum tuberosum [potatoes]
gb|ACG40083.1|  hypothetical protein                                    133   2e-33   Zea mays [maize]
ref|XP_009334822.1|  PREDICTED: uncharacterized protein LOC103927611    133   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_008226932.1|  PREDICTED: uncharacterized protein LOC103326477    133   3e-33   Prunus mume [ume]
ref|XP_011097895.1|  PREDICTED: uncharacterized protein LOC105176701    133   3e-33   
ref|XP_004295816.2|  PREDICTED: uncharacterized protein LOC101297130    133   3e-33   Fragaria vesca subsp. vesca
ref|XP_008371266.1|  PREDICTED: uncharacterized protein LOC103434697    133   3e-33   
ref|XP_009774573.1|  PREDICTED: uncharacterized protein LOC104224588    132   4e-33   Nicotiana sylvestris
ref|XP_010064372.1|  PREDICTED: uncharacterized protein LOC104451409    125   4e-33   
ref|XP_006575675.1|  PREDICTED: uncharacterized protein LOC100789...    132   5e-33   Glycine max [soybeans]
gb|KJB13650.1|  hypothetical protein B456_002G087800                    130   5e-33   Gossypium raimondii
ref|XP_003617489.1|  hypothetical protein MTR_5g092140                  132   6e-33   Medicago truncatula
ref|XP_003519567.1|  PREDICTED: uncharacterized protein LOC100789...    132   8e-33   Glycine max [soybeans]
ref|XP_006413116.1|  hypothetical protein EUTSA_v10024847mg             132   9e-33   Eutrema salsugineum [saltwater cress]
ref|XP_008226933.1|  PREDICTED: uncharacterized protein LOC103326478    131   9e-33   Prunus mume [ume]
ref|XP_007211816.1|  hypothetical protein PRUPE_ppa004222mg             131   9e-33   Prunus persica
ref|XP_008349941.1|  PREDICTED: uncharacterized protein LOC103413239    131   1e-32   
ref|NP_194432.1|  uncharacterized protein                               131   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62765.1|  hypothetical protein B456_009G435000                    130   1e-32   Gossypium raimondii
ref|XP_002316997.1|  hypothetical protein POPTR_0011s14080g             131   1e-32   
ref|XP_008385988.1|  PREDICTED: uncharacterized protein LOC103448506    131   2e-32   
ref|XP_004244131.1|  PREDICTED: uncharacterized protein LOC101251602    130   2e-32   Solanum lycopersicum
ref|XP_009378549.1|  PREDICTED: uncharacterized protein LOC103967027    130   2e-32   Pyrus x bretschneideri [bai li]
gb|KCW67102.1|  hypothetical protein EUGRSUZ_F00885                     130   2e-32   Eucalyptus grandis [rose gum]
ref|XP_002864361.1|  hypothetical protein ARALYDRAFT_331828             130   2e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_009143005.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   2e-32   Brassica rapa
ref|XP_011030808.1|  PREDICTED: uncharacterized protein LOC105130143    130   2e-32   Populus euphratica
gb|KJB62764.1|  hypothetical protein B456_009G435000                    130   3e-32   Gossypium raimondii
gb|KJB13649.1|  hypothetical protein B456_002G087800                    130   3e-32   Gossypium raimondii
gb|KJB13651.1|  hypothetical protein B456_002G087800                    130   3e-32   Gossypium raimondii
ref|XP_011040240.1|  PREDICTED: uncharacterized protein LOC105136541    130   3e-32   Populus euphratica
ref|XP_010060409.1|  PREDICTED: uncharacterized protein LOC104448324    130   3e-32   Eucalyptus grandis [rose gum]
ref|XP_006370687.1|  hypothetical protein POPTR_0001s44890g             130   4e-32   
gb|KJB62763.1|  hypothetical protein B456_009G435000                    130   4e-32   Gossypium raimondii
gb|KHG29749.1|  Transcription activator gutR                            130   4e-32   Gossypium arboreum [tree cotton]
gb|KHG01773.1|  Tryptophan synthase alpha chain                         129   5e-32   Gossypium arboreum [tree cotton]
ref|XP_009614695.1|  PREDICTED: uncharacterized protein LOC104107...    129   6e-32   Nicotiana tomentosiformis
ref|XP_009801253.1|  PREDICTED: uncharacterized protein LOC104246...    129   6e-32   Nicotiana sylvestris
ref|XP_009614697.1|  PREDICTED: uncharacterized protein LOC104107...    129   7e-32   Nicotiana tomentosiformis
ref|XP_002522970.1|  conserved hypothetical protein                     129   8e-32   Ricinus communis
ref|XP_008454551.1|  PREDICTED: uncharacterized protein LOC103494941    129   8e-32   Cucumis melo [Oriental melon]
gb|EYU19247.1|  hypothetical protein MIMGU_mgv1a004499mg                128   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_003578075.1|  PREDICTED: uncharacterized protein LOC100824338    128   1e-31   Brachypodium distachyon [annual false brome]
ref|XP_009801187.1|  PREDICTED: uncharacterized protein LOC104246...    128   1e-31   Nicotiana sylvestris
ref|XP_010675677.1|  PREDICTED: uncharacterized protein LOC104891653    128   2e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP39105.1|  hypothetical protein JCGZ_00862                         128   2e-31   Jatropha curcas
ref|XP_011095372.1|  PREDICTED: uncharacterized protein LOC105174849    128   2e-31   Sesamum indicum [beniseed]
ref|XP_003544978.1|  PREDICTED: uncharacterized protein LOC100796964    127   3e-31   Glycine max [soybeans]
ref|XP_008812430.1|  PREDICTED: uncharacterized protein LOC103723322    126   6e-31   Phoenix dactylifera
ref|XP_007142263.1|  hypothetical protein PHAVU_008G266000g             126   8e-31   Phaseolus vulgaris [French bean]
gb|KCW67113.1|  hypothetical protein EUGRSUZ_F00893                     125   1e-30   Eucalyptus grandis [rose gum]
ref|XP_009127046.1|  PREDICTED: uncharacterized protein LOC103851917    125   1e-30   Brassica rapa
ref|XP_004491367.1|  PREDICTED: uncharacterized protein LOC101492149    125   1e-30   Cicer arietinum [garbanzo]
emb|CDY20800.1|  BnaA02g09400D                                          126   2e-30   Brassica napus [oilseed rape]
ref|XP_009120015.1|  PREDICTED: uncharacterized protein LOC103844940    125   2e-30   Brassica rapa
ref|XP_006346229.1|  PREDICTED: uncharacterized protein LOC102586255    124   3e-30   Solanum tuberosum [potatoes]
ref|XP_002460179.1|  hypothetical protein SORBIDRAFT_02g024000          124   4e-30   Sorghum bicolor [broomcorn]
ref|NP_001142383.1|  uncharacterized protein LOC100274556 precursor     124   4e-30   Zea mays [maize]
tpg|DAA61320.1|  TPA: hypothetical protein ZEAMMB73_635026              124   4e-30   
ref|XP_006367536.1|  PREDICTED: uncharacterized protein LOC102597542    124   7e-30   Solanum tuberosum [potatoes]
gb|KFK29208.1|  hypothetical protein AALP_AA7G103200                    123   9e-30   Arabis alpina [alpine rockcress]
ref|XP_010930259.1|  PREDICTED: uncharacterized protein LOC105051...    122   2e-29   Elaeis guineensis
ref|XP_010930250.1|  PREDICTED: uncharacterized protein LOC105051...    122   3e-29   Elaeis guineensis
ref|XP_004244132.1|  PREDICTED: uncharacterized protein LOC101251905    122   3e-29   Solanum lycopersicum
ref|XP_004252023.1|  PREDICTED: uncharacterized protein LOC101252754    121   5e-29   Solanum lycopersicum
ref|XP_009420606.1|  PREDICTED: uncharacterized protein LOC104000320    120   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY19873.1|  BnaC09g31390D                                          119   3e-28   Brassica napus [oilseed rape]
ref|XP_004956736.1|  PREDICTED: uncharacterized protein LOC101782072    119   4e-28   Setaria italica
emb|CDY17285.1|  BnaA10g09190D                                          118   5e-28   Brassica napus [oilseed rape]
ref|XP_009769049.1|  PREDICTED: uncharacterized protein LOC104219979    118   6e-28   Nicotiana sylvestris
dbj|BAJ99018.1|  predicted protein                                      118   7e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97125.1|  predicted protein                                      118   8e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009599364.1|  PREDICTED: uncharacterized protein LOC104095030    117   1e-27   Nicotiana tomentosiformis
ref|XP_010446119.1|  PREDICTED: uncharacterized protein LOC104728896    118   2e-27   
ref|XP_010092131.1|  hypothetical protein L484_017819                   117   2e-27   
gb|EAZ08986.1|  hypothetical protein OsI_31250                          115   5e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001063085.1|  Os09g0392000                                       115   6e-27   
ref|XP_004151958.1|  PREDICTED: uncharacterized protein LOC101214437    115   7e-27   Cucumis sativus [cucumbers]
ref|XP_001781611.1|  predicted protein                                  112   5e-26   
ref|XP_004152029.1|  PREDICTED: uncharacterized protein LOC101212346    113   6e-26   
ref|XP_008454552.1|  PREDICTED: uncharacterized protein LOC103494942    112   1e-25   
gb|KHN11935.1|  hypothetical protein glysoja_019908                     111   2e-25   Glycine soja [wild soybean]
ref|XP_002986592.1|  hypothetical protein SELMODRAFT_124354             110   3e-25   
ref|XP_002965264.1|  hypothetical protein SELMODRAFT_143057             110   3e-25   
ref|XP_001775460.1|  predicted protein                                  110   7e-25   
ref|XP_003564372.1|  PREDICTED: uncharacterized protein LOC100827...    110   9e-25   Brachypodium distachyon [annual false brome]
emb|CDY29265.1|  BnaC01g19170D                                          108   2e-24   Brassica napus [oilseed rape]
ref|XP_010644430.1|  PREDICTED: uncharacterized protein LOC100241...    105   1e-23   
ref|XP_010644429.1|  PREDICTED: uncharacterized protein LOC100241...    105   2e-23   
ref|XP_002278686.1|  PREDICTED: uncharacterized protein LOC100241...    105   2e-23   Vitis vinifera
ref|XP_010644425.1|  PREDICTED: uncharacterized protein LOC100241...    105   3e-23   
ref|XP_010644428.1|  PREDICTED: uncharacterized protein LOC100241...    105   3e-23   
emb|CAN60720.1|  hypothetical protein VITISV_022056                     105   3e-23   Vitis vinifera
emb|CBI26611.3|  unnamed protein product                                105   4e-23   Vitis vinifera
ref|XP_004970229.1|  PREDICTED: uncharacterized protein LOC101777...    103   1e-22   Setaria italica
dbj|BAJ95380.1|  predicted protein                                      102   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW62203.1|  hypothetical protein ZEAMMB73_209421                  98.2    2e-21   
dbj|BAB89049.1|  unknown protein                                      98.6    1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ACN29289.1|  unknown                                               98.6    1e-20   Zea mays [maize]
ref|XP_008676929.1|  PREDICTED: uncharacterized protein LOC100275...  98.2    1e-20   Zea mays [maize]
ref|NP_001061835.1|  Os08g0425000                                     97.8    2e-20   
gb|EEC83605.1|  hypothetical protein OsI_29292                        97.4    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_004973463.1|  PREDICTED: uncharacterized protein LOC101781133  97.1    3e-20   Setaria italica
ref|XP_002444358.1|  hypothetical protein SORBIDRAFT_07g020660        97.1    4e-20   
ref|NP_001143255.1|  uncharacterized protein LOC100275783 precursor   96.7    5e-20   Zea mays [maize]
ref|NP_001143111.1|  uncharacterized protein LOC100275589             95.5    1e-19   Zea mays [maize]
ref|XP_003574496.1|  PREDICTED: uncharacterized protein LOC100845920  92.8    1e-18   Brachypodium distachyon [annual false brome]
ref|XP_003564373.1|  PREDICTED: uncharacterized protein LOC100827...  92.4    2e-18   Brachypodium distachyon [annual false brome]
dbj|BAJ91369.1|  predicted protein                                    89.0    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010060405.1|  PREDICTED: uncharacterized protein LOC104448310  82.8    5e-17   Eucalyptus grandis [rose gum]
ref|XP_006452283.1|  hypothetical protein CICLE_v10008210mg           83.2    2e-15   Citrus clementina [clementine]
ref|XP_010064384.1|  PREDICTED: uncharacterized protein LOC104451424  79.0    1e-14   
gb|AFG71483.1|  hypothetical protein UMN_5876_01                      74.7    3e-14   Pinus taeda
gb|EAY76121.1|  hypothetical protein OsI_04050                        78.6    6e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004970230.1|  PREDICTED: uncharacterized protein LOC101777...  78.2    1e-13   Setaria italica
ref|NP_001044498.2|  Os01g0793500                                     77.8    2e-13   
emb|CDM84540.1|  unnamed protein product                              76.3    6e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008654687.1|  PREDICTED: uncharacterized protein LOC100275...  76.3    6e-13   Zea mays [maize]
ref|XP_006644833.1|  PREDICTED: uncharacterized protein LOC102706146  73.6    5e-12   Oryza brachyantha
gb|EMT12587.1|  hypothetical protein F775_11937                       70.1    5e-11   
gb|EMT03744.1|  hypothetical protein F775_19554                       70.5    6e-11   
gb|AAB61100.1|  ESTs gb|R30459,gb|N38441 come from this gene          68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AFW62204.1|  hypothetical protein ZEAMMB73_209421                  59.3    2e-08   
gb|AFW84863.1|  hypothetical protein ZEAMMB73_247218                  57.8    1e-07   
gb|EEC71627.1|  hypothetical protein OsI_04051                        57.4    1e-07   Oryza sativa Indica Group [Indian rice]
gb|KCW70170.1|  hypothetical protein EUGRSUZ_F03459                   58.5    4e-07   Eucalyptus grandis [rose gum]
gb|KHN38290.1|  hypothetical protein glysoja_003955                   56.6    2e-06   Glycine soja [wild soybean]
ref|XP_002522971.1|  hypothetical protein RCOM_0585690                54.7    4e-06   
emb|CDX89285.1|  BnaA01g16080D                                        52.0    5e-05   
ref|XP_010652908.1|  PREDICTED: uncharacterized protein LOC100251...  49.7    3e-04   
gb|EMS49816.1|  hypothetical protein TRIUR3_06457                     50.1    3e-04   Triticum urartu
tpg|DAA42766.1|  TPA: hypothetical protein ZEAMMB73_498672            48.9    6e-04   
ref|XP_006660599.1|  PREDICTED: uncharacterized protein LOC102705746  48.5    9e-04   



>ref|XP_006357209.1| PREDICTED: uncharacterized protein LOC102581459 [Solanum tuberosum]
Length=524

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 105/129 (81%), Gaps = 2/129 (2%)
 Frame = +2

Query  134  MYCWRQLRLTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLM  307
            MY  ++L    L+W+LG+G G  FG A K+PFRV DVLPVLP Q+SWPVLN+ HS  DLM
Sbjct  1    MYRPQKLCSLTLLWILGIGLGLSFGYALKMPFRVKDVLPVLPHQVSWPVLNTMHSPVDLM  60

Query  308  PIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYV  487
            P ++G+LAPNNGSI WKG+CFFENEARVE  G GDR IGGATI+LST AAHSWTCMDLYV
Sbjct  61   PTYIGSLAPNNGSISWKGACFFENEARVEFTGPGDRGIGGATIHLSTGAAHSWTCMDLYV  120

Query  488  FATPXRVTW  514
            FATP R++W
Sbjct  121  FATPYRISW  129



>ref|XP_004238724.1| PREDICTED: uncharacterized protein LOC101243707 [Solanum lycopersicum]
Length=524

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 103/129 (80%), Gaps = 2/129 (2%)
 Frame = +2

Query  134  MYCWRQLRLTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLM  307
            MY  ++L    L+W+LG+G G  FG A K+PFRVNDVLPVLP Q+SWPVLN+ HS  DLM
Sbjct  1    MYRPQKLCSLTLLWILGIGLGLSFGYALKMPFRVNDVLPVLPHQVSWPVLNTMHSPVDLM  60

Query  308  PIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYV  487
            P ++G+L PNNGSI WKG+CFFENEAR E  G GDR IGGATI+L T AAHSWTCMDLYV
Sbjct  61   PTYIGSLTPNNGSISWKGACFFENEARAEFTGPGDRGIGGATIHLLTGAAHSWTCMDLYV  120

Query  488  FATPXRVTW  514
            FATP R++W
Sbjct  121  FATPYRISW  129



>emb|CDP00228.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  155  RLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP  334
            +L ++ ++L L  GFG AFKVPF V DVLPVLPRQISWPV+NS HSA DLMP ++G+LAP
Sbjct  6    KLWIVSFILILRLGFGEAFKVPFTVKDVLPVLPRQISWPVMNSIHSAVDLMPSYIGSLAP  65

Query  335  NNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +NGSI WKG+CF +N+ARVE  GSGDR+IGGA IYLST  A SWTCMDLYVFATP R+TW
Sbjct  66   HNGSIDWKGACFLDNKARVEFTGSGDRNIGGAVIYLSTGEAQSWTCMDLYVFATPYRITW  125



>ref|XP_009605574.1| PREDICTED: uncharacterized protein LOC104100114 [Nicotiana tomentosiformis]
Length=523

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  191  FGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCF  370
            F FG A K+PFRV DVLPVLPR++SWPVLN+ HS  DL+P ++G+LAPNNGSI WKG+CF
Sbjct  22   FSFGDALKMPFRVKDVLPVLPREVSWPVLNTLHSPVDLLPTYIGSLAPNNGSISWKGACF  81

Query  371  FENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            F+NEARVE  G  DR IGGATIYLST AAHSWTCMDLYVFATP R+TW
Sbjct  82   FQNEARVEFTGRDDRGIGGATIYLSTGAAHSWTCMDLYVFATPYRITW  129



>gb|KJB61189.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=339

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = +2

Query  158  LTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+L   VLGLGFG  FG AFKVPFRVNDVLPVLPRQ+SWPVLN+ HSA DL+P FVG++ 
Sbjct  10   LSLFFCVLGLGFGVDFGQAFKVPFRVNDVLPVLPRQVSWPVLNTLHSAVDLLPAFVGSVT  69

Query  332  PNNGSIRWKGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPX  502
            PNNGSI WKGSCF  NEAR+E   S DRD   +GG  ++L+T+ AHSWTCMDLYVFATP 
Sbjct  70   PNNGSIDWKGSCFHGNEARLEFTNS-DRDDSGLGGGVLHLTTSEAHSWTCMDLYVFATPY  128

Query  503  RVTW  514
            R+TW
Sbjct  129  RITW  132



>gb|KJB61191.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=375

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = +2

Query  158  LTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+L   VLGLGFG  FG AFKVPFRVNDVLPVLPRQ+SWPVLN+ HSA DL+P FVG++ 
Sbjct  10   LSLFFCVLGLGFGVDFGQAFKVPFRVNDVLPVLPRQVSWPVLNTLHSAVDLLPAFVGSVT  69

Query  332  PNNGSIRWKGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPX  502
            PNNGSI WKGSCF  NEAR+E   S DRD   +GG  ++L+T+ AHSWTCMDLYVFATP 
Sbjct  70   PNNGSIDWKGSCFHGNEARLEFTNS-DRDDSGLGGGVLHLTTSEAHSWTCMDLYVFATPY  128

Query  503  RVTW  514
            R+TW
Sbjct  129  RITW  132



>gb|KJB61188.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=527

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = +2

Query  158  LTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+L   VLGLGFG  FG AFKVPFRVNDVLPVLPRQ+SWPVLN+ HSA DL+P FVG++ 
Sbjct  10   LSLFFCVLGLGFGVDFGQAFKVPFRVNDVLPVLPRQVSWPVLNTLHSAVDLLPAFVGSVT  69

Query  332  PNNGSIRWKGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPX  502
            PNNGSI WKGSCF  NEAR+E   S DRD   +GG  ++L+T+ AHSWTCMDLYVFATP 
Sbjct  70   PNNGSIDWKGSCFHGNEARLEFTNS-DRDDSGLGGGVLHLTTSEAHSWTCMDLYVFATPY  128

Query  503  RVTW  514
            R+TW
Sbjct  129  RITW  132



>gb|KHG00924.1| Protein FAM69A [Gossypium arboreum]
Length=527

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (81%), Gaps = 6/124 (5%)
 Frame = +2

Query  158  LTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+L   VLGLGFG  FG AFKVPFRVNDVLPVLPRQ+SWPVLN+ HSA DL+P FVG++ 
Sbjct  10   LSLFFCVLGLGFGVDFGQAFKVPFRVNDVLPVLPRQVSWPVLNTLHSAVDLLPAFVGSVT  69

Query  332  PNNGSIRWKGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPX  502
            PNNGSI WKG+CF  NEAR+E   S DRD   +GG  ++L+T+ AHSWTCMDLYVFATP 
Sbjct  70   PNNGSIDWKGACFHGNEARLEFT-SSDRDDSGLGGGVLHLTTSEAHSWTCMDLYVFATPY  128

