BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018B04

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010270525.1|  PREDICTED: RING-H2 finger protein ATL80          61.2    1e-09   Nelumbo nucifera [Indian lotus]
emb|CAN59779.1|  hypothetical protein VITISV_024654                   61.6    3e-09   Vitis vinifera
ref|XP_009359625.1|  PREDICTED: RING-H2 finger protein ATL80-like...  59.7    6e-09   
ref|XP_009359623.1|  PREDICTED: RING-H2 finger protein ATL80-like...  59.3    7e-09   Pyrus x bretschneideri [bai li]
ref|XP_006342165.1|  PREDICTED: RING-H2 finger protein ATL80-like     58.9    7e-09   Solanum tuberosum [potatoes]
ref|XP_002274304.2|  PREDICTED: RING-H2 finger protein ATL8           59.3    8e-09   
ref|XP_009766634.1|  PREDICTED: RING-H2 finger protein ATL8-like      58.9    8e-09   Nicotiana sylvestris
ref|XP_009595867.1|  PREDICTED: RING-H2 finger protein ATL80          58.5    1e-08   Nicotiana tomentosiformis
ref|XP_004238452.1|  PREDICTED: RING-H2 finger protein ATL80-like     58.5    1e-08   Solanum lycopersicum
ref|XP_010266252.1|  PREDICTED: RING-H2 finger protein ATL80          58.2    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_002307200.1|  hypothetical protein POPTR_0005s10190g           58.2    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_007158027.1|  hypothetical protein PHAVU_002G118000g           58.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_002510714.1|  protein with unknown function                    57.8    2e-08   Ricinus communis
ref|XP_010686796.1|  PREDICTED: RING-H2 finger protein ATL80          57.8    2e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK44145.1|  unknown                                               57.0    2e-08   Medicago truncatula
gb|EYU23603.1|  hypothetical protein MIMGU_mgv1a014346mg              57.4    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_002276539.1|  PREDICTED: RING-H2 finger protein ATL80          57.4    3e-08   Vitis vinifera
ref|XP_008379650.1|  PREDICTED: RING-H2 finger protein ATL80-like     57.8    3e-08   Malus domestica [apple tree]
ref|XP_009604464.1|  PREDICTED: RING-H2 finger protein ATL80-like     57.0    3e-08   Nicotiana tomentosiformis
ref|XP_007156261.1|  hypothetical protein PHAVU_003G271400g           57.4    3e-08   Phaseolus vulgaris [French bean]
ref|XP_004253118.1|  PREDICTED: RING-H2 finger protein ATL8-like      57.0    4e-08   Solanum lycopersicum
ref|XP_004512286.1|  PREDICTED: RING-H2 finger protein ATL8-like      57.4    4e-08   Cicer arietinum [garbanzo]
ref|XP_003612411.1|  Ring finger protein                              57.4    4e-08   Medicago truncatula
ref|XP_003533404.1|  PREDICTED: RING-H2 finger protein ATL80-like     57.0    4e-08   Glycine max [soybeans]
gb|KDP36758.1|  hypothetical protein JCGZ_08049                       57.0    4e-08   Jatropha curcas
emb|CDP01769.1|  unnamed protein product                              57.4    4e-08   Coffea canephora [robusta coffee]
ref|XP_011022135.1|  PREDICTED: RING-H2 finger protein ATL8-like      56.6    5e-08   Populus euphratica
ref|XP_008242103.1|  PREDICTED: RING-H2 finger protein ATL8           56.6    6e-08   Prunus mume [ume]
ref|XP_010064613.1|  PREDICTED: RING-H2 finger protein ATL80          56.2    7e-08   Eucalyptus grandis [rose gum]
ref|XP_003537694.1|  PREDICTED: RING-H2 finger protein ATL8-like      56.6    9e-08   Glycine max [soybeans]
ref|XP_009775127.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.8    9e-08   Nicotiana sylvestris
ref|XP_004232585.1|  PREDICTED: RING-H2 finger protein ATL8-like      55.8    9e-08   Solanum lycopersicum
ref|XP_006435418.1|  hypothetical protein CICLE_v10004041mg           55.8    1e-07   Citrus clementina [clementine]
ref|XP_007202550.1|  hypothetical protein PRUPE_ppa011201mg           56.2    1e-07   Prunus persica
gb|KDO85202.1|  hypothetical protein CISIN_1g043163mg                 55.5    1e-07   Citrus sinensis [apfelsine]
ref|XP_004287710.1|  PREDICTED: RING-H2 finger protein ATL8           55.8    1e-07   Fragaria vesca subsp. vesca
ref|XP_007018117.1|  RING/U-box superfamily protein, putative         55.5    2e-07   Theobroma cacao [chocolate]