Query  503  RVTW  514
            R+TW
Sbjct  129  RITW  132



>ref|XP_009757019.1| PREDICTED: uncharacterized protein LOC104250177 [Nicotiana sylvestris]
Length=523

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A K+PFRV DVLPVLPR++SWPVLN+ HS  DL+P ++G+LAP+NGSI WKG+CFF+NE
Sbjct  26   DALKMPFRVKDVLPVLPREVSWPVLNTLHSPVDLLPTYIGSLAPDNGSISWKGACFFQNE  85

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            ARVE  G GDR IGGATI+LST AAHSWTCMDLYVFATP R+TW
Sbjct  86   ARVEFTGPGDRGIGGATIHLSTGAAHSWTCMDLYVFATPYRITW  129



>ref|XP_002270582.1| PREDICTED: uncharacterized protein LOC100251867 isoform X1 [Vitis 
vinifera]
 emb|CBI32078.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  176  VLGLGFGF--GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI  349
            +LGLGFGF  G AFKVPFRV DVLP LPRQISWPVLN+ HSA DL+P FVG++ P NGSI
Sbjct  12   ILGLGFGFDHGHAFKVPFRVKDVLPALPRQISWPVLNNLHSAVDLLPAFVGSVTPGNGSI  71

Query  350  RWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             WKG+CF+ N+AR++   SGDR +GG  +YL+TA AHSWTCMDLYVFATP RVTW
Sbjct  72   EWKGACFYGNQARLQFT-SGDRGLGGGVLYLTTAEAHSWTCMDLYVFATPYRVTW  125



>ref|XP_007044485.1| Zinc finger MYND domain-containing protein 15 isoform 2 [Theobroma 
cacao]
 gb|EOY00317.1| Zinc finger MYND domain-containing protein 15 isoform 2 [Theobroma 
cacao]
Length=408

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = +2

Query  158  LTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+L   VLGLGFG  FG AFKVPFRV DVLPVLPRQISWPVLN+ H+  DL+P FVG++ 
Sbjct  10   LSLFFCVLGLGFGVDFGQAFKVPFRVKDVLPVLPRQISWPVLNNLHTPVDLLPAFVGSVT  69

Query  332  PNNGSIRWKGSCFFENEARVELNGS--GDRDIGGATIYLSTAAAHSWTCMDLYVFATPXR  505
            PNNGS+ WKG+CF+ NEAR+E   +   D  +GG  +YL+T+ AHSWTCMDLYVFATP R
Sbjct  70   PNNGSVEWKGACFYGNEARLEFTKTDRNDSRLGGGVLYLTTSEAHSWTCMDLYVFATPYR  129

Query  506  VTW  514
            +TW
Sbjct  130  ITW  132



>ref|XP_010113182.1| hypothetical protein L484_000212 [Morus notabilis]
 gb|EXC72411.1| hypothetical protein L484_000212 [Morus notabilis]
Length=276

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 3/122 (2%)
 Frame = +2

Query  155  RLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP  334
            RL+L+   L +G G G A KVPF+V D+LP LP Q+SWPVLN+ HSAADL+P F+G+++P
Sbjct  9    RLSLIFLCL-VGLGLGHALKVPFKVKDLLPALPHQVSWPVLNNLHSAADLLPYFIGSVSP  67

Query  335  NNGSIRWKGSCFFENEARVELNGS--GDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRV  508
            NNGSI WKG+CF+ NEAR+EL  S   D D+GG  +YL T+ AHSWTCMDLYVFATP R+
Sbjct  68   NNGSIEWKGACFYGNEARLELTQSNRNDPDLGGGVLYLKTSEAHSWTCMDLYVFATPYRI  127

Query  509  TW  514
            TW
Sbjct  128  TW  129



>gb|EYU28651.1| hypothetical protein MIMGU_mgv1a004456mg [Erythranthe guttata]
Length=526

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  179  LGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWK  358
            LGLGF FG A KVPFRVNDVLPVLPRQISWPVLN+ HSA DL+P ++G+L+PNNG+I WK
Sbjct  20   LGLGFDFGDALKVPFRVNDVLPVLPRQISWPVLNNIHSAVDLLPQYIGSLSPNNGTINWK  79

Query  359  GSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            G+CFF+NEA++E  G+GDR IGG  I+LSTAAAHSWTCMDLYVFATP RVTW
Sbjct  80   GACFFDNEAKIEFVGAGDRGIGGGVIHLSTAAAHSWTCMDLYVFATPYRVTW  131



>ref|XP_007044484.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
 gb|EOY00316.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
Length=527

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = +2

Query  158  LTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+L   VLGLGFG  FG AFKVPFRV DVLPVLPRQISWPVLN+ H+  DL+P FVG++ 
Sbjct  10   LSLFFCVLGLGFGVDFGQAFKVPFRVKDVLPVLPRQISWPVLNNLHTPVDLLPAFVGSVT  69

Query  332  PNNGSIRWKGSCFFENEARVELNGS--GDRDIGGATIYLSTAAAHSWTCMDLYVFATPXR  505
            PNNGS+ WKG+CF+ NEAR+E   +   D  +GG  +YL+T+ AHSWTCMDLYVFATP R
Sbjct  70   PNNGSVEWKGACFYGNEARLEFTKTDRNDSRLGGGVLYLTTSEAHSWTCMDLYVFATPYR  129

Query  506  VTW  514
            +TW
Sbjct  130  ITW  132



>ref|XP_002520208.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42263.1| conserved hypothetical protein [Ricinus communis]
Length=527

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 94/116 (81%), Gaps = 6/116 (5%)
 Frame = +2

Query  182  GLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            GLGFG  +G A KVPFR  DVLPVLPRQISWPVLN+ HS  DL+P FVG+L PNNGSI+W
Sbjct  18   GLGFGCNYGEALKVPFRAKDVLPVLPRQISWPVLNNIHSPVDLLPYFVGSLGPNNGSIQW  77

Query  356  KGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CFFENEAR++   S DR+   +GG  IYL T+AAHSWTCMDLYVFATP RVTW
Sbjct  78   KGACFFENEARIDFVES-DRNQSQLGGGVIYLKTSAAHSWTCMDLYVFATPYRVTW  132



>ref|XP_011086470.1| PREDICTED: uncharacterized protein LOC105168199 [Sesamum indicum]
Length=528

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A KVPFRV DVLPVLPRQ+SWPV+N+ HSA DL+P ++G+LAPNNG+I+WKG+CF +NE
Sbjct  30   DALKVPFRVKDVLPVLPRQVSWPVMNNIHSAVDLLPQYIGSLAPNNGTIKWKGACFLDNE  89

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E   +GDR IGG  +++STAAAHSWTCMDLYVFATP RVTW
Sbjct  90   ANIEFTAAGDRGIGGGILHVSTAAAHSWTCMDLYVFATPYRVTW  133



>ref|XP_010100527.1| hypothetical protein L484_027842 [Morus notabilis]
 gb|EXB82661.1| hypothetical protein L484_027842 [Morus notabilis]
Length=443

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 3/122 (2%)
 Frame = +2

Query  155  RLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP  334
            RL+L+   L +G G G A KVPF+V D+LP LP Q+SWPVLN+ HSAADL+P F+G+++P
Sbjct  9    RLSLIFLCL-VGLGLGHALKVPFKVKDLLPALPHQVSWPVLNNLHSAADLLPYFIGSVSP  67

Query  335  NNGSIRWKGSCFFENEARVELNGS--GDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRV  508
            NNGSI WKG+CF+ NEAR+EL  S   D D+GG  +YL T+ AHSWTCMDLYVFATP R+
Sbjct  68   NNGSIEWKGACFYGNEARLELTQSNRNDPDLGGGVLYLKTSEAHSWTCMDLYVFATPYRI  127

Query  509  TW  514
            TW
Sbjct  128  TW  129



>ref|XP_003613417.1| hypothetical protein MTR_5g036420 [Medicago truncatula]
 gb|AES96375.1| plant/F10M23-360 protein [Medicago truncatula]
Length=522

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP-  334
            L +LI V  L   FG +FKVPFRVNDVLPVLP++ISWPVLN+FHSA DL+P FVG++ P 
Sbjct  8    LAILI-VTSLLSSFGDSFKVPFRVNDVLPVLPKEISWPVLNNFHSAVDLLPSFVGSVTPY  66

Query  335  NNGSIRWKGSCFFENEARVELNGSG-DRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVT  511
            NNGSI+WKG+CFF+N+A++E    G D D+GGA +YL T  AHSWTCMDLYVFATP R+T
Sbjct  67   NNGSIQWKGACFFDNQAKLEFTNHGDDSDLGGAVLYLKTGEAHSWTCMDLYVFATPYRIT  126

Query  512  W  514
            W
Sbjct  127  W  127



>ref|XP_010683317.1| PREDICTED: uncharacterized protein LOC104898021 [Beta vulgaris 
subsp. vulgaris]
Length=531

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +2

Query  191  FGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP-NNGSIRWKGSC  367
               G A KVPFR+NDVLPVLPRQISWPVLN+ HSA DL+P FVG++ P NN SI+WKG+C
Sbjct  28   LNLGEALKVPFRINDVLPVLPRQISWPVLNNLHSAVDLLPSFVGSVTPQNNDSIKWKGAC  87

Query  368  FFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            FFEN AR+E   +GD+ +GG  ++L+TA+AHSWTCMDLYVFATP RVTW
Sbjct  88   FFENSARLEFTDTGDKGLGGGVLHLTTASAHSWTCMDLYVFATPYRVTW  136



>gb|KDO82639.1| hypothetical protein CISIN_1g0101751mg, partial [Citrus sinensis]
 gb|KDO82640.1| hypothetical protein CISIN_1g0101751mg, partial [Citrus sinensis]
 gb|KDO82641.1| hypothetical protein CISIN_1g0101751mg, partial [Citrus sinensis]
 gb|KDO82642.1| hypothetical protein CISIN_1g0101751mg, partial [Citrus sinensis]
 gb|KDO82643.1| hypothetical protein CISIN_1g0101751mg, partial [Citrus sinensis]
Length=348

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
              FKVPFRVNDVLPVLPRQ+SWPVLN+FHSA DL+P +VG++ PNNGSI WKG+CF+ NE
Sbjct  19   QGFKVPFRVNDVLPVLPRQLSWPVLNNFHSAVDLLPYYVGSVTPNNGSIDWKGACFYGNE  78

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR+E    GDR+  G  +YL T+ AHSWTCMDLYVFATP RVTW
Sbjct  79   ARLEFT-EGDREPAGGILYLKTSDAHSWTCMDLYVFATPYRVTW  121



>gb|KDO82638.1| hypothetical protein CISIN_1g0101751mg [Citrus sinensis]
Length=365

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 86/104 (83%), Gaps = 1/104 (1%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
              FKVPFRVNDVLPVLPRQ+SWPVLN+FHSA DL+P +VG++ PNNGSI WKG+CF+ NE
Sbjct  19   QGFKVPFRVNDVLPVLPRQLSWPVLNNFHSAVDLLPYYVGSVTPNNGSIDWKGACFYGNE  78

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR+E    GDR+  G  +YL T+ AHSWTCMDLYVFATP RVTW
Sbjct  79   ARLEFT-EGDREPAGGILYLKTSDAHSWTCMDLYVFATPYRVTW  121



>ref|XP_008446261.1| PREDICTED: uncharacterized protein LOC103489044 [Cucumis melo]
Length=524

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPN  337
            L L  + LG G   G A K+PFR NDVLPVLPRQISWPVLN+ H+A DL+P +VG++ P+
Sbjct  12   LVLCCFALGFGANLGRALKLPFRANDVLPVLPRQISWPVLNNLHTAVDLLPSYVGSVTPS  71

Query  338  NGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NG+I WKG+CFF NEA++ L   GDR +GG  + L T+AAHSWTCMDLYVFATP R+TW
Sbjct  72   NGTIEWKGACFFTNEAQINLT-EGDRGLGGGVLRLKTSAAHSWTCMDLYVFATPYRITW  129



>ref|XP_004135222.1| PREDICTED: uncharacterized protein LOC101209749 [Cucumis sativus]
 ref|XP_004155340.1| PREDICTED: uncharacterized LOC101209749 [Cucumis sativus]
 gb|KGN51842.1| hypothetical protein Csa_5G603390 [Cucumis sativus]
Length=524

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPN  337
            L L  + L  G   G A K+PFR NDVLPVLPRQISWPVLN+ H+A DL+P +VG++ P+
Sbjct  12   LVLCCFALAFGANLGRALKLPFRANDVLPVLPRQISWPVLNNLHTAVDLLPSYVGSVTPS  71

Query  338  NGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NG+I WKG+CFF NEA++ L   GDR +GG  + L T+AAHSWTCMDLYVFATP R+TW
Sbjct  72   NGTIEWKGACFFTNEAQINLT-EGDRGLGGGVLRLKTSAAHSWTCMDLYVFATPYRITW  129



>gb|AGV54795.1| hypothetical protein [Phaseolus vulgaris]
Length=522

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = +2

Query  146  RQLRLTLLIWVLG--LGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFV  319
            R+LR  +  W++   LG   G   KVPFRVNDVLPVLPRQISWPVLN+ HSA DL+P FV
Sbjct  7    RRLRHAVAAWMVIALLGCEVGEGLKVPFRVNDVLPVLPRQISWPVLNNLHSAVDLLPYFV  66

Query  320  GTLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATP  499
            G+L P+N SI+WKG+CFF+N A ++L  +    + GA IYL T AAHSWTCMDLYVFATP
Sbjct  67   GSLTPSNASIKWKGACFFDNTANIQLTPA----LEGAVIYLKTEAAHSWTCMDLYVFATP  122

Query  500  XRVTW  514
             R+TW
Sbjct  123  YRITW  127



>ref|XP_010272087.1| PREDICTED: uncharacterized protein LOC104607980 isoform X2 [Nelumbo 
nucifera]
Length=500

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +2

Query  164  LLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNG  343
            L    LG G   G A KVPFRV DVLPVLPRQ+SWPVLN+ HSA DL+P FVG+++PNN 
Sbjct  18   LFFLALGTGLDSGHALKVPFRVKDVLPVLPRQVSWPVLNTIHSAVDLLPSFVGSVSPNNA  77

Query  344  SIRWKGSCFFENEARVELNG--SGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            S +WKG+CF+ NEAR E     + ++ +GG  IYL+T  AHSWTCMDLYVFATP RVTW
Sbjct  78   STKWKGACFYGNEARFEFTSGKTDEKGLGGGIIYLTTGEAHSWTCMDLYVFATPYRVTW  136



>ref|XP_007153681.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
 gb|ESW25675.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
Length=522

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = +2

Query  146  RQLRLTLLIWVLG--LGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFV  319
            R+LR  +  W++   LG   G   KVPFRVNDVLPVLPRQISWPVLN+ HSA DL+P FV
Sbjct  7    RRLRHAVAAWMVIALLGCEVGEGLKVPFRVNDVLPVLPRQISWPVLNNLHSAVDLLPYFV  66

Query  320  GTLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATP  499
            G+L P+N SI+WKG+CFF+N A ++L  +    + GA IYL T AAHSWTCMDLYVFATP
Sbjct  67   GSLTPSNASIKWKGACFFDNTANIQLTPA----LEGAVIYLKTEAAHSWTCMDLYVFATP  122

Query  500  XRVTW  514
             R+TW
Sbjct  123  YRITW  127



>ref|XP_010272086.1| PREDICTED: uncharacterized protein LOC104607980 isoform X1 [Nelumbo 
nucifera]
Length=531

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +2

Query  164  LLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNG  343
            L    LG G   G A KVPFRV DVLPVLPRQ+SWPVLN+ HSA DL+P FVG+++PNN 
Sbjct  18   LFFLALGTGLDSGHALKVPFRVKDVLPVLPRQVSWPVLNTIHSAVDLLPSFVGSVSPNNA  77

Query  344  SIRWKGSCFFENEARVELNG--SGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            S +WKG+CF+ NEAR E     + ++ +GG  IYL+T  AHSWTCMDLYVFATP RVTW
Sbjct  78   STKWKGACFYGNEARFEFTSGKTDEKGLGGGIIYLTTGEAHSWTCMDLYVFATPYRVTW  136



>ref|XP_006438500.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 gb|ESR51740.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=473

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
              FKVPFRVNDVLPVLPRQ+SWPVLN+FHSA DL+P +VG++ PNNGSI WKG+CF+ NE
Sbjct  19   QGFKVPFRVNDVLPVLPRQLSWPVLNNFHSAVDLLPYYVGSVTPNNGSIEWKGACFYGNE  78

Query  383  ARVEL-NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR+E   G  +  +GG  +YL T+ AHSWTCMDLYVFATP RVTW
Sbjct  79   ARLEFTEGDLEPALGGGILYLKTSDAHSWTCMDLYVFATPYRVTW  123



>gb|KDP21286.1| hypothetical protein JCGZ_21757 [Jatropha curcas]
Length=529

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 100/127 (79%), Gaps = 7/127 (6%)
 Frame = +2

Query  152  LRLTLLIWV-LGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG  322
            L L L+++  LGLG G  +G A KVPFRV D+LPVLPR+ISWPVLN+ H+  DL+P FVG
Sbjct  9    LHLVLVLFCFLGLGSGSIYGEALKVPFRVKDLLPVLPREISWPVLNNLHNPVDLLPYFVG  68

Query  323  TLAPNNGSIRWKGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFA  493
            ++ P NGSI+WKG+CF+ENEAR++    GDR+   +GG  +++ T+AAHSWTCMDLYVFA
Sbjct  69   SVTPQNGSIQWKGACFYENEARIDFT-EGDRNQSGLGGGVLHVKTSAAHSWTCMDLYVFA  127

Query  494  TPXRVTW  514
            TP R+TW
Sbjct  128  TPYRITW  134



>ref|XP_006438501.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 ref|XP_006483762.1| PREDICTED: uncharacterized protein LOC102615522 [Citrus sinensis]
 gb|ESR51741.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=518

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
              FKVPFRVNDVLPVLPRQ+SWPVLN+FHSA DL+P +VG++ PNNGSI WKG+CF+ NE
Sbjct  19   QGFKVPFRVNDVLPVLPRQLSWPVLNNFHSAVDLLPYYVGSVTPNNGSIEWKGACFYGNE  78

Query  383  ARVEL-NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR+E   G  +  +GG  +YL T+ AHSWTCMDLYVFATP RVTW
Sbjct  79   ARLEFTEGDLEPALGGGILYLKTSDAHSWTCMDLYVFATPYRVTW  123



>ref|XP_003552001.1| PREDICTED: uncharacterized protein LOC100815535 [Glycine max]
 gb|KHN28269.1| hypothetical protein glysoja_040924 [Glycine soja]
Length=531

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 88/113 (78%), Gaps = 4/113 (4%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            +L  G   G A KVPFRVNDVLPVLPR+ISWPVLN+ HSA DL+P FVG+L P N S++W
Sbjct  28   LLSFGCERGHALKVPFRVNDVLPVLPREISWPVLNNLHSAVDLLPYFVGSLTPANASVKW  87

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CFF+N A++E   S    + GAT+YL T AAHSWTCMDLYVFATP R+TW
Sbjct  88   KGACFFDNTAKIEFAPS----LEGATLYLKTEAAHSWTCMDLYVFATPYRITW  136



>gb|EPS62473.1| hypothetical protein M569_12317, partial [Genlisea aurea]
Length=251

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            AF+VPFRV DVLPVLP +ISWPV+N+ HSA DL+P +VG+LAP+NG++ W GSCF +N A
Sbjct  2    AFQVPFRVKDVLPVLPHEISWPVMNNLHSAVDLLPKYVGSLAPSNGTVSWTGSCFRDNTA  61

Query  386  RVELNG-SGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E+   +GDR IGG  I +ST AAHSWTCMDLYVFATP RVTW
Sbjct  62   VIEVTARAGDRGIGGGVIRISTGAAHSWTCMDLYVFATPYRVTW  105



>ref|XP_008339979.1| PREDICTED: uncharacterized protein LOC103402967 [Malus domestica]
Length=526

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 4/110 (4%)
 Frame = +2

Query  194  GFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFF  373
            GFG A KVP R+ DVLPVLPRQISWPVLN+FHSA DL+P F+G++ P+N SI+W G+CF 
Sbjct  23   GFGDALKVPLRIKDVLPVLPRQISWPVLNNFHSAVDLLPSFIGSVTPDNSSIQWDGACFS  82

Query  374  ENEARVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             N+AR+E    GDR   D+GG  +YL T+ AHSW CMDLYVFATP R+TW
Sbjct  83   GNQARLEFT-EGDRGKPDLGGGVLYLKTSEAHSWACMDLYVFATPYRITW  131



>ref|XP_004297675.1| PREDICTED: uncharacterized protein LOC101296656 [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
             SA KVP R+ DVLPVLPRQISWPVLN+FHSA DL+P F+G+++PNN SI+W+G+CF  N
Sbjct  18   ASALKVPLRIKDVLPVLPRQISWPVLNNFHSAVDLLPSFIGSVSPNNDSIQWEGACFSGN  77

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            EAR+E    GDR +GG  +YL T+ AHSW CMDLYVFATP R+TW
Sbjct  78   EARLEF-VEGDRGLGGGVLYLRTSEAHSWACMDLYVFATPYRITW  121



>dbj|BAJ33873.1| unnamed protein product [Thellungiella halophila]
Length=521

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFHSA DL+P+F+G++ PNN S+ WKG+CF  
Sbjct  27   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHSAVDLLPVFIGSVTPNNASLEWKGACFHG  86

Query  377  NEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD   +GG  ++L T+ AHS TCMD+YVFATP R+TW
Sbjct  87   NEARLDITGS-DRDEPGLGGGVLHLKTSEAHSLTCMDIYVFATPYRITW  134



>ref|XP_006300446.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
 gb|EOA33344.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
Length=531

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+F+G+++PNN S+ WKG+CF  
Sbjct  29   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVFIGSVSPNNASLEWKGACFNG  88

Query  377  NEARVELNGSGDRDI---GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD+   GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  89   NEARLDITGS-DRDVPGLGGGVLHLKTSKAHSLTCMDLYVFATPYRITW  136



>ref|XP_011015682.1| PREDICTED: uncharacterized protein LOC105119255 [Populus euphratica]
Length=540

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 3/109 (3%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
            +  AFKVPFRV DVLPVLP QISWPVLN+ HSA DL+P FVG+++P+NG+++WKG+CF++
Sbjct  37   YVEAFKVPFRVKDVLPVLPHQISWPVLNNLHSAVDLLPYFVGSVSPDNGTLQWKGACFYD  96

Query  377  NEARVELN-GSGDRD--IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR++ +    D D  +GG  + L T+AAHSWTCMDLYVFATP RVTW
Sbjct  97   NEARLDFSLADSDHDPALGGGLLRLKTSAAHSWTCMDLYVFATPYRVTW  145



>ref|XP_006856897.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
 gb|ERN18364.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
Length=526

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G A KVPFRV DVLPVLPRQ+SWPVLN+ HSA DL+P +VG++ P    + WKG+CF+ 
Sbjct  25   LGQALKVPFRVKDVLPVLPRQVSWPVLNTLHSAVDLLPYYVGSVTPQGEKVEWKGACFYG  84

Query  377  NEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEA ++   S   ++GG  IY+ TA AHSWTCMDLYVFATP RVTW
Sbjct  85   NEAHLKFTDSEKDELGGGVIYVKTAEAHSWTCMDLYVFATPYRVTW  130



>ref|XP_006378188.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55985.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=552

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 3/109 (3%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
            +  AFKVPFRV DVLPVLP QISWPVLN+ HSA DL+P FVG+++P+NG+++WKG+CF++
Sbjct  37   YVEAFKVPFRVKDVLPVLPHQISWPVLNNLHSAVDLLPYFVGSVSPDNGTLQWKGACFYD  96

Query  377  NEARVEL---NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR++    +   D  +GG  + L T+AAHSWTCMDLYVFATP RVTW
Sbjct  97   NEARLDFALADSDHDPALGGGLLRLKTSAAHSWTCMDLYVFATPYRVTW  145



>ref|XP_006390921.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
 gb|ESQ28207.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
Length=529

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFHSA DL+P+F+G++ PNN S+ WKG+CF  
Sbjct  27   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHSAVDLLPVFIGSVTPNNASLEWKGACFHG  86

Query  377  NEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD   +GG  ++L T+ AHS TCMD+YVFATP R+TW
Sbjct  87   NEARLDITGS-DRDEPGLGGGVLHLKTSEAHSLTCMDIYVFATPYRITW  134



>ref|XP_010471012.1| PREDICTED: uncharacterized protein LOC104750861 [Camelina sativa]
Length=532

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+F+G++ PNN S+ WKG+CF  
Sbjct  30   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVFIGSVTPNNASLEWKGACFNG  89

Query  377  NEARVELNGSGDRDI---GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD+   GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  90   NEARLDITGS-DRDVPGLGGGVLHLKTSKAHSLTCMDLYVFATPYRITW  137



>ref|XP_010415693.1| PREDICTED: uncharacterized protein LOC104701657 [Camelina sativa]
Length=531

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+F+G++ PNN S+ WKG+CF  
Sbjct  29   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVFIGSVTPNNASLEWKGACFNG  88

Query  377  NEARVELNGSGDRDI---GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD+   GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  89   NEARLDITGS-DRDVPGLGGGVLHLKTSKAHSLTCMDLYVFATPYRITW  136



>ref|XP_011012739.1| PREDICTED: uncharacterized protein LOC105116927 [Populus euphratica]
Length=540

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             AFKVPFRV DVLPVLP QISWPVLN+ HSA DL+P FVG+++P+NG+++WKG+CF++NE
Sbjct  39   EAFKVPFRVKDVLPVLPHQISWPVLNNLHSAVDLLPYFVGSVSPDNGTLQWKGACFYDNE  98

Query  383  ARVELN-GSGDRD--IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR++ +    D D  +GG  + L T+AAHSWTCMDLYVFATP RVTW
Sbjct  99   ARLDFSLADSDHDPALGGGLLRLKTSAAHSWTCMDLYVFATPYRVTW  145



>ref|XP_010533011.1| PREDICTED: uncharacterized protein LOC104808873 [Tarenaya hassleriana]
Length=530

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPN  337
            L L I  LGLG   G AFKVPFRVNDVLPVLP QISWPVLN+FHSA DL+P+FVG++ P 
Sbjct  15   LFLCISGLGLGVDRGEAFKVPFRVNDVLPVLPGQISWPVLNNFHSAVDLLPVFVGSVTPT  74

Query  338  NGSIRWKGSCFFENEARVELNGSGDRD--IGGATIYLSTAAAHSWTCMDLYVFATPXRVT  511
            NGS+ WKG+CF  NEAR+E+  S   +  +GG  ++L T+ AHSWTCMDLYVFATP R+T
Sbjct  75   NGSLVWKGACFHGNEARLEITHSDRHEPGLGGGLLHLKTSEAHSWTCMDLYVFATPYRIT  134

Query  512  W  514
            W
Sbjct  135  W  135



>ref|XP_010512094.1| PREDICTED: uncharacterized protein LOC104788107 [Camelina sativa]
Length=531

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+F+G++ PNN S+ WKG+CF  
Sbjct  29   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVFIGSVTPNNASLEWKGACFNG  88

Query  377  NEARVELNGSGDRDI---GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD+   GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  89   NEARLDITGS-DRDVPGLGGGVLHLKTSKAHSLTCMDLYVFATPYRITW  136



>ref|NP_564985.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK25910.1|AF360200_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93691.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35026.1| uncharacterized protein AT1G70160 [Arabidopsis thaliana]
Length=523

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+F+G++ PNN SI WKG+CF  
Sbjct  21   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVFIGSVTPNNVSIEWKGACFNG  80

Query  377  NEARVELNGSGDRDI---GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD+   GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  81   NEARLDITGS-DRDVPGLGGGVLHLKTSKAHSLTCMDLYVFATPYRITW  128



>ref|XP_008244965.1| PREDICTED: uncharacterized protein LOC103343066 [Prunus mume]
Length=526

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 84/109 (77%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
            FG A KVP R+ DVLPVLPRQISWPVLN+FHSA DL+P F+G++ P+N SI W+G+CF  
Sbjct  24   FGDALKVPLRIKDVLPVLPRQISWPVLNNFHSAVDLLPSFIGSVTPDNTSIEWEGACFSG  83

Query  377  NEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            N AR+E    GDRD   +GG  +YL T+ AHSW CMDLYVFATP R+TW
Sbjct  84   NRARLEFT-EGDRDKPNLGGGVLYLKTSEAHSWACMDLYVFATPYRITW  131



>ref|XP_004504499.1| PREDICTED: uncharacterized protein LOC101510072 [Cicer arietinum]
Length=520

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 4/106 (4%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            + KVPFRVNDVLPVLP  ISWPVLN+FH+A DL+P FVG++ P NGSI WKG+CF++N+A
Sbjct  21   SLKVPFRVNDVLPVLPHGISWPVLNNFHTAVDLLPSFVGSVTPYNGSIEWKGACFYDNQA  80

Query  386  RVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            ++E   +GD D   +GGA +YL T  AHSWTCMDLYVFATP R+TW
Sbjct  81   KLEFT-AGDADASALGGAILYLKTGEAHSWTCMDLYVFATPYRITW  125



>ref|XP_002887283.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63542.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+F+G++ PNN SI WKG+CF  
Sbjct  23   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVFIGSVTPNNVSIEWKGACFNG  82

Query  377  NEARVELNGSGDRDI---GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+++ GS DRD+   GG  ++L ++ AHS TCMDLYVFATP R+TW
Sbjct  83   NEARLDITGS-DRDVPGLGGGVLHLKSSKAHSLTCMDLYVFATPYRITW  130



>ref|XP_008389573.1| PREDICTED: uncharacterized protein LOC103451910 [Malus domestica]
Length=526

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A KVP R+ DVLPVLPRQISWPVLN+FHSA DL+P F+G + P+N SI+W+G+CF  N+
Sbjct  26   DALKVPLRIKDVLPVLPRQISWPVLNNFHSAVDLLPSFIGAVTPDNSSIQWEGACFSGNQ  85

Query  383  ARVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR+E    GDR   D+GG  +YL T+ AHSW CMDLYVFATP R+TW
Sbjct  86   ARLEFT-EGDRGKPDLGGGVLYLKTSEAHSWACMDLYVFATPYRITW  131



>ref|XP_009360447.1| PREDICTED: uncharacterized protein LOC103950916 [Pyrus x bretschneideri]
Length=527

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A KVP R+ DVLPVLPRQISWPVLN+FHSA DL+P F+G + P+N SI+W+G+CF  N+
Sbjct  26   DALKVPLRIKDVLPVLPRQISWPVLNNFHSAVDLLPSFIGAVTPDNSSIQWEGACFSGNQ  85

Query  383  ARVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR+E    GDR   D+GG  +YL T+ AHSW CMDLYVFATP R+TW
Sbjct  86   ARLEFT-EGDRGKSDLGGGVLYLKTSEAHSWACMDLYVFATPYRITW  131



>ref|XP_009419908.1| PREDICTED: uncharacterized protein LOC103999784 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=537

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = +2

Query  179  LGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWK  358
             GL     +A KVPFRV DVLP+LP QISWPV+N+ HSA DL+P FVG++ P  G++ WK
Sbjct  26   FGLADSVAAALKVPFRVKDVLPILPHQISWPVMNNLHSAVDLLPSFVGSVVPGAGTVGWK  85

Query  359  GSCFFENEARVELN-----GSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            G+CFFENEAR++       G  +  + G  ++L T AAHSWTCMDLYVFATP R+ W
Sbjct  86   GACFFENEARLDFTEHVSGGGNESSLNGGILHLKTDAAHSWTCMDLYVFATPYRIMW  142



>ref|XP_009419909.1| PREDICTED: uncharacterized protein LOC103999784 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = +2

Query  179  LGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWK  358
             GL     +A KVPFRV DVLP+LP QISWPV+N+ HSA DL+P FVG++ P  G++ WK
Sbjct  26   FGLADSVAAALKVPFRVKDVLPILPHQISWPVMNNLHSAVDLLPSFVGSVVPGAGTVGWK  85

Query  359  GSCFFENEARVELN-----GSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            G+CFFENEAR++       G  +  + G  ++L T AAHSWTCMDLYVFATP R+ W
Sbjct  86   GACFFENEARLDFTEHVSGGGNESSLNGGILHLKTDAAHSWTCMDLYVFATPYRIMW  142



>ref|XP_007222590.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
 gb|EMJ23789.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
Length=526

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 82/107 (77%), Gaps = 4/107 (4%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A KVP R+ DVLPVLPRQISWPVLN+FHSA DL+P F+G++  +N SI W+G+CF  N+
Sbjct  26   DALKVPLRIKDVLPVLPRQISWPVLNNFHSAVDLLPSFIGSVTADNTSIEWEGACFSGNQ  85

Query  383  ARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            AR+E    GDRD   +GG  +YL T+ AHSW CMDLYVFATP R+TW
Sbjct  86   ARLEFT-EGDRDKPNLGGGVLYLKTSEAHSWACMDLYVFATPYRITW  131



>ref|XP_010043827.1| PREDICTED: uncharacterized protein LOC104432932 [Eucalyptus grandis]
 gb|KCW85832.1| hypothetical protein EUGRSUZ_B02569 [Eucalyptus grandis]
Length=534

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 7/119 (6%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            +LG        FKVPF+VNDVLPVLPRQISWPVLNSF+ A DL+P FVGT+AP N  +RW
Sbjct  22   ILGFLGDRALGFKVPFKVNDVLPVLPRQISWPVLNSFNGAVDLLPSFVGTVAPGNEPLRW  81

Query  356  KGSCFFENEARVELNGSGDR------DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             G+CF  N+AR+E    GDR       +GG  +YL T+  HSWTCMDLYVFATP R+TW
Sbjct  82   NGTCFDGNDARLEFT-EGDRGGDEEPGLGGGVLYLKTSEPHSWTCMDLYVFATPYRITW  139



>ref|XP_003517865.1| PREDICTED: uncharacterized protein LOC100805887 [Glycine max]
Length=518

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 5/103 (5%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PFRVNDVLPVLP  ISWP+LN+ HSA DL+P FVG + P+NGS++WKG+CF++N+A
Sbjct  26   ALKLPFRVNDVLPVLPHGISWPLLNNLHSAVDLLPSFVGAVTPDNGSLQWKGACFYDNQA  85

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E         GGA ++L T AAHSWTCMDLYVFATP R+TW
Sbjct  86   SLEFTAP-----GGAVLHLKTEAAHSWTCMDLYVFATPYRITW  123



>ref|XP_003519794.1| PREDICTED: uncharacterized protein LOC100779863 [Glycine max]
 gb|KHN28683.1| hypothetical protein glysoja_025417 [Glycine soja]
Length=520

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  185  LGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGS  364
            L  G   A KVPFRVNDVLPVLP  ISWP+LN+ HSA DL+P FV  + P+N S++W+ +
Sbjct  13   LFLGSAHALKVPFRVNDVLPVLPHGISWPLLNNLHSAVDLLPSFVAAVPPDNDSVQWRAA  72

Query  365  CFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            CF++N+A +E    G  D   +GGA + L T AAHSWTCMDLYVFATP R+TW
Sbjct  73   CFYDNQASLEFTAPGHDDADGLGGAVLRLKTEAAHSWTCMDLYVFATPYRITW  125



>ref|XP_010913435.1| PREDICTED: uncharacterized protein LOC105039122 isoform X2 [Elaeis 
guineensis]
Length=453

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 84/117 (72%), Gaps = 9/117 (8%)
 Frame = +2

Query  191  FGFGS--------AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGS  346
            FG+GS        A KVPFRV DVLP+LPRQISWPVLN+ HSA DL+P FVG + P  GS
Sbjct  23   FGWGSFSSRSQAHALKVPFRVKDVLPILPRQISWPVLNNLHSAVDLLPAFVGAVLPEGGS  82

Query  347  IRWKGSCFFENEARVEL-NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            I WKG+CFFENEAR E  N S +  + G  + L T AAHSWTCMDLYVFATP R+ W
Sbjct  83   IGWKGACFFENEARFEFTNTSDEHGLLGGLLRLKTDAAHSWTCMDLYVFATPYRIMW  139



>ref|XP_010913432.1| PREDICTED: uncharacterized protein LOC105039122 isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 84/117 (72%), Gaps = 9/117 (8%)
 Frame = +2

Query  191  FGFGS--------AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGS  346
            FG+GS        A KVPFRV DVLP+LPRQISWPVLN+ HSA DL+P FVG + P  GS
Sbjct  23   FGWGSFSSRSQAHALKVPFRVKDVLPILPRQISWPVLNNLHSAVDLLPAFVGAVLPEGGS  82

Query  347  IRWKGSCFFENEARVEL-NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            I WKG+CFFENEAR E  N S +  + G  + L T AAHSWTCMDLYVFATP R+ W
Sbjct  83   IGWKGACFFENEARFEFTNTSDEHGLLGGLLRLKTDAAHSWTCMDLYVFATPYRIMW  139



>ref|XP_008798032.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713048 
[Phoenix dactylifera]
Length=539

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A KVPFRV DVLP+LPRQISWPVLN+ HSA DL+P FVG + P  GSI WKGSCFFENEA
Sbjct  41   ALKVPFRVKDVLPILPRQISWPVLNNLHSAVDLLPAFVGAVVPEGGSIEWKGSCFFENEA  100

Query  386  RVELNGSGDR-DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            R E + + D   + G  + L T A HSWTCMDLYVFATP R+ W
Sbjct  101  RFEFSNTSDEAGLLGGLLRLKTDAPHSWTCMDLYVFATPYRIMW  144



>gb|KHN01126.1| hypothetical protein glysoja_008028 [Glycine soja]
Length=518

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 5/103 (5%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PFRVNDVLPVLP  ISWP+LN+ HSA DL+  FVG + P+NGS++WKG+CF++N+A
Sbjct  26   ALKLPFRVNDVLPVLPHGISWPLLNNLHSAVDLLVSFVGAVTPDNGSLQWKGACFYDNQA  85

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E         GGA ++L T AAHSWTCMDLYVFATP R+TW
Sbjct  86   SLEFTAP-----GGAVLHLKTEAAHSWTCMDLYVFATPYRITW  123



>emb|CDY38797.1| BnaA07g28690D [Brassica napus]
Length=523

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +2

Query  152  LRLTLLIWVLGLGFG--FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGT  325
            L   L+  +LGL F    G + KVPF VNDVLP+LPRQ+SWPVLNSFHSA DL+P+FVG+
Sbjct  3    LTRNLIYLLLGLAFSVDLGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHSAVDLLPVFVGS  62

Query  326  LAP-NNGSIRWKGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFA  493
            + P NN S+ WKG+CF  NEAR+++  S DRD   +GG  ++L T+ AHS TCMDLYVFA
Sbjct  63   VTPNNNASLEWKGACFKGNEARLDITVS-DRDEPGLGGGLLHLKTSEAHSLTCMDLYVFA  121

Query  494  TPXRVTW  514
            TP R+TW
Sbjct  122  TPYRITW  128



>ref|XP_010545218.1| PREDICTED: uncharacterized protein LOC104817662 [Tarenaya hassleriana]
Length=524

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            VL L      + K+PF   D+LPVLPRQ+SWP+LNS +SA DL+P FVG+ +P N +++W
Sbjct  14   VLLLAIPSSESVKLPFHPRDLLPVLPRQVSWPILNSLNSAVDLLPSFVGSASPQNDAVQW  73

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF+EN A +E + +   + GG T+++    AHSWTCMD+YVFATP RVTW
Sbjct  74   KGACFYENRAWLEFHNNSGSEFGGGTLHIKVDKAHSWTCMDIYVFATPYRVTW  126



>ref|XP_006858155.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
 gb|ERN19622.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
Length=526

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +2

Query  143  WRQLRLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG  322
            WR  R  L +++  L    G A+KVPFR NDVLP+LPRQ+SWP+LN   S  DL+P FVG
Sbjct  6    WRS-RTVLALFLSLLFCSTGFAWKVPFRPNDVLPLLPRQVSWPILNRLKSPIDLLPSFVG  64

Query  323  TLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPX  502
             ++ +N ++ WKG+CF+EN A +E         GG T+++ T+ AHSWTCMDLYVFATP 
Sbjct  65   AVSSSNATVEWKGACFYENTAWMEFKNENGSQWGGGTLHIKTSKAHSWTCMDLYVFATPY  124

Query  503  RVTW  514
            RVTW
Sbjct  125  RVTW  128



>gb|ABR17461.1| unknown [Picea sitchensis]
Length=520

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +2

Query  152  LRLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            LR+T+ + ++  G  F    KVPFR  D+LP LPRQ++WP+L+S H+A DL+P+FVG   
Sbjct  5    LRITVSLLLILYGIAFMDGLKVPFRPKDILPALPRQVAWPLLDSMHNAVDLLPLFVGAPG  64

Query  332  PNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVT  511
             NN S  WKG+CF++NEA ++   S   ++GG  +++ T+ AHSWTCMDLYVF TP RVT
Sbjct  65   VNN-SAEWKGACFYKNEAWMDFTTSNGSELGGGVLHIETSKAHSWTCMDLYVFVTPYRVT  123

Query  512  W  514
            W
Sbjct  124  W  124



>ref|XP_006378189.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55986.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=514

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 3/99 (3%)
 Frame = +2

Query  227  VNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVEL---  397
            V DVLPVLP QISWPVLN+ HSA DL+P FVG+++P+NG+++WKG+CF++NEAR++    
Sbjct  9    VKDVLPVLPHQISWPVLNNLHSAVDLLPYFVGSVSPDNGTLQWKGACFYDNEARLDFALA  68

Query  398  NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +   D  +GG  + L T+AAHSWTCMDLYVFATP RVTW
Sbjct  69   DSDHDPALGGGLLRLKTSAAHSWTCMDLYVFATPYRVTW  107



>gb|KDO62609.1| hypothetical protein CISIN_1g009605mg [Citrus sinensis]
Length=304

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            +A K PF   D+LPVLPRQ+SWP+LN+ + AADL+P FVG+ +   G++ WKG+CF++N+
Sbjct  31   NALKYPFHPRDILPVLPRQVSWPILNALNGAADLLPAFVGSASDQTGTVEWKGACFYQNQ  90

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E +     + GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  91   AWMEFHNKSGSEFGGGTLHIKVSDAHSWTCMDLYVFATPYRVTW  134