ref|XP_009772726.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.5    2e-07   Nicotiana sylvestris
gb|KJB14191.1|  hypothetical protein B456_002G113500                  55.1    2e-07   Gossypium raimondii
gb|AFW90598.1|  E3 ubiquitin ligase                                   55.1    2e-07   Solanum tuberosum [potatoes]
ref|XP_002526834.1|  protein with unknown function                    55.5    2e-07   Ricinus communis
ref|XP_006342531.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.1    2e-07   Solanum tuberosum [potatoes]
ref|XP_009601753.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.1    2e-07   Nicotiana tomentosiformis
ref|XP_011074071.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.1    2e-07   
ref|XP_009413072.1|  PREDICTED: RING-H2 finger protein ATL80-like     55.1    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002526830.1|  protein with unknown function                    55.8    2e-07   
ref|XP_008812592.1|  PREDICTED: RING-H2 finger protein ATL80-like     54.7    2e-07   Phoenix dactylifera
ref|XP_004234505.1|  PREDICTED: RING-H2 finger protein ATL8-like      54.7    2e-07   Solanum lycopersicum
ref|XP_011041176.1|  PREDICTED: RING-H2 finger protein ATL8           54.7    2e-07   Populus euphratica
ref|XP_009589982.1|  PREDICTED: RING-H2 finger protein ATL8-like      54.7    3e-07   Nicotiana tomentosiformis
ref|XP_004159747.1|  PREDICTED: RING-H2 finger protein ATL80-like     54.7    3e-07   
ref|XP_006343322.1|  PREDICTED: RING-H2 finger protein ATL8-like      54.3    3e-07   Solanum tuberosum [potatoes]
ref|XP_003547882.1|  PREDICTED: RING-H2 finger protein ATL80-like     54.7    3e-07   Glycine max [soybeans]
ref|XP_002306993.2|  hypothetical protein POPTR_0005s27660g           54.7    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_009338623.1|  PREDICTED: RING-H2 finger protein ATL80-like     54.7    3e-07   
ref|XP_009795598.1|  PREDICTED: RING-H2 finger protein ATL80-like     54.3    3e-07   Nicotiana sylvestris
ref|XP_009776172.1|  PREDICTED: RING-H2 finger protein ATL8-like      54.3    3e-07   Nicotiana sylvestris
ref|XP_002301903.1|  zinc finger family protein                       54.3    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004146217.1|  PREDICTED: RING-H2 finger protein ATL80-like     53.9    4e-07   Cucumis sativus [cucumbers]
ref|XP_008392292.1|  PREDICTED: RING-H2 finger protein ATL80-like     54.3    4e-07   
ref|XP_008449155.1|  PREDICTED: RING-H2 finger protein ATL80          53.9    4e-07   Cucumis melo [Oriental melon]
ref|XP_004145558.1|  PREDICTED: RING-H2 finger protein ATL80-like     53.9    4e-07   Cucumis sativus [cucumbers]
ref|XP_011034822.1|  PREDICTED: RING-H2 finger protein ATL8-like      54.3    4e-07   Populus euphratica
ref|XP_003517122.1|  PREDICTED: RING-H2 finger protein ATL8-like      54.3    5e-07   Glycine max [soybeans]
ref|XP_010094527.1|  RING-H2 finger protein ATL80                     53.9    5e-07   Morus notabilis
ref|XP_006366657.1|  PREDICTED: RING-H2 finger protein ATL80-like     53.9    5e-07   Solanum tuberosum [potatoes]
ref|XP_010498523.1|  PREDICTED: RING-H2 finger protein ATL80-like     53.9    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010911522.1|  PREDICTED: RING-H2 finger protein ATL44-like     53.5    6e-07   Elaeis guineensis
gb|EPS68943.1|  hypothetical protein M569_05824                       53.5    7e-07   Genlisea aurea
ref|XP_004253245.1|  PREDICTED: RING-H2 finger protein ATL80-like     53.1    8e-07   Solanum lycopersicum
ref|XP_008453009.1|  PREDICTED: RING-H2 finger protein ATL80          53.1    8e-07   Cucumis melo [Oriental melon]
ref|XP_009150790.1|  PREDICTED: RING-H2 finger protein ATL44-like     53.1    9e-07   Brassica rapa
ref|XP_002532473.1|  protein with unknown function                    53.1    1e-06   
ref|XP_009620555.1|  PREDICTED: RING-H2 finger protein ATL80-like     52.8    1e-06   Nicotiana tomentosiformis
gb|ADI71977.1|  E3 ubiquitin ligase                                   52.8    1e-06   Capsicum annuum
ref|XP_010477335.1|  PREDICTED: RING-H2 finger protein ATL80          52.8    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006416360.1|  hypothetical protein EUTSA_v10009964mg           52.8    2e-06   Eutrema salsugineum [saltwater cress]