>emb|CDY06624.1| BnaC02g13480D [Brassica napus]
Length=610

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  IWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI  349
            I VL L      + K PF   D+LP+LP+Q+SWP+LNS + AADL+P F+GT +P N  +
Sbjct  18   IAVLILTASTAESLKSPFNPRDLLPLLPKQVSWPILNSLYGAADLLPTFIGTASPGNDDV  77

Query  350  RWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +WKG+CF+EN A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  78   KWKGACFYENTAYLEFHNKSGSEFGGGTLHIQADKAHSWTCMDLYVFATPYRVTW  132



>ref|XP_010267678.1| PREDICTED: uncharacterized protein LOC104604833 [Nelumbo nucifera]
Length=528

 Score =   138 bits (348),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 57/120 (48%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  155  RLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP  334
            R  +   +  L F  G A+K PF   D+LP+LPRQ+SWP+LNS  +A DL+P FVG  + 
Sbjct  12   RYLIFSLLFSLAFSHGYAWKAPFYPYDILPLLPRQVSWPILNSLRNAVDLLPTFVGAASS  71

Query  335  NNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +N ++ WKG+CF++N A +E +     + GG T+++ T+ AHSWTCMD+Y+F+TP RVTW
Sbjct  72   SNSTVEWKGACFYKNSAWMEFHNKSGSEFGGGTLHIKTSKAHSWTCMDIYIFSTPYRVTW  131



>ref|XP_009127775.1| PREDICTED: uncharacterized protein LOC103852633 [Brassica rapa]
Length=526

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 89/116 (77%), Gaps = 5/116 (4%)
 Frame = +2

Query  179  LGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP-NNGSIRW  355
            +G     G + KVPF V+DVLP+LPRQ+SWPVLNSFHSA DL+P+F+G+L P NN S+ W
Sbjct  17   VGFSVDLGQSLKVPFSVDDVLPMLPRQVSWPVLNSFHSAVDLLPVFIGSLTPNNNASLEW  76

Query  356  KGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF  NEAR+++  S DRD   +GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  77   KGACFHGNEARLDITPS-DRDDPGLGGGLLHLKTSEAHSLTCMDLYVFATPYRITW  131



>gb|KFK41436.1| hypothetical protein AALP_AA2G130200 [Arabis alpina]
Length=527

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 87/109 (80%), Gaps = 4/109 (4%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+F+G++ P+N S+ WKG+CF  
Sbjct  25   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVFIGSVTPDNVSLEWKGACFHG  84

Query  377  NEARVELNGSGDRDI---GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            N+AR+E+  S DR++   GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  85   NQARLEIT-SSDRNVPGLGGGLLHLKTSKAHSLTCMDLYVFATPYRITW  132



>gb|ABK24649.1| unknown [Picea sitchensis]
Length=521

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
                 K+PFR  DVLP+LPRQ+SWPVLN+ HSAADL+P+FVG+++     ++W GSCF  
Sbjct  21   LSEGLKMPFRPKDVLPMLPRQVSWPVLNTIHSAADLLPLFVGSVS-QEEIVQWNGSCFDG  79

Query  377  NEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NEAR+E       ++GG  +Y+ T+ AHSWTCMDLYVFATP RVTW
Sbjct  80   NEARMEFTDKERDELGGGVLYIKTSNAHSWTCMDLYVFATPFRVTW  125



>ref|XP_010433417.1| PREDICTED: uncharacterized protein LOC104717532 [Camelina sativa]
Length=523

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            S  K+PF   D+LP+LPRQ+SWPVLNS H+A DL+P F+G+ +  N ++ WKG+CF+EN+
Sbjct  23   SFVKLPFHPRDLLPILPRQVSWPVLNSLHTAVDLLPTFIGSASLENDAVEWKGACFYENK  82

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  83   AWLELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  126



>emb|CDY03761.1| BnaA02g14760D [Brassica napus]
Length=526

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 89/116 (77%), Gaps = 5/116 (4%)
 Frame = +2

Query  179  LGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP-NNGSIRW  355
            +G     G + KVPF V+DVLP+LPRQ+SWPVLNSFHSA DL+P+F+G+L P NN S+ W
Sbjct  17   VGFSVDLGQSLKVPFSVDDVLPMLPRQVSWPVLNSFHSAVDLLPVFIGSLTPNNNASLEW  76

Query  356  KGSCFFENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF  NEAR+++  S DRD   +GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  77   KGACFRGNEARLDITPS-DRDEPGLGGGLLHLKTSEAHSLTCMDLYVFATPYRITW  131



>ref|XP_010448183.1| PREDICTED: uncharacterized protein LOC104730687 [Camelina sativa]
Length=561

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            + K+PF   D+LP+LPRQ+SWPVLNS H+A DL+P F+G+ +  N ++ WKG+CF+EN+A
Sbjct  62   SVKLPFHPRDLLPILPRQVSWPVLNSLHTAVDLLPTFIGSASLKNDAVEWKGACFYENKA  121

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  122  WLELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  164



>emb|CDY42991.1| BnaC02g19650D [Brassica napus]
Length=529

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 5/110 (5%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP-NNGSIRWKGSCFF  373
             G + KVPF VNDVLP+LPRQ+SWPVLNSFHSA DL+P+F+G+L P NN S+ WKG+CF 
Sbjct  26   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHSAVDLLPVFIGSLTPNNNASLEWKGACFR  85

Query  374  ENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             NEAR+++  S DRD   +GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  86   GNEARLDITPS-DRDEPGLGGGLLHLKTSEAHSLTCMDLYVFATPYRITW  134



>ref|XP_007020906.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 2 [Theobroma 
cacao]
 gb|EOY12431.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 2 [Theobroma 
cacao]
Length=437

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A KVPF   DVLP+LPRQ+SWP+LNS  SA DL+P FVG+++  N  + WKG+CF+EN 
Sbjct  67   QAAKVPFHPRDVLPLLPRQVSWPILNSLSSAVDLLPAFVGSVSSQNRGVEWKGACFYENT  126

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E +       GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  127  AWMEFHNKSGSQFGGGTLHIKVSKAHSWTCMDLYVFATPYRVTW  170



>ref|XP_006280251.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
 gb|EOA13149.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
Length=563

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  IWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI  349
            I VL L      + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT +  N S+
Sbjct  52   ILVLFLIVSTAESVKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTASSENDSV  111

Query  350  RWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +WKG+CF+EN A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  112  QWKGACFYENTAMLEFHNKSGSEFGGGTLHIKADKAHSWTCMDLYVFATPYRVTW  166



>gb|AAK68839.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68255.1| At5g54870 [Arabidopsis thaliana]
Length=318

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT +  N S+ WKG+CFFEN 
Sbjct  31   ESVKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTASSGNDSVDWKGACFFENT  90

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  91   AWLEFHNKSGSEFGGGTLHIKADKAHSWTCMDLYVFATPYRVTW  134



>ref|XP_009105692.1| PREDICTED: uncharacterized protein LOC103831561 [Brassica rapa]
Length=526

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 5/110 (5%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAP-NNGSIRWKGSCFF  373
             G + KVPF VNDVLP+LPRQ+SWPVLNSFHSA DL+P+FVG++ P NN S+ WKG+CF 
Sbjct  23   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHSAVDLLPVFVGSVTPNNNASLEWKGACFK  82

Query  374  ENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             NEAR+++  S DRD   +GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  83   GNEARLDITVS-DRDEPGLGGGLLHLKTSEAHSLTCMDLYVFATPYRITW  131



>ref|XP_010448765.1| PREDICTED: uncharacterized protein LOC104731172 [Camelina sativa]
Length=536

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
              + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT +  N S++WKG+CFFEN
Sbjct  35   AESVKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTASSGNDSVQWKGACFFEN  94

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  95   TATLEFHNKSGSEFGGGTLHIKADKAHSWTCMDLYVFATPYRVTW  139



>gb|AAL09800.1| AT4g27020/F10M23_360 [Arabidopsis thaliana]
Length=222

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            S+ K+PF   D+LP+ PRQ+SWPV+NS ++A DL+P F+G+ +  N ++ WKG+CF+EN+
Sbjct  23   SSGKLPFHPRDLLPLFPRQVSWPVVNSLNTAVDLLPTFIGSASVRNDAVEWKGACFYENK  82

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  83   AWLELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  126



>ref|XP_007020905.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
 gb|EOY12430.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
Length=567

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A KVPF   DVLP+LPRQ+SWP+LNS  SA DL+P FVG+++  N  + WKG+CF+EN 
Sbjct  67   QAAKVPFHPRDVLPLLPRQVSWPILNSLSSAVDLLPAFVGSVSSQNRGVEWKGACFYENT  126

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E +       GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  127  AWMEFHNKSGSQFGGGTLHIKVSKAHSWTCMDLYVFATPYRVTW  170



>ref|XP_010276049.1| PREDICTED: uncharacterized protein LOC104610902 [Nelumbo nucifera]
Length=528

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            +L L F  G A+  PF   DVLP+LPRQISWPVLNS  SA DL+P FVG  +  N ++ W
Sbjct  19   LLSLVFSHGYAWNAPFHPLDVLPLLPRQISWPVLNSLRSAVDLLPTFVGAASSPNDTLNW  78

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG TI++  + AHSWTCMDLY+F TP RVTW
Sbjct  79   KGACFYKNRAWLEFHNKSGSEFGGGTIHIKNSHAHSWTCMDLYIFVTPYRVTW  131



>ref|XP_006475148.1| PREDICTED: uncharacterized protein LOC102609098 [Citrus sinensis]
 gb|KDO62608.1| hypothetical protein CISIN_1g009605mg [Citrus sinensis]
Length=531

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            +A K PF   D+LPVLPRQ+SWP+LN+ + AADL+P FVG+ +   G++ WKG+CF++N+
Sbjct  31   NALKYPFHPRDILPVLPRQVSWPILNALNGAADLLPAFVGSASDQTGTVEWKGACFYQNQ  90

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E +     + GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  91   AWMEFHNKSGSEFGGGTLHIKVSDAHSWTCMDLYVFATPYRVTW  134



>ref|XP_002867528.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43787.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            S+ K+PF   D+LP+LPRQ+SWPVLNS ++A DL+P F+G+ +  N ++ WKG+CF+EN+
Sbjct  22   SSVKLPFHPRDLLPLLPRQVSWPVLNSLNTAVDLLPTFIGSASVKNDAVEWKGACFYENK  81

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  82   AWLELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  125



>emb|CDY11612.1| BnaC06g31270D [Brassica napus]
Length=525

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 5/110 (5%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNG-SIRWKGSCFF  373
             G   KVPF VNDVLP+LPRQ+SWPVLNSFHSA DL+P+FVG++ PNN  S+ WKG+CF 
Sbjct  22   LGQPLKVPFSVNDVLPMLPRQVSWPVLNSFHSAVDLLPVFVGSVTPNNNDSLEWKGACFK  81

Query  374  ENEARVELNGSGDRD---IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             NEAR+++  S DRD   +GG  ++L T+ AHS TCMDLYVFATP R+TW
Sbjct  82   GNEARLDITVS-DRDEPGLGGGLLHLKTSEAHSLTCMDLYVFATPYRITW  130



>ref|XP_006283454.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
 gb|EOA16352.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
Length=557

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  212  KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARV  391
            K+PF   D+LP+LPRQ+SWPVLNS ++A DL+P FVG+ +  N ++ WKG+CF+EN+A +
Sbjct  60   KLPFHPRDLLPILPRQVSWPVLNSLYTAVDLLPTFVGSASVKNDAVEWKGACFYENKAWL  119

Query  392  ELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  120  ELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  160



>gb|EYU33635.1| hypothetical protein MIMGU_mgv1a018256mg, partial [Erythranthe 
guttata]
Length=505

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGT-LAPNNGSIRWKGSCFFEN  379
             AFK PFR  DVLP+LPRQ+SWP++ + ++AADLMP FVG   A NN  ++WKG+CF+ N
Sbjct  62   QAFKAPFRAKDVLPLLPRQVSWPIMKTLNNAADLMPSFVGAATAENNSILQWKGACFYNN  121

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +E + +   + GG T+++  + AHSWTCMD+YVFATP RVTW
Sbjct  122  TAWLEFHNNSGTEFGGGTLHIQVSKAHSWTCMDIYVFATPFRVTW  166



>ref|XP_006401517.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
 gb|ESQ42970.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
Length=529

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  IWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI  349
            I VL L      + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT +  N ++
Sbjct  18   IAVLILTVSTAESAKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTASEGNDAV  77

Query  350  RWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             WKG+CF+EN+A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  78   EWKGACFYENKAWLEFHNKSGSEFGGGTLHIKADKAHSWTCMDLYVFATPYRVTW  132



>ref|XP_010482896.1| PREDICTED: uncharacterized protein LOC104761505 [Camelina sativa]
Length=534

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPN  337
             T +  VL L      + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT +  
Sbjct  19   FTTIFVVLFLIVSTVESVKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTASSG  78

Query  338  NGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            N S++WKG+CF+EN A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  79   NDSVQWKGACFYENTATLEFHNKSGSEFGGGTLHIKADKAHSWTCMDLYVFATPYRVTW  137



>ref|XP_010644433.1| PREDICTED: uncharacterized protein LOC100267545 isoform X2 [Vitis 
vinifera]
Length=468

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K P R  D+LP+LPRQ+SWP+LNS HSA DL+P FVG+ A +N ++ WKG+CF+E  A
Sbjct  33   ALKPPIRPRDILPLLPRQLSWPILNSLHSAVDLLPTFVGS-ASSNDTVEWKGTCFYETRA  91

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E N     + GG T+++  ++AHSWTCMDLYVFATP +VTW
Sbjct  92   WMEFNNKSGSEFGGGTLHIKVSSAHSWTCMDLYVFATPYQVTW  134



>emb|CDP05764.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A KVPF   DVLPVLPR++SWP++N  +SA DL+P FVG  +  N S+ WKG+CF+EN A
Sbjct  28   ALKVPFHPLDVLPVLPRRVSWPIMNYLNSAVDLLPSFVGAASSTNNSLEWKGACFYENTA  87

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E N     + GG T+++  + AHSWTCMDLY+FATP RVTW
Sbjct  88   WLEFNNKSGSEFGGGTLHIKVSKAHSWTCMDLYIFATPYRVTW  130



>ref|XP_009607397.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
 ref|XP_009607398.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
Length=525

 Score =   134 bits (338),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
             FKVPF   D+LP LPRQ+SWP+LNS HSA DLMP F+G  A ++  + WKG+CF++N A
Sbjct  28   GFKVPFHPKDILPFLPRQVSWPILNSLHSAVDLMPTFIG--AASDNILEWKGACFYKNIA  85

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL+       GG T+++  + AHSWTCMDLY+FATP RVTW
Sbjct  86   WLELHNKSQSQFGGGTLHIKVSNAHSWTCMDLYIFATPYRVTW  128



>ref|XP_007211818.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
 gb|EMJ13017.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
Length=522

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            V+ L   F  + K+PF   DVLP+LPRQ+SWP+LNS H A DL+P FVG+ +  N S+ W
Sbjct  13   VITLTLLFAYSAKLPFHPRDVLPLLPRQVSWPILNSLHGAVDLLPTFVGSASSPNDSLEW  72

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T+++    AHSWTCMD+YVFATP  VTW
Sbjct  73   KGACFYQNTAWMEFHNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFATPYTVTW  125



>ref|XP_002280959.1| PREDICTED: uncharacterized protein LOC100267545 isoform X1 [Vitis 
vinifera]
 emb|CBI26614.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K P R  D+LP+LPRQ+SWP+LNS HSA DL+P FVG+ A +N ++ WKG+CF+E  A
Sbjct  33   ALKPPIRPRDILPLLPRQLSWPILNSLHSAVDLLPTFVGS-ASSNDTVEWKGTCFYETRA  91

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E N     + GG T+++  ++AHSWTCMDLYVFATP +VTW
Sbjct  92   WMEFNNKSGSEFGGGTLHIKVSSAHSWTCMDLYVFATPYQVTW  134



>ref|XP_010438669.1| PREDICTED: uncharacterized protein LOC104722227 [Camelina sativa]
Length=524

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFENE  382
            + K+PF   D+LP+LPRQ+SWPVLNS H+A DL+P F+G+ +  N+  + WKG+CF+EN+
Sbjct  24   SLKLPFHPRDLLPILPRQVSWPVLNSLHTAVDLLPTFIGSASLENDAVVEWKGACFYENK  83

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  84   AWLELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  127



>ref|NP_200298.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08766.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96551.1| uncharacterized protein AT5G54870 [Arabidopsis thaliana]
Length=531

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
              + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT +  N S+ WKG+CFFEN
Sbjct  30   AESVKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTASSGNDSVDWKGACFFEN  89

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  90   TAWLEFHNKSGSEFGGGTLHIKADKAHSWTCMDLYVFATPYRVTW  134



>gb|AFK41291.1| unknown [Medicago truncatula]
Length=354

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +2

Query  161  TLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNN  340
            TLLI++  L F   S FK PF   D+LP++P+QISWP++NS HSA D++P+FV   +  N
Sbjct  14   TLLIFLTCLQF---STFKSPFHPRDLLPLMPKQISWPIINSLHSAVDILPVFVAAASSPN  70

Query  341  GSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +  WKG+CF++N+A +E +       GG T++L  + AHS+TCMD+Y+FATP RVTW
Sbjct  71   NTPEWKGACFYKNQAWMEFHNKTGSQFGGGTLHLKVSNAHSYTCMDIYIFATPYRVTW  128



>ref|XP_006346228.1| PREDICTED: uncharacterized protein LOC102585922 [Solanum tuberosum]
Length=527

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFENE  382
             FK PF   DVLP+LPRQ+SWP+LNS +SA D+MP FVG  +   N ++ WKG+CFF+N 
Sbjct  26   GFKTPFHPKDVLPLLPRQVSWPILNSLYSAVDIMPSFVGVASIEGNNTLEWKGACFFKNI  85

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +EL+   +   GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  86   AWLELHNKSNSQFGGGTLHIKVSNAHSWTCMDLYVFATPYRVTW  129



>gb|ACG40083.1| hypothetical protein [Zea mays]
Length=537

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 5/106 (5%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNN-GSIRWKGSCFFENEA  385
             K+PF   DVLPVLPRQ++WPV+N+ HSA DL+P FV  +AP +     WKG+CF ENEA
Sbjct  38   LKLPFSPGDVLPVLPRQVAWPVMNTLHSAVDLLPSFVAAVAPGSPAPAAWKGACFSENEA  97

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   D+GGA + L TA+AHSW CMDLYVFATP R+TW
Sbjct  98   AIELT-PGDRNGTDVGGAVLRLKTASAHSWACMDLYVFATPYRITW  142



>ref|XP_009334822.1| PREDICTED: uncharacterized protein LOC103927611 [Pyrus x bretschneideri]
 ref|XP_009334847.1| PREDICTED: uncharacterized protein LOC103927629 [Pyrus x bretschneideri]
Length=522

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            +  L      + K+PF   DVLP+LPRQISWP+LNS HSA DL+P FVG+ +  N  + W
Sbjct  13   ITALTLLSAQSVKLPFHPRDVLPLLPRQISWPILNSLHSAVDLLPTFVGSASSPNHIVEW  72

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T++L  + AHSWTCMD+YVFATP  VTW
Sbjct  73   KGACFYQNTAWMEFHNKTGSEFGGGTLHLKVSKAHSWTCMDIYVFATPYTVTW  125



>ref|XP_008226932.1| PREDICTED: uncharacterized protein LOC103326477 [Prunus mume]
Length=522

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            V+ L   F  + K+PF   D LP+LPRQ+SWP+LNS H A DL+P FVG+ +  N S+ W
Sbjct  13   VITLTLLFAYSAKLPFHPRDALPLLPRQVSWPILNSLHGAVDLLPTFVGSASSPNDSLEW  72

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T+++    AHSWTCMD+YVFATP  VTW
Sbjct  73   KGACFYQNTAWMEFHNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFATPYTVTW  125



>ref|XP_011097895.1| PREDICTED: uncharacterized protein LOC105176701 [Sesamum indicum]
Length=533

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 87/126 (69%), Gaps = 3/126 (2%)
 Frame = +2

Query  146  RQLRLTLL--IWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFV  319
             QL L  L  + V G+G     A K PFR  DVLP+LPRQ+SWP+LN+ ++AADL+P FV
Sbjct  11   HQLLLMFLAILAVSGIGLPGVQAVKAPFRPGDVLPLLPRQVSWPILNALNNAADLLPSFV  70

Query  320  GT-LAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFAT  496
            G   A NN  + WKG+CF+ + A +E + +   + GG T+++  ++AHSWTCMDLYVFAT
Sbjct  71   GAATASNNSLLNWKGACFYNSTAWLEFHNNSRSEFGGGTLHIKVSSAHSWTCMDLYVFAT  130

Query  497  PXRVTW  514
            P RVTW
Sbjct  131  PFRVTW  136



>ref|XP_004295816.2| PREDICTED: uncharacterized protein LOC101297130 [Fragaria vesca 
subsp. vesca]
Length=536