ref|NP_179337.1|  RING-H2 finger protein ATL44                        52.4    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462813.1|  PREDICTED: RING-H2 finger protein ATL80-like     53.1    2e-06   
ref|XP_011100182.1|  PREDICTED: RING-H2 finger protein ATL80-like     52.4    2e-06   Sesamum indicum [beniseed]
ref|XP_009395296.1|  PREDICTED: RING-H2 finger protein ATL8-like      52.4    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002886113.1|  ring-H2 finger A3A                               52.4    2e-06   
ref|NP_173506.1|  RING-H2 finger protein ATL80                        52.4    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537218.1|  PREDICTED: RING-H2 finger protein ATL80-like     52.0    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_003629097.1|  Ring finger protein                              52.4    2e-06   Medicago truncatula
ref|XP_010908037.1|  PREDICTED: RING-H2 finger protein ATL8-like      52.0    3e-06   
ref|XP_010935347.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  52.0    3e-06   
emb|CDY33648.1|  BnaC08g19480D                                        52.0    3e-06   Brassica napus [oilseed rape]
gb|KFK44194.1|  hypothetical protein AALP_AA1G226700                  52.0    3e-06   Arabis alpina [alpine rockcress]
emb|CDY69366.1|  BnaAnng30200D                                        51.6    3e-06   Brassica napus [oilseed rape]
ref|XP_002890411.1|  zinc finger family protein                       52.0    3e-06   
emb|CDX96619.1|  BnaA08g21620D                                        52.0    3e-06   
ref|XP_004509462.1|  PREDICTED: RING-H2 finger protein ATL80-like     52.0    3e-06   Cicer arietinum [garbanzo]
ref|XP_010534292.1|  PREDICTED: RING-H2 finger protein ATL80-like     51.6    3e-06   Tarenaya hassleriana [spider flower]
emb|CDY31495.1|  BnaC05g16040D                                        51.6    3e-06   Brassica napus [oilseed rape]
ref|XP_009109289.1|  PREDICTED: RING-H2 finger protein ATL45-like     51.6    3e-06   Brassica rapa
ref|XP_009110211.1|  PREDICTED: RING-H2 finger protein ATL80          51.6    3e-06   Brassica rapa
ref|XP_006303328.1|  hypothetical protein CARUB_v10010177mg           52.4    3e-06   
ref|XP_009149561.1|  PREDICTED: RING-H2 finger protein ATL80          51.6    4e-06   Brassica rapa
emb|CDY29504.1|  BnaA06g14660D                                        51.6    4e-06   Brassica napus [oilseed rape]
ref|XP_010432277.1|  PREDICTED: RING-H2 finger protein ATL45-like     51.6    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008786682.1|  PREDICTED: RING-H2 finger protein ATL44          51.2    4e-06   Phoenix dactylifera
ref|XP_010029567.1|  PREDICTED: RING-H2 finger protein ATL8-like      51.6    4e-06   Eucalyptus grandis [rose gum]
ref|XP_010446920.1|  PREDICTED: RING-H2 finger protein ATL45-like     51.2    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006409305.1|  hypothetical protein EUTSA_v10023141mg           50.8    5e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006285317.1|  hypothetical protein CARUB_v10006700mg           51.2    6e-06   Capsella rubella
emb|CDY31863.1|  BnaC07g15130D                                        50.4    6e-06   Brassica napus [oilseed rape]
ref|XP_009384604.1|  PREDICTED: RING-H2 finger protein ATL44-like     50.8    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK56013.1|  zinc finger protein                                   50.8    6e-06   Brassica rapa
ref|XP_009103326.1|  PREDICTED: RING-H2 finger protein ATL80-like     50.8    6e-06   Brassica rapa
emb|CDY41651.1|  BnaC03g62330D                                        50.8    6e-06   Brassica napus [oilseed rape]
ref|XP_010437466.1|  PREDICTED: RING-H2 finger protein ATL45-like     50.8    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009138362.1|  PREDICTED: RING-H2 finger protein ATL45-like     50.8    7e-06   Brassica rapa
ref|XP_006298646.1|  hypothetical protein CARUB_v10014735mg           50.8    7e-06   Capsella rubella