 Score =   133 bits (334),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 55/106 (52%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFE  376
            F  + K+PF   D+LP+LPRQ+SWP+LNS H A DL+P FVG+ +  N ++ WKG+CF++
Sbjct  34   FSYSVKLPFHPRDLLPLLPRQLSWPILNSLHGAVDLLPTFVGSASSPNDTLSWKGACFYD  93

Query  377  NEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            N A +E +     + GG T++L  + AHSWTCMD+YVFATP  VTW
Sbjct  94   NTAWMEFHNKSGSEFGGGTLHLKVSKAHSWTCMDIYVFATPYTVTW  139



>ref|XP_008371266.1| PREDICTED: uncharacterized protein LOC103434697 [Malus domestica]
Length=522

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            + K+PF   DVLP+LPRQISWP+LNS HSA DL+P FVG+ +  N  + WKG+CF++N A
Sbjct  23   SVKLPFHPRDVLPLLPRQISWPILNSLHSAVDLLPTFVGSASSPNHIVEWKGACFYQNTA  82

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T++L  + AHSWTCMD+YVFATP  VTW
Sbjct  83   WMEFHNKTGSEFGGGTLHLKVSKAHSWTCMDIYVFATPYTVTW  125



>ref|XP_009774573.1| PREDICTED: uncharacterized protein LOC104224588 [Nicotiana sylvestris]
Length=525

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
             FKVPF   D+LP LPRQ+SWP+LNS HSA +LMP FVG  +  N  + WKG+CF++N A
Sbjct  28   GFKVPFHPKDILPFLPRQVSWPILNSLHSAVNLMPTFVGVAS--NNILEWKGACFYKNIA  85

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL+       GG T+++  + AHSWTCMDLY+FATP RVTW
Sbjct  86   WLELHNKSQSQFGGGTLHIKVSNAHSWTCMDLYIFATPYRVTW  128



>ref|XP_010064372.1| PREDICTED: uncharacterized protein LOC104451409 [Eucalyptus grandis]
Length=144

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PF   DVLP+LPRQ+SWP+LN+     DL+P FVG  +P+NGS+ WKG+CF +N A
Sbjct  27   AAKLPFHPEDVLPLLPRQLSWPILNALRRPLDLLPAFVGAASPSNGSLAWKGACFCDNTA  86

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T+++  + AHSWTCMD+YVFATP  +TW
Sbjct  87   WLEFHNETWSEFGGGTLHIKVSKAHSWTCMDIYVFATPYHMTW  129



>ref|XP_006575675.1| PREDICTED: uncharacterized protein LOC100789468 isoform X2 [Glycine 
max]
Length=464

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K PF   DVLP+LP+Q+SWP+LN  HSA DL+P+FVG  +  + +++WKG+CF+EN+A
Sbjct  20   ALKSPFHPRDVLPLLPKQLSWPILNRLHSAVDLLPVFVGAASSPDDNLKWKGACFYENKA  79

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +  +       GG T++L  + AHSWTCMDLY+FATP RVTW
Sbjct  80   WMVFHNKSGTQFGGGTLHLKVSNAHSWTCMDLYIFATPYRVTW  122



>gb|KJB13650.1| hypothetical protein B456_002G087800 [Gossypium raimondii]
Length=338

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
              A K P    DVLP+LPRQ+SWP+LNS +SA DL+P FVG+++  N  + WKG+CF+EN
Sbjct  29   AQAVKSPIHPRDVLPLLPRQVSWPILNSLNSAIDLLPAFVGSVSSQNHIVSWKGACFYEN  88

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +E +     + GG T+++  + AHSWTC+DLY+FATP RVTW
Sbjct  89   TAWMEFHNKSGSEFGGGTLHIKVSKAHSWTCLDLYLFATPYRVTW  133



>ref|XP_003617489.1| hypothetical protein MTR_5g092140 [Medicago truncatula]
 gb|AET00448.1| plant/F10M23-360 protein [Medicago truncatula]
Length=525

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +2

Query  161  TLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNN  340
            TLLI++  L F   S FK PF   D+LP++P+QISWP++NS HSA D++P+FV   +  N
Sbjct  14   TLLIFLTCLQF---STFKSPFHPRDLLPLMPKQISWPIINSLHSAVDILPVFVAAASSPN  70

Query  341  GSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +  WKG+CF++N+A +E +       GG T++L  + AHS+TCMD+Y+FATP RVTW
Sbjct  71   NTPEWKGACFYKNQAWMEFHNKTGSQFGGGTLHLKVSNAHSYTCMDIYIFATPYRVTW  128



>ref|XP_003519567.1| PREDICTED: uncharacterized protein LOC100789468 isoform X1 [Glycine 
max]
Length=519

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K PF   DVLP+LP+Q+SWP+LN  HSA DL+P+FVG  +  + +++WKG+CF+EN+A
Sbjct  20   ALKSPFHPRDVLPLLPKQLSWPILNRLHSAVDLLPVFVGAASSPDDNLKWKGACFYENKA  79

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +  +       GG T++L  + AHSWTCMDLY+FATP RVTW
Sbjct  80   WMVFHNKSGTQFGGGTLHLKVSNAHSWTCMDLYIFATPYRVTW  122



>ref|XP_006413116.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
 gb|ESQ54569.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
Length=546

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +2

Query  212  KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARV  391
            K+PF   D+LP+LPRQ+SWP+LNS +SA DL+P ++G  +  N ++ WKG+CF+EN+A +
Sbjct  49   KLPFHPRDLLPLLPRQVSWPLLNSLNSAVDLLPSYIGAASLKNDAVEWKGACFYENKAWL  108

Query  392  ELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  109  ELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  149



>ref|XP_008226933.1| PREDICTED: uncharacterized protein LOC103326478 [Prunus mume]
Length=522

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            V+ L   F  + K+PF   DVLP+LPRQ+SWP+LNS H A DL+PIFVG+ +    S+ W
Sbjct  13   VITLTLLFAYSVKLPFHPRDVLPLLPRQVSWPILNSLHGAVDLLPIFVGSASSPKDSLEW  72

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T+++    A SWTCMD+YVFATP  VTW
Sbjct  73   KGACFYQNTAWMEFHNKRGSEFGGGTLHIKVNKAQSWTCMDIYVFATPYAVTW  125



>ref|XP_007211816.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
 gb|EMJ13015.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
Length=522

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            V+ L   F  + K+PF   DVLP+LPRQ+SWP+LNS HSA DL+P FVG+ +    S+ W
Sbjct  13   VITLTLLFAYSVKLPFHPRDVLPLLPRQVSWPILNSLHSAVDLLPTFVGSASSPKDSLEW  72

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T+++    A SWTCMD+YVFATP  VTW
Sbjct  73   KGACFYQNTAWMEFHNKRGSEFGGGTLHIKVNKAQSWTCMDIYVFATPYAVTW  125



>ref|XP_008349941.1| PREDICTED: uncharacterized protein LOC103413239 [Malus domestica]
Length=522

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            V  L F    + K+PF   DVLP+LPRQISWP+LNS H A DL+P FVG+ +  N S  W
Sbjct  13   VTTLTFLSVHSVKLPFHPRDVLPLLPRQISWPILNSLHGAVDLLPTFVGSASSPNDSFEW  72

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T++L  +  HSWTCMD+YVFATP  VTW
Sbjct  73   KGACFYQNTAWMEFHNKTGSEFGGGTLHLKVSKPHSWTCMDIYVFATPYTVTW  125



>ref|NP_194432.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB36548.1| putative protein [Arabidopsis thaliana]
 emb|CAB79557.1| putative protein [Arabidopsis thaliana]
 gb|AAL75889.1| AT4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AAN28849.1| At4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AEE85285.1| uncharacterized protein AT4G27020 [Arabidopsis thaliana]
Length=523

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            S+ K+PF   D+LP+ PRQ+SWPV+NS ++A DL+P F+G+ +  N ++ WKG+CF+EN+
Sbjct  23   SSGKLPFHPRDLLPLFPRQVSWPVVNSLNTAVDLLPTFIGSASVRNDAVEWKGACFYENK  82

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  83   AWLELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  126



>gb|KJB62765.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=358

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A  +PF   DVLP+LPRQ+SWPVLNS +S  DL+P FVG+++ +N  + WKG+CF+EN 
Sbjct  24   QAANLPFHPRDVLPLLPRQVSWPVLNSLNSPVDLLPSFVGSVSSSNRIVNWKGACFYENT  83

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A VE +     + GG T+++  +  HSWTCMDLYVFATP RVTW
Sbjct  84   AWVEFHNKTGSEFGGGTLHIKVSYPHSWTCMDLYVFATPYRVTW  127



>ref|XP_002316997.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
 gb|EEE97609.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
Length=526

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPN  337
            LT+ +++  L      A KVPF   D+LP+LPRQ+SWP+LN  + AADL+P FVG  +  
Sbjct  11   LTISLFLFFLTPQSSLAIKVPFHPQDLLPLLPRQVSWPILNYLNGAADLLPTFVGAASAL  70

Query  338  NGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            N +  WKG+CF+EN A +E +     + GG T++L  + AHSWTCMD+YVFATP RVTW
Sbjct  71   NDTGEWKGACFYENRAWMEFHNKTGSEFGGGTLHLKVSKAHSWTCMDIYVFATPYRVTW  129



>ref|XP_008385988.1| PREDICTED: uncharacterized protein LOC103448506 [Malus domestica]
Length=552

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            V  L F    + K+PF   DVLP+LPRQISWP+LNS H A DL+P FVG+ +  N S  W
Sbjct  43   VTTLTFLSVHSVKLPFHPRDVLPLLPRQISWPILNSLHGAVDLLPTFVGSASSPNDSFEW  102

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T++L  +  HSWTCMD+YVFATP  VTW
Sbjct  103  KGACFYQNTAWMEFHNKTGSEFGGGTLHLKVSKPHSWTCMDIYVFATPYTVTW  155



>ref|XP_004244131.1| PREDICTED: uncharacterized protein LOC101251602 [Solanum lycopersicum]
Length=527

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFENE  382
             FK PF   DVLP+LPRQ+SWP+LNS +SA D++P FVG  +   N ++ WKG+CFF+N 
Sbjct  26   GFKTPFHPKDVLPLLPRQVSWPILNSLYSAVDILPSFVGGASIEGNNTLEWKGACFFKNI  85

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +EL+       GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  86   AWLELHNKSKSQFGGGTLHIKVSNAHSWTCMDLYVFATPYRVTW  129



>ref|XP_009378549.1| PREDICTED: uncharacterized protein LOC103967027 [Pyrus x bretschneideri]
Length=522

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            +  L F    + K+PF   DVLP+LPRQISWP+LNS H A DL+P FVG+ +  N S  W
Sbjct  13   ITTLTFLSVHSVKLPFHPRDVLPLLPRQISWPILNSLHGAVDLLPTFVGSASSPNDSFEW  72

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF++N A +E +     + GG T++L  +  HSWTCMD+YVFATP  VTW
Sbjct  73   KGACFYQNTAWMEFHNKTGSEFGGGTLHLKVSKPHSWTCMDIYVFATPYTVTW  125



>gb|KCW67102.1| hypothetical protein EUGRSUZ_F00885 [Eucalyptus grandis]
Length=484

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PF   DVLP+LPRQ+SWP+LN+     DL+P FVG  +P+NGS+ WKG+CF++N A
Sbjct  27   AAKLPFHPEDVLPLLPRQLSWPILNALRRPLDLLPAFVGAASPSNGSLAWKGACFYQNTA  86

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E + +   + GG T+++  + AHSW CMD+YVFATP RVTW
Sbjct  87   WLEFHNNTGSEFGGGTLHIKVSKAHSWICMDIYVFATPYRVTW  129



>ref|XP_002864361.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40620.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
              + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT    N S+ WKG+CF++N
Sbjct  28   AESVKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTARSGNDSVDWKGACFYDN  87

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  88   TAWLEFHNKSGSEFGGGTLHIKADKAHSWTCMDLYVFATPYRVTW  132



>ref|XP_009143005.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103866775 
[Brassica rapa]
Length=523

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            S+ K+PF   D+LP+LPRQ+SWP  NS +SA DL+P ++G  +  N ++ WKG+CF+EN+
Sbjct  23   SSVKLPFHPRDLLPLLPRQLSWPXSNSLNSAVDLLPTYIGAASIKNDAVEWKGACFYENK  82

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +ELN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  83   AWLELNNKSGSEFGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  126



>ref|XP_011030808.1| PREDICTED: uncharacterized protein LOC105130143 [Populus euphratica]
Length=526

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  QLRLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTL  328
            + RLT+ +++  L      A KVPF   D+LP+LPRQ+SWP+L   + A DL+P FVG  
Sbjct  8    KTRLTISLFLFFLTPQSSLAIKVPFHPQDLLPLLPRQVSWPILKYLNGAVDLLPTFVGAA  67

Query  329  APNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRV  508
            +  N +  WKG+CF+EN A +E +     + GG T++L  + AHSWTCMD+YVFATP RV
Sbjct  68   SALNDTGEWKGACFYENRAWMEFHNKTGSEFGGGTLHLKVSKAHSWTCMDIYVFATPYRV  127

Query  509  TW  514
            TW
Sbjct  128  TW  129



>gb|KJB62764.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=460

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A  +PF   DVLP+LPRQ+SWPVLNS +S  DL+P FVG+++ +N  + WKG+CF+EN 
Sbjct  24   QAANLPFHPRDVLPLLPRQVSWPVLNSLNSPVDLLPSFVGSVSSSNRIVNWKGACFYENT  83

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A VE +     + GG T+++  +  HSWTCMDLYVFATP RVTW
Sbjct  84   AWVEFHNKTGSEFGGGTLHIKVSYPHSWTCMDLYVFATPYRVTW  127



>gb|KJB13649.1| hypothetical protein B456_002G087800 [Gossypium raimondii]
Length=530

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
              A K P    DVLP+LPRQ+SWP+LNS +SA DL+P FVG+++  N  + WKG+CF+EN
Sbjct  29   AQAVKSPIHPRDVLPLLPRQVSWPILNSLNSAIDLLPAFVGSVSSQNHIVSWKGACFYEN  88

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +E +     + GG T+++  + AHSWTC+DLY+FATP RVTW
Sbjct  89   TAWMEFHNKSGSEFGGGTLHIKVSKAHSWTCLDLYLFATPYRVTW  133



>gb|KJB13651.1| hypothetical protein B456_002G087800 [Gossypium raimondii]
Length=471

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
              A K P    DVLP+LPRQ+SWP+LNS +SA DL+P FVG+++  N  + WKG+CF+EN
Sbjct  29   AQAVKSPIHPRDVLPLLPRQVSWPILNSLNSAIDLLPAFVGSVSSQNHIVSWKGACFYEN  88

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +E +     + GG T+++  + AHSWTC+DLY+FATP RVTW
Sbjct  89   TAWMEFHNKSGSEFGGGTLHIKVSKAHSWTCLDLYLFATPYRVTW  133



>ref|XP_011040240.1| PREDICTED: uncharacterized protein LOC105136541 [Populus euphratica]
Length=526

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PF   D+LP+LPRQ+SWP+LN  H A DL+P FVG  +  N +  WKG+CF+EN A
Sbjct  27   AVKLPFHPQDLLPLLPRQVSWPILNRLHGAVDLLPTFVGAASTLNETGDWKGACFYENRA  86

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T++L  + AHSWTCMD+YVFATP RVTW
Sbjct  87   WMEFHNKTGSEFGGGTLHLKVSNAHSWTCMDIYVFATPYRVTW  129



>ref|XP_010060409.1| PREDICTED: uncharacterized protein LOC104448324 [Eucalyptus grandis]
Length=523

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PF   DVL +LPRQ+SWP+LN+     DL+P FVG  +P+NGS+ WKG+CF++N A
Sbjct  27   AAKLPFHPEDVLTLLPRQLSWPILNALRRPVDLLPTFVGAASPSNGSLAWKGACFYQNTA  86

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T+++  + AHSWTCMD+YVFATP RVTW
Sbjct  87   WLEFHNETGSEFGGGTLHIKVSKAHSWTCMDIYVFATPYRVTW  129



>ref|XP_006370687.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
 gb|ERP67256.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
Length=585

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PF   D+LP+LPRQ+SWP+LN  H A DL+P FVG  +  N +  WKG+CF+EN A
Sbjct  86   AVKLPFHPQDLLPLLPRQVSWPILNRLHGAVDLLPTFVGAASALNETGDWKGACFYENRA  145

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T++L  + AHSWTCMD+YVFATP RVTW
Sbjct  146  WMEFHNKTGSEFGGGTLHLKVSNAHSWTCMDIYVFATPYRVTW  188



>gb|KJB62763.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=524

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A  +PF   DVLP+LPRQ+SWPVLNS +S  DL+P FVG+++ +N  + WKG+CF+EN 
Sbjct  24   QAANLPFHPRDVLPLLPRQVSWPVLNSLNSPVDLLPSFVGSVSSSNRIVNWKGACFYENT  83

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A VE +     + GG T+++  +  HSWTCMDLYVFATP RVTW
Sbjct  84   AWVEFHNKTGSEFGGGTLHIKVSYPHSWTCMDLYVFATPYRVTW  127



>gb|KHG29749.1| Transcription activator gutR [Gossypium arboreum]
Length=531

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A  +PF   DVLP+LPRQ+SWPVLNS +S  DL+P FVG+++ +N  + WKG+CF+EN 
Sbjct  31   QAANLPFHPRDVLPLLPRQVSWPVLNSLNSPVDLLPSFVGSVSSSNRIVNWKGACFYENT  90

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A VE +     + GG T+++  +  HSWTCMDLYVFATP RVTW
Sbjct  91   AWVEFHNKTGSEFGGGTLHIKVSYPHSWTCMDLYVFATPYRVTW  134



>gb|KHG01773.1| Tryptophan synthase alpha chain [Gossypium arboreum]
Length=531

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
             A K P    DVLP+LPRQ+SWP+LNS +SA DL+P FVG+++  N  + WKG+CF+EN 
Sbjct  31   QAVKSPIHPRDVLPLLPRQVSWPILNSLNSAIDLLPAFVGSVSSQNHIVSWKGACFYENT  90

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E +     + GG T+++  + AHSWTC+DLY+FATP RVTW
Sbjct  91   AWMEFHNKSGSEFGGGTLHIKVSKAHSWTCLDLYLFATPYRVTW  134



>ref|XP_009614695.1| PREDICTED: uncharacterized protein LOC104107565 isoform X1 [Nicotiana 
tomentosiformis]
Length=533

 Score =   129 bits (325),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG--TLAPNNGSIRWKGSCFFEN  379
              K P    D+LP LPRQ+SWP+LNS HSA DL+P FVG  ++A NN ++ WKG+CF++N
Sbjct  28   GLKSPLNPKDILPFLPRQVSWPILNSLHSAVDLLPAFVGAASIAENN-TLEWKGACFYKN  86

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +EL+       GG T+++  + AHSWTCMDLY+FATP RVTW
Sbjct  87   TAWLELHNKSQSQFGGGTLHIKVSNAHSWTCMDLYIFATPYRVTW  131



>ref|XP_009801253.1| PREDICTED: uncharacterized protein LOC104246940 isoform X2 [Nicotiana 
sylvestris]
Length=432

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG--TLAPNNGSIRWKGSCFFENE  382
             K PF   D+LP+LPRQ+SWP+LNS H A DL+P FVG  ++A NN ++ WKG+CF++N 
Sbjct  29   LKSPFNPKDILPLLPRQVSWPILNSLHGAVDLLPAFVGAASIAENN-TLEWKGACFYKNT  87

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +EL+       GG T+++  + AHSWTCMDLY+FATP  VTW
Sbjct  88   AWLELHNKSQSQFGGGTLHIKVSNAHSWTCMDLYIFATPYHVTW  131



>ref|XP_009614697.1| PREDICTED: uncharacterized protein LOC104107565 isoform X2 [Nicotiana 
tomentosiformis]
Length=528

 Score =   129 bits (324),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG--TLAPNNGSIRWKGSCFFEN  379
              K P    D+LP LPRQ+SWP+LNS HSA DL+P FVG  ++A NN ++ WKG+CF++N
Sbjct  28   GLKSPLNPKDILPFLPRQVSWPILNSLHSAVDLLPAFVGAASIAENN-TLEWKGACFYKN  86

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +EL+       GG T+++  + AHSWTCMDLY+FATP RVTW
Sbjct  87   TAWLELHNKSQSQFGGGTLHIKVSNAHSWTCMDLYIFATPYRVTW  131



>ref|XP_002522970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39400.1| conserved hypothetical protein [Ricinus communis]
Length=524

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFG-----SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG  322
            L+L I +L + F F      SA +VPF   D+LP+LPRQ+SWP+LN  +SA DL+P FVG
Sbjct  5    LSLTI-ILIISFSFSIFAAISAVEVPFHPQDLLPLLPRQVSWPILNRLNSAVDLLPTFVG  63

Query  323  TLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPX  502
                 N +  WKG+CF++N A +E +       GG T+++  + AHSWTCMDLYVFATP 
Sbjct  64   AANSLNNTAEWKGACFYKNTAWMEFHNKTGSQFGGGTLHIKISNAHSWTCMDLYVFATPY  123

Query  503  RVTW  514
            RVTW
Sbjct  124  RVTW  127



>ref|XP_008454551.1| PREDICTED: uncharacterized protein LOC103494941 [Cucumis melo]
Length=537

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K PF   D+LP+LPRQ+SWPVLN  ++AADL+P FVG +   + SI+W+G+CF++N A
Sbjct  38   ALKSPFSPIDLLPLLPRQVSWPVLNYLNNAADLLPTFVGAVTSPDNSIQWQGACFYKNTA  97

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T+++  + AHSWTCMDLY+FATP R+TW
Sbjct  98   WIEFHNKSGSEFGGGTLHIKASDAHSWTCMDLYIFATPYRITW  140



>gb|EYU19247.1| hypothetical protein MIMGU_mgv1a004499mg [Erythranthe guttata]
Length=524

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  158  LTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-P  334
            L+LL+ VL +G     AFK PFR  DVLP+LPRQIS P+LN  ++AADL+P FVG  +  
Sbjct  8    LSLLLAVL-VGTEKVQAFKAPFRPVDVLPILPRQISRPILNKLNNAADLLPSFVGAASVS  66

Query  335  NNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            NN  + WKGSCF+ N A +  + +     GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  67   NNSVLNWKGSCFYNNTAWLVFHNNSGTQFGGGTLHIKVSKAHSWTCMDLYVFATPYRVTW  126



>ref|XP_003578075.1| PREDICTED: uncharacterized protein LOC100824338 [Brachypodium 
distachyon]
Length=536

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 5/106 (5%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGS-IRWKGSCFFENEA  385
             K+PF   DVLP+LPRQ++WPV+N+ HSA DL+P FV  +AP + S   W GSCF  NEA
Sbjct  37   MKLPFSPGDVLPILPRQVAWPVMNTLHSAVDLLPSFVAAVAPGDLSPAAWNGSCFAVNEA  96

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   DIGGA + L TA+A SWTCMDLYVFATP R+TW
Sbjct  97   ALELT-PGDRNGTDIGGAVLRLKTASAQSWTCMDLYVFATPYRITW  141



>ref|XP_009801187.1| PREDICTED: uncharacterized protein LOC104246940 isoform X1 [Nicotiana 
sylvestris]
Length=528

 Score =   128 bits (322),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG--TLAPNNGSIRWKGSCFFEN  379
              K PF   D+LP+LPRQ+SWP+LNS H A DL+P FVG  ++A NN ++ WKG+CF++N
Sbjct  28   GLKSPFNPKDILPLLPRQVSWPILNSLHGAVDLLPAFVGAASIAENN-TLEWKGACFYKN  86

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +EL+       GG T+++  + AHSWTCMDLY+FATP  VTW
Sbjct  87   TAWLELHNKSQSQFGGGTLHIKVSNAHSWTCMDLYIFATPYHVTW  131



>ref|XP_010675677.1| PREDICTED: uncharacterized protein LOC104891653 [Beta vulgaris 
subsp. vulgaris]
Length=523

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 85/121 (70%), Gaps = 4/121 (3%)
 Frame = +2

Query  161  TLLIW-VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG--TLA  331
            TL+I+ +L L        K PFR  D+LP+LP+++SWP+L S + A DL+P FVG  + +
Sbjct  7    TLVIFSLLLLSIPMVVPLKTPFRATDILPLLPKELSWPILKSLNRAVDLLPTFVGAASSS  66

Query  332  PNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVT  511
            PNN S+ WKG+CF+EN A +E +     + GG T+++  +AAHSWTCMD+YVFATP RVT
Sbjct  67   PNN-SLDWKGACFYENTAWLEFHNKTGSEFGGGTLHIKVSAAHSWTCMDIYVFATPYRVT  125

Query  512  W  514
            W
Sbjct  126  W  126



>gb|KDP39105.1| hypothetical protein JCGZ_00862 [Jatropha curcas]
Length=524

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEAR  388
             ++PF   D+LP+LPRQ+SWPVLN  +S  DL+P FVG  +  N S+ WKG+CF++ +A 
Sbjct  26   LQIPFHPQDLLPLLPRQVSWPVLNYLNSPVDLLPTFVGAASSQNNSVEWKGACFYKCKAW  85

Query  389  VELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +E +     + GG T+++  + AHSWTCMDLYVFATP RVTW
Sbjct  86   MEFHNKTGSEFGGGTLHIKVSKAHSWTCMDLYVFATPYRVTW  127



>ref|XP_011095372.1| PREDICTED: uncharacterized protein LOC105174849 [Sesamum indicum]
Length=533

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +2

Query  158  LTLLIWVLGLGFGF---GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTL  328
            L LL+ VL +   +     AFK PFR  DVLP+LPRQ+SWPVLN  ++A DL+P FVG  
Sbjct  14   LMLLLAVLIVSCSYTQKAQAFKAPFRPGDVLPLLPRQVSWPVLNKLNNAVDLLPTFVGAA  73

Query  329  -APNNGSIRWKGSCFFENEA-RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPX  502
             A NN  + WKG+CF+ N A  V  N SG R  GG T+++  + AHSWTCMDLYVFATP 
Sbjct  74   SATNNSLLHWKGACFYNNTAWLVFHNNSGSR-FGGGTLHIKVSNAHSWTCMDLYVFATPY  132

Query  503  RVTW  514
            +VTW
Sbjct  133  QVTW  136



>ref|XP_003544978.1| PREDICTED: uncharacterized protein LOC100796964 [Glycine max]
Length=525

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K PF   DVLP+LPRQ+SWP+LN  HSA DL+P+FVG       +++WKG+CF+EN+A
Sbjct  26   ALKSPFHPRDVLPLLPRQLSWPILNRLHSAVDLLPVFVGAAFSPVDNLKWKGACFYENKA  85

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +  +       GG T+++  + AHSWTCMDLY+FA+P RVTW
Sbjct  86   WMVFHNKSGTQYGGGTLHIKVSNAHSWTCMDLYIFASPYRVTW  128



>ref|XP_008812430.1| PREDICTED: uncharacterized protein LOC103723322 [Phoenix dactylifera]
Length=537

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEAR  388
            +K PFR  D LP+LPR +SWP+L S  SA DL+P FVG  +  N  + WKG+CF+EN+A 
Sbjct  39   WKAPFRPTDFLPLLPRIVSWPILRSLRSAVDLLPTFVGAASSTNHDLEWKGACFYENQAW  98

Query  389  VELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +E +       GG T+++ T+ AHSWTCMDLY+FATP +VTW
Sbjct  99   LEFHNKSGTPFGGGTLHIKTSNAHSWTCMDLYIFATPFQVTW  140



>ref|XP_007142263.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
 gb|ESW14257.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
Length=544

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K PF V DVLP+LPRQ+SWP+LN  +SA D++P+FVG  +  +  + WKG+CF++N A
Sbjct  45   ALKPPFHVRDVLPLLPRQVSWPILNRLNSAVDILPVFVGAASSPDNVLDWKGACFYKNTA  104

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +  +     + GG T++L  + AHSWTCMDLY+FATP RVTW
Sbjct  105  WMVFHNKSLTEYGGGTLHLKVSDAHSWTCMDLYIFATPYRVTW  147



>gb|KCW67113.1| hypothetical protein EUGRSUZ_F00893 [Eucalyptus grandis]
Length=496

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K+PF   DVLP+LPRQ+SWP+LN+     DL+P FVG  +P+NGS+ WKG+CF +N A
Sbjct  27   AAKLPFHPEDVLPLLPRQLSWPILNALRRPLDLLPAFVGAASPSNGSLAWKGACFCDNTA  86

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T+++  + AHSWTCMD+YVFATP  +TW
Sbjct  87   WLEFHNETWSEFGGGTLHIKVSKAHSWTCMDIYVFATPYHMTW  129



>ref|XP_009127046.1| PREDICTED: uncharacterized protein LOC103851917 [Brassica rapa]
Length=529

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  IWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI  349
            I VL L      + K PF   D+LP+LP+Q+SWP+LNS + AADL+P F+GT +P N  +
Sbjct  18   IAVLILTVSTAESLKSPFHPLDLLPLLPKQVSWPILNSLYGAADLLPTFIGTASPGNDDV  77

Query  350  RWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +WKG+CF+EN A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  78   KWKGACFYENTAYLEFHNKSGSEFGGGTLHIQADKAHSWTCMDLYVFATPYRVTW  132



>ref|XP_004491367.1| PREDICTED: uncharacterized protein LOC101492149 [Cicer arietinum]
Length=525

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENE  382
            S  K PF   D+LP+LP+QISWP+LNS H+A DL+P+FVG  +  + +  WKG+CF+ N+
Sbjct  25   SPLKSPFHPRDLLPLLPKQISWPILNSLHTAVDLLPVFVGAASSPDNTFDWKGACFYNNK  84

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +  +       GG T++L  + AHSWTC+D+Y+FATP RVTW
Sbjct  85   AWIVFHNKTGSQFGGGTLHLKVSNAHSWTCLDIYIFATPYRVTW  128



>emb|CDY20800.1| BnaA02g09400D [Brassica napus]
Length=610

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  170  IWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI  349
            I VL L      + K PF   D+LP+LP+Q+SWP+LNS + AADL+P F+GT +P N  +
Sbjct  18   IAVLILTVSTAESLKSPFHPLDLLPLLPKQVSWPILNSLYGAADLLPTFIGTASPGNDDV  77

Query  350  RWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +WKG+CF+EN A +E +     + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  78   KWKGACFYENTAYLEFHNKSGSEFGGGTLHIQADKAHSWTCMDLYVFATPYRVTW  132



>ref|XP_009120015.1| PREDICTED: uncharacterized protein LOC103844940 [Brassica rapa]
Length=529

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            VL L      + K      D+LP LPRQ+SWP+LNS + AADL+P F+GT    N +++W
Sbjct  20   VLILVLSTAVSLKSTLHPRDMLPHLPRQVSWPILNSLYGAADLLPTFIGTANAGNNTVKW  79

Query  356  KGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            KG+CF+EN A +E +       GG T+++    AHS TCMDLYVFATP RVTW
Sbjct  80   KGACFYENTAHMEFHNKSGSKFGGGTLHIKADKAHSSTCMDLYVFATPYRVTW  132



>ref|XP_006346229.1| PREDICTED: uncharacterized protein LOC102586255 [Solanum tuberosum]
Length=528

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFEN  379
            + ++  F   D+LP+LPRQ+SWPV+NS HSA DL+P F+G  +   N ++ WKG+CFF+N
Sbjct  27   NGYESLFHPKDILPLLPRQVSWPVINSLHSAVDLLPAFMGAASIEGNNTLEWKGACFFKN  86

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A +EL+       GG T+++  + AHSWTC+DLY+FATP RVTW
Sbjct  87   IAWLELHNKSKSQFGGGTLHIKVSNAHSWTCLDLYIFATPYRVTW  131



>ref|XP_002460179.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
 gb|EER96700.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
Length=537

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 73/106 (69%), Gaps = 5/106 (5%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF-VGTLAPNNGSIRWKGSCFFENEA  385
             K+PF   DVLPVLPRQ++WPV+N+ HSA DL+P F             W G+CF ENEA
Sbjct  38   LKLPFSPGDVLPVLPRQVAWPVMNTLHSAVDLLPSFVAAVAPGAPAPAAWSGACFAENEA  97

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   D+GGA + L TA+AHSWTCMDLYVFATP R+TW
Sbjct  98   AIELT-PGDRNGTDVGGAVLRLKTASAHSWTCMDLYVFATPYRITW  142



>ref|NP_001142383.1| uncharacterized protein LOC100274556 precursor [Zea mays]
 gb|ACF88369.1| unknown [Zea mays]
Length=536

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 73/106 (69%), Gaps = 5/106 (5%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF-VGTLAPNNGSIRWKGSCFFENEA  385
             K+PF   DVLPVLPRQ++WPV+N+ HSA DL+P F             WKG+CF ENEA
Sbjct  37   LKLPFSPGDVLPVLPRQVAWPVMNTLHSAVDLLPSFVAAVAPGAPAPAAWKGACFSENEA  96

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   D+GGA + L TA+AHSW CMDLYVFATP R+TW
Sbjct  97   AIELT-PGDRNGTDVGGAVLRLKTASAHSWACMDLYVFATPYRITW  141



>tpg|DAA61320.1| TPA: hypothetical protein ZEAMMB73_635026 [Zea mays]
Length=536

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 73/106 (69%), Gaps = 5/106 (5%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF-VGTLAPNNGSIRWKGSCFFENEA  385
             K+PF   DVLPVLPRQ++WPV+N+ HSA DL+P F             WKG+CF ENEA
Sbjct  37   LKLPFSPGDVLPVLPRQVAWPVMNTLHSAVDLLPSFVAAVAPGAPAPAAWKGACFSENEA  96

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   D+GGA + L TA+AHSW CMDLYVFATP R+TW
Sbjct  97   AIELT-PGDRNGTDVGGAVLRLKTASAHSWACMDLYVFATPYRITW  141



>ref|XP_006367536.1| PREDICTED: uncharacterized protein LOC102597542 [Solanum tuberosum]
Length=537

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +2

Query  152  LRLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+   L  VL       S  K  F + DVLP+LP Q+SWP++NS +SA DL+P FVG ++
Sbjct  19   LKTHFLFIVLMFSCLLLSGSKSVFHIKDVLPILPVQVSWPIVNSLYSAVDLLPSFVGAVS  78

Query  332  -PNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRV  508
              NN +++WKG+CF+ N A +EL+       GG TI++    AHS++CMDLY+FATP RV
Sbjct  79   IANNSTLQWKGACFYNNTASLELHNKTGSRFGGGTIHIKVNNAHSYSCMDLYIFATPYRV  138

Query  509  TW  514
            TW
Sbjct  139  TW  140



>gb|KFK29208.1| hypothetical protein AALP_AA7G103200 [Arabis alpina]
Length=521

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFENE  382
            A  +PF   D+LP+LPRQ+SWP+LNS +SA DL+P ++G  +  N+ ++ WKG+CF++N+
Sbjct  21   AVNLPFHPRDLLPLLPRQVSWPLLNSLNSAVDLLPTYIGAASLKNDAAVEWKGACFYQNK  80

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A +E N +     GG T+++     HSWTCMD+YVF TP RVTW
Sbjct  81   AWLEFNNNSGTQFGGGTLHIKVDKPHSWTCMDIYVFVTPYRVTW  124



>ref|XP_010930259.1| PREDICTED: uncharacterized protein LOC105051475 isoform X2 [Elaeis 
guineensis]
Length=511

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
             +K PFR  D LP+LPR +SW +L S  SA DL+P FVG  +  N  + WKG+CF++N A
Sbjct  43   CWKAPFRPTDFLPLLPRIVSWRILRSLRSAVDLLPTFVGAASSTNDDLEWKGACFYKNRA  102

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +       GG T+++ T+ AHSWTCMDLY+FATP RVTW
Sbjct  103  WLEFHNKSGTPFGGGTLHIKTSNAHSWTCMDLYIFATPFRVTW  145



>ref|XP_010930250.1| PREDICTED: uncharacterized protein LOC105051475 isoform X1 [Elaeis 
guineensis]
Length=542

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEAR  388
            +K PFR  D LP+LPR +SW +L S  SA DL+P FVG  +  N  + WKG+CF++N A 
Sbjct  44   WKAPFRPTDFLPLLPRIVSWRILRSLRSAVDLLPTFVGAASSTNDDLEWKGACFYKNRAW  103

Query  389  VELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +E +       GG T+++ T+ AHSWTCMDLY+FATP RVTW
Sbjct  104  LEFHNKSGTPFGGGTLHIKTSNAHSWTCMDLYIFATPFRVTW  145



>ref|XP_004244132.1| PREDICTED: uncharacterized protein LOC101251905 [Solanum lycopersicum]
Length=528

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  SAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFEN  379
            + ++  F   D+LP+LPRQ+SWP++NS HSA DL+P F+G  +   N ++ WKG+CF++N
Sbjct  27   NGYESLFHPKDILPLLPRQVSWPIINSLHSAVDLLPAFMGAASVEGNNTLEWKGACFYKN  86

Query  380  EARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             A ++L+       GG T+++  + AHSWTC+DLY+FATP RVTW
Sbjct  87   IAWLQLHNKSKSQFGGGTLHIKVSNAHSWTCLDLYIFATPYRVTW  131



>ref|XP_004252023.1| PREDICTED: uncharacterized protein LOC101252754 [Solanum lycopersicum]
Length=523

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = +2

Query  152  LRLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA  331
            L+   L +VL       S  K  F + DVLP+LP Q+SWP++NS +SA DL+P FVG ++
Sbjct  5    LKTHFLFFVLMFSCLLLSGSKSVFHIKDVLPMLPVQVSWPIVNSLYSAVDLLPSFVGAVS  64

Query  332  -PNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRV  508
              NN +++WKG+CF+ N A ++L+       GG TI++    AHS++CMDLY+FATP RV
Sbjct  65   IANNNTLQWKGACFYNNTAFLDLHNKTGSRYGGGTIHIKVNNAHSYSCMDLYIFATPYRV  124

Query  509  TW  514
            TW
Sbjct  125  TW  126



>ref|XP_009420606.1| PREDICTED: uncharacterized protein LOC104000320 [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            ++K PFR  D+LP+LP + +WPVL S  SA DL+P FVG  +     + WKG+CF++  A
Sbjct  38   SWKAPFRPVDLLPLLPHRAAWPVLRSLRSAVDLLPTFVGAASSAEDDLEWKGACFYKTTA  97

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +       GG T+++ T  AHSWTCMDLYVFATP RVTW
Sbjct  98   WMEFHNKSQSQFGGGTLHIKTNNAHSWTCMDLYVFATPYRVTW  140



>emb|CDY19873.1| BnaC09g31390D [Brassica napus]
Length=541

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 75/125 (60%), Gaps = 12/125 (10%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            VL L      + K  F   D+LP LPRQ+SWP+LNS + AADL+P F+GT    N +++W
Sbjct  20   VLILVLSTAVSLKSAFHPRDMLPHLPRQVSWPILNSLYGAADLLPTFIGTANAGNNTVKW  79

Query  356  KGSCFFENEARVELNGSGDRDIGGATI------------YLSTAAAHSWTCMDLYVFATP  499
            KG+CF++N A +E +       GG T+            +LS   AHS TCMDLYVFATP
Sbjct  80   KGACFYDNTAHMEFHNKSASKFGGGTLHIKARSVFKNRYFLSADKAHSSTCMDLYVFATP  139

Query  500  XRVTW  514
             RVTW
Sbjct  140  YRVTW  144



>ref|XP_004956736.1| PREDICTED: uncharacterized protein LOC101782072 [Setaria italica]
Length=538

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 71/106 (67%), Gaps = 5/106 (5%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF-VGTLAPNNGSIRWKGSCFFENEA  385
             KVPF   DVLP+LPRQ++WPV+N+ HSA DL+P F             W G+CF  NEA
Sbjct  39   LKVPFSPRDVLPILPRQVAWPVMNTLHSAVDLLPSFVAAVAPGAPAPAAWSGACFAVNEA  98

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   D+GGA + L TA+A SWTCMDLYVFATP R+TW
Sbjct  99   AIELT-PGDRNGTDVGGAVLRLKTASAQSWTCMDLYVFATPYRITW  143



>emb|CDY17285.1| BnaA10g09190D [Brassica napus]
Length=541

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 74/125 (59%), Gaps = 12/125 (10%)
 Frame = +2

Query  176  VLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRW  355
            VL L      + K      D+LP LPRQ+SWP+LNS + AADL+P F+GT    N +++W
Sbjct  20   VLILVLSTAVSLKSTLHPRDMLPHLPRQVSWPILNSLYGAADLLPTFIGTANAGNNTVKW  79

Query  356  KGSCFFENEARVELNGSGDRDIGGATI------------YLSTAAAHSWTCMDLYVFATP  499
            KG+CF+EN A +E +       GG T+            +LS   AHS TCMDLYVFATP
Sbjct  80   KGACFYENTAHMEFHNKSGSKFGGGTLHIKAHSICKNRYFLSADKAHSSTCMDLYVFATP  139

Query  500  XRVTW  514
             RVTW
Sbjct  140  YRVTW  144



>ref|XP_009769049.1| PREDICTED: uncharacterized protein LOC104219979 [Nicotiana sylvestris]
Length=526

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +2

Query  212  KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFENEAR  388
            K  F + DVLP+LP ++SWP++NS +SA DL+P F+G  +  NN ++ WKG+CF++N A 
Sbjct  28   KSLFHLKDVLPLLPGKVSWPIVNSLYSAVDLLPSFMGAASISNNNTLEWKGACFYKNTAW  87

Query  389  VELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +EL+       GG T+++  + AHS+TCMDLY+FATP RVTW
Sbjct  88   LELHNKTGSQFGGGTVHIKVSNAHSYTCMDLYIFATPYRVTW  129



>dbj|BAJ99018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  194  GFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF-VGTLAPNNGSIRWKGSCF  370
            G     K+PF   DVLP+LPRQ++WPV+N+ HSA DL+P F             W GSCF
Sbjct  30   GGAVGLKLPFSPGDVLPILPRQVAWPVMNTLHSAVDLLPSFVAAVAPAAPSPAVWNGSCF  89

Query  371  FENEARVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
              NEA +EL   GDR   +IGGA + L TA+A SWTCMDLYVFATP R+TW
Sbjct  90   AANEAAIELT-PGDRNGTEIGGAVLRLKTASAQSWTCMDLYVFATPYRITW  139



>dbj|BAJ97125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  194  GFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF-VGTLAPNNGSIRWKGSCF  370
            G     K+PF   DVLP+LPRQ++WPV+N+ HSA DL+P F             W GSCF
Sbjct  30   GGAVGLKLPFSPGDVLPILPRQVAWPVMNTLHSAVDLLPSFVAAVAPAAPSPAVWNGSCF  89

Query  371  FENEARVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
              NEA +EL   GDR   +IGGA + L TA+A SWTCMDLYVFATP R+TW
Sbjct  90   AANEAAIELT-PGDRNGTEIGGAVLRLKTASAQSWTCMDLYVFATPYRITW  139



>ref|XP_009599364.1| PREDICTED: uncharacterized protein LOC104095030 [Nicotiana tomentosiformis]
Length=526

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +2

Query  212  KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIRWKGSCFFENEAR  388
            K  F + DVLP+LP ++SWP++NS +SA DL+P FVG  +  NN ++ WKG+CF++N A 
Sbjct  28   KSLFHLKDVLPLLPGKVSWPIVNSLYSAVDLLPSFVGAASISNNSTLEWKGACFYKNTAW  87

Query  389  VELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +EL+       GG T+++  + AHS+TCMDLY+ ATP RVTW
Sbjct  88   LELHNKTGSQFGGGTVHIKVSNAHSYTCMDLYILATPYRVTW  129



>ref|XP_010446119.1| PREDICTED: uncharacterized protein LOC104728896 [Camelina sativa]
Length=697

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 12/117 (10%)
 Frame = +2

Query  200  GSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFEN  379
              + K PF   D+LP LPRQ+SWP+LNS + AADL+P F+GT +  N S++WKG+CFFEN
Sbjct  30   AESVKSPFHPRDLLPHLPRQVSWPILNSLYGAADLLPTFIGTASSGNDSVQWKGACFFEN  89

Query  380  EARVELNGSG-----------DRDIGGATIYLSTA-AAHSWTCMDLYVFATPXRVTW  514
             A +EL+              DR +    + L  A  AHSWTCMDLYVFATP RVTW
Sbjct  90   TATLELSFGVIDLLDEKLVLIDRILNLILLVLMKADKAHSWTCMDLYVFATPYRVTW  146



>ref|XP_010092131.1| hypothetical protein L484_017819 [Morus notabilis]
 gb|EXB50282.1| hypothetical protein L484_017819 [Morus notabilis]
Length=624

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 75/121 (62%), Gaps = 20/121 (17%)
 Frame = +2

Query  212  KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPN-NGSIRWKGSCFFENEAR  388
            K+PF   D LP+LPRQ++WP+LN  HSA D++P FVG  + + N ++RWKG+CF+EN A 
Sbjct  35   KLPFDPRDALPLLPRQVAWPILNYLHSAVDILPSFVGAASSSPNHTLRWKGACFYENTAW  94

Query  389  VELNGSGDRDIGGATIYLS-------------------TAAAHSWTCMDLYVFATPXRVT  511
            +E + +   + GG T+++                       AHSWTCMDLYVFATP RVT
Sbjct  95   LEFHNNSGSEFGGGTLHIKMGFNFVKVVASAVEFRTNFVGKAHSWTCMDLYVFATPYRVT  154

Query  512  W  514
            W
Sbjct  155  W  155



>gb|EAZ08986.1| hypothetical protein OsI_31250 [Oryza sativa Indica Group]
Length=546

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +2

Query  212  KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF--VGTLAPNNGSIRWKGSCFFENEA  385
            KVPF   DVLPVLPRQ+SWPV+N+ HSA DL+P F              W G+CF  NEA
Sbjct  47   KVPFSPGDVLPVLPRQVSWPVMNTLHSAVDLLPSFVAAVAPGAAPSDAAWSGACFARNEA  106

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   ++ GA + L TA+A SWTCMDLYVFATP R+TW
Sbjct  107  ALELT-PGDRNGTELSGAVLRLKTASAKSWTCMDLYVFATPYRITW  151



>ref|NP_001063085.1| Os09g0392000 [Oryza sativa Japonica Group]
 dbj|BAD26533.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24999.1| Os09g0392000 [Oryza sativa Japonica Group]
 gb|EAZ44615.1| hypothetical protein OsJ_29237 [Oryza sativa Japonica Group]
 dbj|BAG99992.1| unnamed protein product [Oryza sativa Japonica Group]
Length=546

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +2

Query  212  KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF--VGTLAPNNGSIRWKGSCFFENEA  385
            KVPF   DVLPVLPRQ+SWPV+N+ HSA DL+P F              W G+CF  NEA
Sbjct  47   KVPFSPGDVLPVLPRQVSWPVMNTLHSAVDLLPSFVAAVAPGAAPSDAAWSGACFARNEA  106

Query  386  RVELNGSGDR---DIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +EL   GDR   ++ GA + L TA+A SWTCMDLYVFATP R+TW
Sbjct  107  ALELT-PGDRNGTELSGAVLRLKTASAKSWTCMDLYVFATPYRITW  151



>ref|XP_004151958.1| PREDICTED: uncharacterized protein LOC101214437 [Cucumis sativus]
 ref|XP_004158470.1| PREDICTED: uncharacterized LOC101214437 [Cucumis sativus]
 gb|KGN57971.1| hypothetical protein Csa_3G416640 [Cucumis sativus]
Length=536

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K PF   D+LP+LPRQ+SWPVLN  ++AADL+P FVG +   + SI+W+G+CF++N A
Sbjct  37   ALKSPFSPLDLLPLLPRQVSWPVLNYLNNAADLLPTFVGAVTSPDNSIQWQGACFYKNTA  96

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +     + GG T+++  + AHSWTCMDLY+FATP R+TW
Sbjct  97   WIEFHNKSGSEFGGGTLHIKASDAHSWTCMDLYIFATPYRITW  139



>ref|XP_001781611.1| predicted protein [Physcomitrella patens]
 gb|EDQ53567.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  230  NDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVE-LNGS  406
             DVLPVLP  ++WP+L    SA DL+P FVG +A  N ++ WKG+CF++NEA +E +  S
Sbjct  17   EDVLPVLPHSVAWPILKKTRSAVDLLPRFVGGVASENVNVMWKGACFYQNEAHLEYVEAS  76

Query  407  GDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            G+    G  +++ T+ AHS+TC+DLYVFATP RVTW
Sbjct  77   GEGKREGLVLHIKTSKAHSYTCLDLYVFATPYRVTW  112



>ref|XP_004152029.1| PREDICTED: uncharacterized protein LOC101212346 [Cucumis sativus]
 gb|KGN57972.1| hypothetical protein Csa_3G416650 [Cucumis sativus]
Length=527

 Score =   113 bits (282),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A K PF   D+LP+LP ++S+ +LN F+SAADL+P FVG+++  + S++W+G+CF++N A
Sbjct  22   ALKTPFSPRDMLPLLPTKVSYRILNYFNSAADLLPSFVGSVSSPDKSVQWQGACFYQNTA  81

Query  386  RVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             +E +       GG T+++  + AHS TC+DLY+FATP R TW
Sbjct  82   WLEFHNKSGSQYGGGTLHIKVSDAHSPTCIDLYIFATPYRWTW  124



>ref|XP_008454552.1| PREDICTED: uncharacterized protein LOC103494942 [Cucumis melo]
Length=538

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = +2

Query  164  LLIWVLG-LGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNN  340
             LI ++G L      A K PF   D+LP+LPR++S  +LN F+SAADL+P FVG ++  +
Sbjct  18   FLISIVGFLLVSQSEALKTPFSPRDMLPLLPRKVSLRILNYFNSAADLLPSFVGDVSSPD  77

Query  341  GSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             S++W+G+CF++N A +E +       GG T+++  + AHS TCMD+Y+FATP R TW
Sbjct  78   RSVQWQGACFYKNTAWLEFHNKSGSQYGGGTLHIKVSNAHSPTCMDVYIFATPYRWTW  135



>gb|KHN11935.1| hypothetical protein glysoja_019908 [Glycine soja]
Length=486

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  248  LPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGG  427
            +PRQ+SWP+LN  HSA DL+P+FVG       +++WKG+CF+EN+A +  +       GG
Sbjct  1    MPRQLSWPILNRLHSAVDLLPVFVGAAFSPVDNLKWKGACFYENKAWMVFHNKSGTQYGG  60

Query  428  ATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             T+++  + AHSWTCMDLY+FA+P RVTW
Sbjct  61   GTLHIKVSNAHSWTCMDLYIFASPYRVTW  89



>ref|XP_002986592.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
 gb|EFJ12449.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
Length=509

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIR-WKGSCFFENEAR  388
            +PF   DVLP LP  I+WP LN  H+A DL+P FV  ++ P++ ++  WKG+CF++NEA 
Sbjct  13   LPFHPRDVLPALPHGIAWPTLNRLHNAVDLLPEFVAAVSSPSDRNLSSWKGACFYKNEAW  72

Query  389  VELNGSGDRDI-GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +E     + +  GG  +Y+ T+ AHSWTCMDLY+FATP RVTW
Sbjct  73   LEFTEPKEANSSGGGILYIKTSNAHSWTCMDLYIFATPYRVTW  115



>ref|XP_002965264.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
 gb|EFJ34102.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
Length=509

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLA-PNNGSIR-WKGSCFFENEAR  388
            +PF   DVLP LP  I+WP LN  H+A DL+P FV  ++ P++ ++  WKG+CF++NEA 
Sbjct  13   LPFHPRDVLPALPHGIAWPTLNRLHNAVDLLPEFVAAVSSPSDRNLSSWKGACFYKNEAW  72

Query  389  VELNGSGDRDI-GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +E     + +  GG  +Y+ T+ AHSWTCMDLY+FATP RVTW
Sbjct  73   LEFTEPKEANSSGGGILYIKTSNAHSWTCMDLYIFATPYRVTW  115



>ref|XP_001775460.1| predicted protein [Physcomitrella patens]
 gb|EDQ59789.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = +2

Query  167  LIWV-LGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNG  343
            L+W+ +G G        +PF   D+LP+LP  I+ PVL + ++A DL+P FVG ++  N 
Sbjct  14   LVWIAIGSGADAYDLPLLPFHPEDLLPLLPGSIALPVLKNLNNAVDLLPQFVGAVSSRND  73

Query  344  SIRWKGSCFFENEARVELNG-SGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            ++ W G+CFF+NEA +E      +   GG  +++ T++AHSWTC+DLYVFATP RVTW
Sbjct  74   TVVWNGTCFFQNEAYMEYTEPKKEGHNGGGILHIRTSSAHSWTCLDLYVFATPYRVTW  131



>ref|XP_003564372.1| PREDICTED: uncharacterized protein LOC100827139 isoform X1 [Brachypodium 
distachyon]
Length=542

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = +2

Query  164  LLIWVLGLGFGFGSAF---KVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTL--  328
            +L+W  G   G  S F    +PF   DVLP+LPR+++   L +   A+D+ P+FVG    
Sbjct  21   VLLWSAGANDGAASRFAPPTLPFSPLDVLPILPRRVAMAALRALRGASDIFPVFVGAALA  80

Query  329  --APNNGS-IRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATP  499
               P  G+   WKG+CF+ENEA +  +     + GG T++L T  AHSWTCMDLYVFATP
Sbjct  81   GPGPAGGARAGWKGACFYENEAWLVFHNDSGSEYGGGTLHLKTTKAHSWTCMDLYVFATP  140

Query  500  XRVTW  514
             RVTW
Sbjct  141  YRVTW  145



>emb|CDY29265.1| BnaC01g19170D [Brassica napus]
Length=507

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVE  394
            + F V  ++ +    +SWP+LNS +SA DL+P ++G  +  N  + WKG+CF+EN+A +E
Sbjct  11   IIFAVTVLMLLTVSSLSWPLLNSVNSAVDLLPTYIGAASIKNDVVEWKGACFYENKAWLE  70

Query  395  LNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            LN     + GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  71   LNNKSGSEYGGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  110



>ref|XP_010644430.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644431.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644432.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
Length=467

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  239  LPVLPR--QISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
            LP+ PR  Q+S P+LNS HSA DL+P FVG+++ N  ++ W G+CF++  A +E N    
Sbjct  36   LPIWPRDRQLSRPILNSLHSAVDLLPTFVGSVSSNE-TVEWTGTCFYKTSAWMEFNNKSG  94

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             + GG T+++  + AHSW CMDLYVFATP +VTW
Sbjct  95   SEFGGGTLHIKVSNAHSWKCMDLYVFATPYQVTW  128



>ref|XP_010644429.1| PREDICTED: uncharacterized protein LOC100241838 isoform X4 [Vitis 
vinifera]
Length=505

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  239  LPVLPR--QISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
            LP+ PR  Q+S P+LNS HSA DL+P FVG+++ N  ++ W G+CF++  A +E N    
Sbjct  36   LPIWPRDRQLSRPILNSLHSAVDLLPTFVGSVSSNE-TVEWTGTCFYKTSAWMEFNNKSG  94

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             + GG T+++  + AHSW CMDLYVFATP +VTW
Sbjct  95   SEFGGGTLHIKVSNAHSWKCMDLYVFATPYQVTW  128



>ref|XP_002278686.1| PREDICTED: uncharacterized protein LOC100241838 isoform X3 [Vitis 
vinifera]
Length=524

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  239  LPVLPR--QISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
            LP+ PR  Q+S P+LNS HSA DL+P FVG+++ +N ++ W G+CF++  A +E N    
Sbjct  36   LPIWPRDRQLSRPILNSLHSAVDLLPTFVGSVS-SNETVEWTGTCFYKTSAWMEFNNKSG  94

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             + GG T+++  + AHSW CMDLYVFATP +VTW
Sbjct  95   SEFGGGTLHIKVSNAHSWKCMDLYVFATPYQVTW  128



>ref|XP_010644425.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644426.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644427.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
Length=545

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  239  LPVLPR--QISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
            LP+ PR  Q+S P+LNS HSA DL+P FVG+++ +N ++ W G+CF++  A +E N    
Sbjct  36   LPIWPRDRQLSRPILNSLHSAVDLLPTFVGSVS-SNETVEWTGTCFYKTSAWMEFNNKSG  94

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             + GG T+++  + AHSW CMDLYVFATP +VTW
Sbjct  95   SEFGGGTLHIKVSNAHSWKCMDLYVFATPYQVTW  128



>ref|XP_010644428.1| PREDICTED: uncharacterized protein LOC100241838 isoform X2 [Vitis 
vinifera]
Length=538

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +2

Query  239  LPVLPR--QISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
            LP+ PR  Q+S P+LNS HSA DL+P FVG+++ N  ++ W G+CF++  A +E N    
Sbjct  36   LPIWPRDRQLSRPILNSLHSAVDLLPTFVGSVSSNE-TVEWTGTCFYKTSAWMEFNNKSG  94

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             + GG T+++  + AHSW CMDLYVFATP +VTW
Sbjct  95   SEFGGGTLHIKVSNAHSWKCMDLYVFATPYQVTW  128



>emb|CAN60720.1| hypothetical protein VITISV_022056 [Vitis vinifera]
Length=555

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  239  LPVLPR--QISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
            LP+ PR  Q+S P+LNS HSA DL+P FVG+++ +N ++ W G+CF++  A +E N    
Sbjct  36   LPIWPRDRQLSRPILNSLHSAVDLLPTFVGSVS-SNETVEWTGTCFYKTSAWMEFNNKSG  94

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             + GG T+++  + AHSW CMDLYVFATP +VTW
Sbjct  95   SEFGGGTLHIKVSNAHSWKCMDLYVFATPYQVTW  128



>emb|CBI26611.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  239  LPVLPR--QISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
            LP+ PR  Q+S P+LNS HSA DL+P FVG+++ +N ++ W G+CF++  A +E N    
Sbjct  81   LPIWPRDRQLSRPILNSLHSAVDLLPTFVGSVS-SNETVEWTGTCFYKTSAWMEFNNKSG  139

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             + GG T+++  + AHSW CMDLYVFATP +VTW
Sbjct  140  SEFGGGTLHIKVSNAHSWKCMDLYVFATPYQVTW  173



>ref|XP_004970229.1| PREDICTED: uncharacterized protein LOC101777322 isoform X1 [Setaria 
italica]
Length=554

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTL----------APNNGSIRWKGS  364
            +PF   DVLP+LPR ++   L +    +D+ P+FVG            + + G +RWKG+
Sbjct  48   LPFSPTDVLPLLPRGVAMAALRALRGVSDIFPVFVGAALAGAPGAAPGSDSGGEVRWKGA  107

Query  365  CFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            CF+ENEA + L+       GG T+++ T  AHSWTC+DLYVFATP RVTW
Sbjct  108  CFYENEAWLVLHNESGSKYGGGTLHIKTTKAHSWTCIDLYVFATPYRVTW  157



>dbj|BAJ95380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   102 bits (255),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 66/108 (61%), Gaps = 5/108 (5%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGS-----IRWKGSCF  370
            A  +PF   DVLP+LPR+++   L +   A+D+ P+FVG             + WKG+CF
Sbjct  37   ATALPFSPADVLPLLPRRVAMAALLALRRASDIFPVFVGAATAGPAQAGAAPVGWKGACF  96

Query  371  FENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +ENEA +  +       GG T++L T  AHSWTCMDLYVFATP RVTW
Sbjct  97   YENEAWLVFHNDSGSKYGGGTVHLKTTKAHSWTCMDLYVFATPYRVTW  144



>gb|AFW62203.1| hypothetical protein ZEAMMB73_209421 [Zea mays]
Length=259

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 73/105 (70%), Gaps = 6/105 (6%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLN-SFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARV  391
             PFR  D+LP+LPR+++W ++  + HSA DL+P FVG +AP   +  W+G+CF EN+A +
Sbjct  24   APFRARDLLPLLPRRMAWQLMGATAHSAVDLLPSFVGAVAPGGPAAAWRGACFDENQAVL  83

Query  392  EL----NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +L    NG+    +GGA + L TA+  SWTCMDLYVFATP RV W
Sbjct  84   DLTPGRNGTAG-GLGGAVLRLKTASPQSWTCMDLYVFATPYRVAW  127



>dbj|BAB89049.1| unknown protein [Oryza sativa Japonica Group]
Length=545

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 66/104 (63%), Gaps = 4/104 (4%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI----RWKGSCFFENE  382
            +PF   DVLP+LPR  +   L +    +D+ P+FVG  +   G++     WKG+CF+ENE
Sbjct  45   LPFSPMDVLPLLPRTAAMAALRALRGVSDIFPVFVGAASDRPGAVGSRLEWKGACFYENE  104

Query  383  ARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            A + L+       GG T+++ T  AHSWTC+DLYVFATP RVTW
Sbjct  105  AWLVLHNDSGSKYGGGTLHIKTNKAHSWTCIDLYVFATPYRVTW  148



>gb|ACN29289.1| unknown [Zea mays]
 gb|AFW84862.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=559

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 67/108 (62%), Gaps = 8/108 (7%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNG--------SIRWKGSCF  370
            +PF   D+LP+LPR ++   L +    +D+ P+FVG  +            ++RWKG+CF
Sbjct  55   LPFSPADLLPLLPRGVAMAALRALRGVSDIFPVFVGAASAGGSGSVPGSGGTVRWKGACF  114

Query  371  FENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +ENEA +  +       GG T+++ T+ AHSWTC+DLYVFATP RVTW
Sbjct  115  YENEAWLVFHNESGSKYGGGTLHIKTSKAHSWTCIDLYVFATPYRVTW  162



>ref|XP_008676929.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 ref|XP_008676930.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 gb|AFW62202.1| hypothetical protein ZEAMMB73_209421 [Zea mays]
Length=522

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 73/105 (70%), Gaps = 6/105 (6%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLN-SFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARV  391
             PFR  D+LP+LPR+++W ++  + HSA DL+P FVG +AP   +  W+G+CF EN+A +
Sbjct  24   APFRARDLLPLLPRRMAWQLMGATAHSAVDLLPSFVGAVAPGGPAAAWRGACFDENQAVL  83

Query  392  EL----NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +L    NG+    +GGA + L TA+  SWTCMDLYVFATP RV W
Sbjct  84   DLTPGRNGTAG-GLGGAVLRLKTASPQSWTCMDLYVFATPYRVAW  127



>ref|NP_001061835.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAC98558.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC99810.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23749.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAG97186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=547

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 14/112 (13%)
 Frame = +2

Query  221  FRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGS-IRWKGSCFFENEARVEL  397
            FR  D+LP+LPR ++WP + S HSA DL+P FV  +AP   S + W+ +CF +NEA + L
Sbjct  41   FRARDLLPLLPRGLTWPAVGSVHSAVDLLPRFVAHVAPEASSAVAWRATCFADNEAVLTL  100

Query  398  NGSGDRDIGG-------------ATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
              S      G             A + L TA+A SWTCMDLYVFATP R+ W
Sbjct  101  THSSSAAAAGRNATTAGAAALGGALLRLKTASAQSWTCMDLYVFATPYRIGW  152



>gb|EEC83605.1| hypothetical protein OsI_29292 [Oryza sativa Indica Group]
Length=547

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 14/112 (13%)
 Frame = +2

Query  221  FRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGS-IRWKGSCFFENEARVEL  397
            FR  D+LP+LPR ++WP + S HSA DL+P FV  +AP   S + W+ +CF +NEA + L
Sbjct  41   FRARDLLPLLPRGLAWPAVGSVHSAVDLLPRFVAHVAPEASSAVAWRATCFADNEAVLTL  100

Query  398  NGSGDRDIGG-------------ATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
              S      G             A + L TA+A SWTCMDLYVFATP R+ W
Sbjct  101  THSSSAAAAGRNATTAGAAALGGALLRLKTASAQSWTCMDLYVFATPYRIGW  152



>ref|XP_004973463.1| PREDICTED: uncharacterized protein LOC101781133 [Setaria italica]
Length=546

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 73/119 (61%), Gaps = 19/119 (16%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLN-SFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARV  391
             PFR  DVLP+LPR+++W ++  + HSA DL+P FVG +AP      W+G+CF ENEA +
Sbjct  32   APFRARDVLPLLPRRLAWQLMGATAHSAVDLLPSFVGAVAPGGAPAAWRGACFAENEAVL  91

Query  392  EL-----------NGSG-------DRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             L           NG+G          +GGA ++L TA+  SWTCMDLYVFATP R+ W
Sbjct  92   SLTPGAGAGAVGRNGTGGGLHGNTSSGLGGAVLHLKTASPESWTCMDLYVFATPYRIAW  150



>ref|XP_002444358.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
 gb|EES13853.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
Length=542

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 17/117 (15%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLN-SFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARV  391
             PFR  DVLP+LPR+++W ++  + HSA DL+P FV  +AP   +  W+G+CF EN+A +
Sbjct  30   APFRARDVLPLLPRRLAWQLMGATAHSAVDLLPSFVAAVAPGGPAAAWRGACFEENQAVL  89

Query  392  ELN---GSGDRD-------------IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
             L     SG R+             +GGA I+L TA+  SWTCMDLYVFATP R+ W
Sbjct  90   SLTTPGSSGGRNGTAAGGLNSTTSGLGGAVIHLKTASPQSWTCMDLYVFATPYRIAW  146



>ref|NP_001143255.1| uncharacterized protein LOC100275783 precursor [Zea mays]
 gb|ACG30173.1| hypothetical protein [Zea mays]
Length=522

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 72/105 (69%), Gaps = 6/105 (6%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLN-SFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARV  391
             PFR  D+LP+LPR+++W ++  + HSA DL+P FVG +AP   +  W+G+CF EN+A +
Sbjct  24   APFRARDLLPLLPRRMAWQLMGATAHSAVDLLPSFVGAVAPGGPAAAWRGACFDENQAVL  83

Query  392  EL----NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +L    NG+    +GGA + L TA+  SWTCMDLYVF TP RV W
Sbjct  84   DLTPGRNGTAG-GLGGAVLRLKTASPQSWTCMDLYVFTTPYRVAW  127



>ref|NP_001143111.1| uncharacterized protein LOC100275589 [Zea mays]
 gb|ACG29052.1| hypothetical protein [Zea mays]
Length=559

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 66/108 (61%), Gaps = 8/108 (7%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNG--------SIRWKGSCF  370
            +PF   D+LP+LPR ++   L +    +D+ P+FVG  +            ++RWK +CF
Sbjct  55   LPFSPADLLPLLPRGVAMAALRALRGVSDIFPVFVGAASAGGSGSVPGSGGTVRWKRACF  114

Query  371  FENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +ENEA +  +       GG T+++ T+ AHSWTC+DLYVFATP RVTW
Sbjct  115  YENEAWLVFHNESGSKYGGGTLHIKTSKAHSWTCIDLYVFATPYRVTW  162



>ref|XP_003574496.1| PREDICTED: uncharacterized protein LOC100845920 [Brachypodium 
distachyon]
Length=536

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 11/108 (10%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVE  394
             PFR   +LP   R ++WP+ N+ HSA DL+P FV   AP   +  W+G+CF ENEA + 
Sbjct  37   APFRTGGLLP---RGLAWPLANTVHSAIDLLPTFVAFAAPGGRAAAWRGACFEENEAVLS  93

Query  395  LN-GSGDRD-------IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            L  G   R+       +GGA + L TA+A SWTCMDLYVFATP R+ W
Sbjct  94   LTPGPAGRNGTGAGAGLGGAVLQLKTASAQSWTCMDLYVFATPYRIGW  141



>ref|XP_003564373.1| PREDICTED: uncharacterized protein LOC100827139 isoform X2 [Brachypodium 
distachyon]
Length=535

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  209  FKVPFRVNDVLPVLPRQISWPVLN--SFHSAADLMPIFVGT--LAPNNGSIRWKGSCFFE  376
             + P    D LP+LP  ++ P+L      S ADL+P FVG   +  +  + +WKG+CF+E
Sbjct  33   LRAPILPADFLPLLPWSVARPLLRRLKLQSPADLLPAFVGAARVGDDARAAKWKGACFYE  92

Query  377  NEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            N A +E     +  +GG T++L T  AHSWTCMDLYVFATP RVTW
Sbjct  93   NRAWMEFRNGTNGGLGGGTVHLETTKAHSWTCMDLYVFATPYRVTW  138



>dbj|BAJ91369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 7/97 (7%)
 Frame = +2

Query  245  VLPRQISWPVLNS-FHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVEL------NG  403
            +LPR+++W ++ S  HSA DL+P FV   AP   +  W+G+CF ENEA + L      + 
Sbjct  40   LLPRRLAWSLMGSTIHSAVDLLPTFVAFAAPGGPAAAWRGACFAENEAVLSLTPGPRGSN  99

Query  404  SGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            S    +GGA + L TA+A SWTCMDLYVFATP R+ W
Sbjct  100  STAAGLGGAVLRLKTASAQSWTCMDLYVFATPYRIGW  136



>ref|XP_010060405.1| PREDICTED: uncharacterized protein LOC104448310 [Eucalyptus grandis]
Length=110

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  206  AFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEA  385
            A  +PF   DVLP+LPRQ+SWP+LN+     DL+P FVG  +P+NGS+ WKG+CF+EN A
Sbjct  27   AANLPFHPEDVLPLLPRQLSWPILNALRRPVDLLPTFVGAASPSNGSLAWKGACFYENTA  86

Query  386  RVELNG  403
             +E + 
Sbjct  87   WLEFHN  92



>ref|XP_006452283.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
 gb|ESR65523.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
Length=463

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  317  VGTLAPNNGSIRWKGSCFFENEARVELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFAT  496
            +G+ +   G++ WKG+CF++N+A +E +     + GG T+++  + AHSWTCMDLYVFAT
Sbjct  1    MGSASDQTGTVEWKGACFYQNQAWMEFHNKSGSEFGGGTLHIKVSDAHSWTCMDLYVFAT  60

Query  497  PXRVTW  514
            P RVTW
Sbjct  61   PYRVTW  66



>ref|XP_010064384.1| PREDICTED: uncharacterized protein LOC104451424 [Eucalyptus grandis]
Length=316

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = +2

Query  194  GFGSAFKV--PFRVNDVL---PVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWK  358
            GF SA     P  ++ +L   P+LPRQ+SWP+LN+     DL+P FVG  +P++GS+ WK
Sbjct  122  GFSSAISAASPLPLHALLSAHPLLPRQLSWPILNALRRPVDLLPAFVGAASPSSGSLAWK  181

Query  359  GSCFFENEARVELNGSGDRDIGGATIYLSTAA  454
            G+CF+EN A +E +     + GG T+++   +
Sbjct  182  GACFYENTAWLEFHNETGSEFGGGTLHIKVKS  213



>gb|AFG71483.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
 gb|AFG71484.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
 gb|AFG71485.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
 gb|AFG71486.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
 gb|AFG71487.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
 gb|AFG71488.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
 gb|AFG71489.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
 gb|AFG71490.1| hypothetical protein UMN_5876_01, partial [Pinus taeda]
Length=77

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSIRWKGSCF  370
                 K+PFR  D LP+LPRQ+SWPVLN+ HSA DL+P+FVG+++ +   ++W GSCF
Sbjct  21   LSEGLKMPFRPKDFLPMLPRQVSWPVLNTIHSAVDLLPLFVGSVS-DQEIVQWNGSCF  77



>gb|EAY76121.1| hypothetical protein OsI_04050 [Oryza sativa Indica Group]
Length=405

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +2

Query  260  ISWPVLN--SFHSAADLMPIFVGTL-APNNGSIR---WKGSCFFENEARVELNGSGDRDI  421
            ++ P+L   +   AADL+P FVG    P++G  R   WKG+CF++N A +E +   D  +
Sbjct  52   VAQPLLRRLALRGAADLLPSFVGVAREPDDGGARAAEWKGACFYDNRAWMEFHNGTDGGL  111

Query  422  GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            GG T++L T  AHSWTC+DLYVFATP RVTW
Sbjct  112  GGGTLHLETNKAHSWTCIDLYVFATPYRVTW  142



>ref|XP_004970230.1| PREDICTED: uncharacterized protein LOC101777322 isoform X2 [Setaria 
italica]
Length=543

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = +2

Query  260  ISWPVLN--SFHSAADLMPIFVGTL-APNNG----SIRWKGSCFFENEARVELNGSGDRD  418
            ++ P+L   +    ADL+P FVG   AP +G    +  WKG+CF+EN A VE     +  
Sbjct  55   VAQPLLRRLALRGPADLLPSFVGAARAPEDGDAGSTAEWKGACFYENRAWVEFRNGTNGG  114

Query  419  IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +GG  +++ T  AHSWTC+DLYVFATP RVTW
Sbjct  115  LGGGVVHVETTKAHSWTCIDLYVFATPYRVTW  146



>ref|NP_001044498.2| Os01g0793500 [Oryza sativa Japonica Group]
 dbj|BAD53001.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94904.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55516.1| hypothetical protein OsJ_03735 [Oryza sativa Japonica Group]
 dbj|BAF06412.2| Os01g0793500 [Oryza sativa Japonica Group]
Length=539

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 6/91 (7%)
 Frame = +2

Query  260  ISWPVLN--SFHSAADLMPIFVGTL-APNNGSIR---WKGSCFFENEARVELNGSGDRDI  421
            ++ P+L   +   AADL+P FVG    P +G  R   WKG+CF++N A +E +   D  +
Sbjct  52   VAQPLLRRLALRGAADLLPSFVGVAREPGDGGARAAEWKGACFYDNRAWMEFHNGTDGGL  111

Query  422  GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            GG T++L T  AHSWTC+DLYVFATP RVTW
Sbjct  112  GGGTLHLETNKAHSWTCIDLYVFATPYRVTW  142



>emb|CDM84540.1| unnamed protein product [Triticum aestivum]
Length=539

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 48/79 (61%), Gaps = 6/79 (8%)
 Frame = +2

Query  296  ADLMPIFVGTLAPNNG----SIRWKGSCFFENEARVELNGSGDRDIGGAT--IYLSTAAA  457
            ADL+P FVG      G    +  WKG+CF+EN A +E   +   D G     +YL T  A
Sbjct  64   ADLLPAFVGAARVPGGDGARAAEWKGACFYENRAWMEFRDANGTDGGLGGGTVYLETTKA  123

Query  458  HSWTCMDLYVFATPXRVTW  514
            HSWTCMDLYVFATP RVTW
Sbjct  124  HSWTCMDLYVFATPYRVTW  142



>ref|XP_008654687.1| PREDICTED: uncharacterized protein LOC100275589 isoform X1 [Zea 
mays]
 gb|ACR35704.1| unknown [Zea mays]
 gb|AFW84864.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=542

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = +2

Query  260  ISWPVLN--SFHSAADLMPIFVGTL-APNNGSI----RWKGSCFFENEARVELNGSGDRD  418
            ++ P+L   +    ADL+P FVG   AP +        WKG+CF+EN A VE        
Sbjct  54   VAQPLLRRLALRGPADLLPAFVGAARAPGSDDAYPVAEWKGACFYENRAWVEFRNGTGGG  113

Query  419  IGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +GG  +++ T+ AHSWTC+DLYVFATP RVTW
Sbjct  114  LGGGVVHVETSKAHSWTCIDLYVFATPYRVTW  145



>ref|XP_006644833.1| PREDICTED: uncharacterized protein LOC102706146 [Oryza brachyantha]
Length=540

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +2

Query  260  ISWPVLN--SFHSAADLMPIFVGTL-APNNG---SIRWKGSCFFENEARVELNGSGDRDI  421
            ++ P+L   +   AADL+P FVG    P++G   +  WKG+CF+EN A +E +   +  +
Sbjct  53   VAQPLLRRLALRGAADLLPAFVGVAREPSDGDAPAAGWKGACFYENRAWMEFHNGTEGGL  112

Query  422  GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            GG T++L T  AHSWTC+DLYVFATP RVTW
Sbjct  113  GGGTLHLETNKAHSWTCIDLYVFATPYRVTW  143



>gb|EMT12587.1| hypothetical protein F775_11937 [Aegilops tauschii]
Length=453

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 21/94 (22%)
 Frame = +2

Query  236  VLPVLPRQISWPVL-NSFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVELNGSGD  412
             + +LPR++   ++ ++ HSA DL+P FV   AP   +  W+G+CF ENEA         
Sbjct  35   AMDLLPRRLEGSLMGDTVHSAVDLLPTFVAFAAPGGPAAAWRGACFAENEA---------  85

Query  413  RDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
                       TA+A SWTCMDLYVFATP R+ W
Sbjct  86   -----------TASAQSWTCMDLYVFATPYRIGW  108



>gb|EMT03744.1| hypothetical protein F775_19554 [Aegilops tauschii]
Length=637

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 49/81 (60%), Gaps = 6/81 (7%)
 Frame = +2

Query  290  SAADLMPIFVGTL-APNNGSIR---WKGSCFFENEARVELNGSGDRDIGGAT--IYLSTA  451
            S ADL+P  VG    P   + R   WKG+CF+EN A +E   +   D G     ++L T 
Sbjct  160  SPADLLPPAVGAARVPGGDAARAAEWKGACFYENRAWMEFRDANGTDGGLGGGTVHLETT  219

Query  452  AAHSWTCMDLYVFATPXRVTW  514
             AHSWTCMDLYVFATP RVTW
Sbjct  220  KAHSWTCMDLYVFATPYRVTW  240


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 5/91 (5%)
 Frame = +2

Query  188  GFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVG--TLAPNNGS---IR  352
            G G G    +PF   DVLP+LPR+++   L +   A+D+ P+FVG  T  P       + 
Sbjct  37   GAGSGILTSLPFSPTDVLPLLPRRVAMAALRALRGASDIFPVFVGAATAGPAQAGTAPVG  96

Query  353  WKGSCFFENEARVELNGSGDRDIGGATIYLS  445
            WKG+CF+ENEA +  +       GG T++L 
Sbjct  97   WKGACFYENEAWLSFHNDSGSKYGGGTVHLK  127



>gb|AAB61100.1| ESTs gb|R30459,gb|N38441 come from this gene [Arabidopsis thaliana]
Length=551

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  197  FGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIF  316
             G + KVPF VNDVLP+LPRQ+SWPVLNSFH+A DL+P+ 
Sbjct  21   LGQSLKVPFSVNDVLPMLPRQVSWPVLNSFHNAVDLLPVL  60



>gb|AFW62204.1| hypothetical protein ZEAMMB73_209421 [Zea mays]
Length=120

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 6/82 (7%)
 Frame = +2

Query  218  PFRVNDVLPVLPRQISWPVLN-SFHSAADLMPIFVGTLAPNNGSIRWKGSCFFENEARVE  394
            PFR  D+LP+LPR+++W ++  + HSA DL+P FVG +AP   +  W+G+CF EN+A ++
Sbjct  25   PFRARDLLPLLPRRMAWQLMGATAHSAVDLLPSFVGAVAPGGPAAAWRGACFDENQAVLD  84

Query  395  L----NGSGDRDIGGATIYLST  448
            L    NG+    +GGA + L  
Sbjct  85   LTPGRNGTAG-GLGGAVLRLKV  105



>gb|AFW84863.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=148

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (54%), Gaps = 8/89 (9%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNG--------SIRWKGSCF  370
            +PF   D+LP+LPR ++   L +    +D+ P+FVG  +            ++RWKG+CF
Sbjct  55   LPFSPADLLPLLPRGVAMAALRALRGVSDIFPVFVGAASAGGSGSVPGSGGTVRWKGACF  114

Query  371  FENEARVELNGSGDRDIGGATIYLSTAAA  457
            +ENEA +  +       GG T+++   A+
Sbjct  115  YENEAWLVFHNESGSKYGGGTLHIKVRAS  143



>gb|EEC71627.1| hypothetical protein OsI_04051 [Oryza sativa Indica Group]
 gb|EEE55517.1| hypothetical protein OsJ_03736 [Oryza sativa Japonica Group]
Length=141

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = +2

Query  215  VPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGTLAPNNGSI----RWKGSCFFENE  382
            +PF   DVLP+LPR  +   L +    +D+ P+FVG  +   G++     WKG+CF+ENE
Sbjct  45   LPFSPMDVLPLLPRTAAMAALRALRGVSDIFPVFVGAASDRPGAVGSRLEWKGACFYENE  104

Query  383  ARVELNGSGDRDIGGATIYLST  448
            A + L+       GG T+++ +
Sbjct  105  AWLVLHNDSGSKYGGGTLHIKS  126



>gb|KCW70170.1| hypothetical protein EUGRSUZ_F03459 [Eucalyptus grandis]
Length=439

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  389  VELNGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            +E +   + + GG T+++    AHSWTCMDLYVFATP RVTW
Sbjct  1    MEFHNKSESEFGGGTLHIKVNKAHSWTCMDLYVFATPYRVTW  42



>gb|KHN38290.1| hypothetical protein glysoja_003955 [Glycine soja]
Length=439

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +2

Query  398  NGSGDRDIGGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            N SG +  GG T++L  + AHSWTCMDLY+FATP RVTW
Sbjct  5    NKSGTQ-FGGGTLHLKVSNAHSWTCMDLYIFATPYRVTW  42



>ref|XP_002522971.1| hypothetical protein RCOM_0585690 [Ricinus communis]
 gb|EEF39401.1| hypothetical protein RCOM_0585690 [Ricinus communis]
Length=244

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 60/122 (49%), Gaps = 7/122 (6%)
 Frame = +2

Query  146  RQLRLTLLIWVLGLGFGFGSAFKVPFRVNDVLPVLPRQISWPVLNSFHSAADLMPIFVGT  325
            + L + +++++         + K  F     + VL R  S   LNS    +D++PIFVG 
Sbjct  10   KILTIFIMLFIFNTEAARSPSKKQKFESMLSMEVL-RPTSLSYLNS--DISDILPIFVGD  66

Query  326  LAPNNGSIRWKGSCFFENEARVELNGSGDRDIGG----ATIYLSTAAAHSWTCMDLYVFA  493
            ++  N +I W   CF +NEAR+E +       GG      +  + ++    +C DLY+F+
Sbjct  67   ISYVNNTITWSAFCFRQNEARLEFHKHPASKYGGWHTSCQVTGNASSPLDLSCADLYIFS  126

Query  494  TP  499
            TP
Sbjct  127  TP  128



>emb|CDX89285.1| BnaA01g16080D [Brassica napus]
Length=475

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  422  GGATIYLSTAAAHSWTCMDLYVFATPXRVTW  514
            GG T+++    AHSWTCMD+YVF TP RVTW
Sbjct  48   GGGTLHIKVDKAHSWTCMDIYVFVTPYRVTW  78



>ref|XP_010652908.1| PREDICTED: uncharacterized protein LOC100251867 isoform X2 [Vitis 
vinifera]
Length=430

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +2

Query  446  TAAAHSWTCMDLYVFATPXRVTW  514
            TA AHSWTCMDLYVFATP RVTW
Sbjct  13   TAEAHSWTCMDLYVFATPYRVTW  35



>gb|EMS49816.1| hypothetical protein TRIUR3_06457 [Triticum urartu]
Length=589

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +2

Query  446  TAAAHSWTCMDLYVFATPXRVTW  514
            T  AHSWTCMDLYVFATP RVTW
Sbjct  54   TTKAHSWTCMDLYVFATPYRVTW  76



>tpg|DAA42766.1| TPA: hypothetical protein ZEAMMB73_498672 [Zea mays]
Length=659

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 7/63 (11%)
 Frame = +2

Query  230  NDVLPVLPRQISWPVLN--SFHSAADLMPIFVGTL-APNNGS----IRWKGSCFFENEAR  388
            +D+LP+LP  ++  +L   +  S ADL+P FVG   AP +       +WKG+CFFEN A 
Sbjct  578  DDLLPLLPWSVAQSLLCRLALRSPADLLPAFVGAAHAPRSDDAHPVTKWKGACFFENRAW  637

Query  389  VEL  397
            +E 
Sbjct  638  LEF  640



>ref|XP_006660599.1| PREDICTED: uncharacterized protein LOC102705746 [Oryza brachyantha]
Length=420

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  440  LSTAAAHSWTCMDLYVFATPXRVTW  514
            + TA+A SWTCMDLYVFATP R+TW
Sbjct  1    MQTASAQSWTCMDLYVFATPYRITW  25



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720