ref|XP_010489373.1|  PREDICTED: RING-H2 finger protein ATL44-like     50.8    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007135973.1|  hypothetical protein PHAVU_009G007400g           50.4    7e-06   Phaseolus vulgaris [French bean]
ref|NP_001241583.1|  uncharacterized protein LOC100794614             50.4    8e-06   Glycine max [soybeans]
ref|XP_002867072.1|  ring-H2 finger A3B                               50.8    8e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_006390200.1|  hypothetical protein EUTSA_v10019183mg           50.4    8e-06   Eutrema salsugineum [saltwater cress]
emb|CDX72540.1|  BnaC07g45620D                                        50.4    8e-06   
ref|XP_006412098.1|  hypothetical protein EUTSA_v10027339mg           50.4    9e-06   Eutrema salsugineum [saltwater cress]
gb|KDP43788.1|  hypothetical protein JCGZ_22415                       50.4    1e-05   Jatropha curcas
ref|XP_008804625.1|  PREDICTED: RING-H2 finger protein ATL8           50.1    1e-05   Phoenix dactylifera
ref|XP_009104676.1|  PREDICTED: RING-H2 finger protein ATL8-like      50.1    1e-05   Brassica rapa
emb|CDX68098.1|  BnaA07g21380D                                        50.1    1e-05   
ref|NP_195273.1|  putative RING-H2 finger protein RHA3b               50.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85948.1|  BnaC06g21860D                                        50.1    1e-05   
emb|CDY01352.1|  BnaA07g11250D                                        50.1    1e-05   
ref|XP_010515011.1|  PREDICTED: RING-H2 finger protein ATL44          50.1    1e-05   Camelina sativa [gold-of-pleasure]
gb|KFK42061.1|  hypothetical protein AALP_AA2G206300                  49.7    2e-05   Arabis alpina [alpine rockcress]
ref|XP_010467517.1|  PREDICTED: RING-H2 finger protein ATL44-like     49.3    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDY49431.1|  BnaC07g06500D                                        49.3    2e-05   Brassica napus [oilseed rape]
emb|CDY45988.1|  BnaA02g18080D                                        49.3    2e-05   Brassica napus [oilseed rape]
ref|XP_008779008.1|  PREDICTED: RING-H2 finger protein ATL8-like      49.3    3e-05   Phoenix dactylifera
ref|XP_003603861.1|  RING-H2 finger protein ATL1B                     49.3    3e-05   Medicago truncatula
ref|XP_009420835.1|  PREDICTED: RING-H2 finger protein ATL8-like      48.9    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002887637.1|  hypothetical protein ARALYDRAFT_316562           48.5    5e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_010548197.1|  PREDICTED: RING-H2 finger protein ATL44-like     48.1    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_004983797.1|  PREDICTED: RING-H2 finger protein ATL45-like     49.3    5e-05   
ref|NP_177767.1|  RING-H2 finger protein ATL8                         48.1    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63811.1|  putative RING zinc finger protein                     48.1    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302871.1|  hypothetical protein CARUB_v10021002mg           48.1    6e-05   Capsella rubella
ref|XP_010530985.1|  PREDICTED: RING-H2 finger protein ATL44-like     47.8    7e-05   Tarenaya hassleriana [spider flower]
emb|CDY24337.1|  BnaA07g02620D                                        47.8    8e-05   Brassica napus [oilseed rape]
ref|XP_010416561.1|  PREDICTED: RING-H2 finger protein ATL8           47.8    9e-05   Camelina sativa [gold-of-pleasure]
ref|XP_003527275.1|  PREDICTED: RING-H2 finger protein ATL80-like     47.4    1e-04   Glycine max [soybeans]
ref|XP_010471794.1|  PREDICTED: RING-H2 finger protein ATL8-like      47.4    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009121114.1|  PREDICTED: RING-H2 finger protein ATL44          47.8    1e-04   Brassica rapa
emb|CDX75506.1|  BnaA01g01960D                                        47.4    1e-04   
ref|XP_009128176.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  47.4    1e-04   Brassica rapa
gb|KHN20089.1|  RING-H2 finger protein ATL80                          46.2    2e-04   Glycine soja [wild soybean]
ref|XP_010428701.1|  PREDICTED: RING-H2 finger protein ATL8-like      46.6    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009383554.1|  PREDICTED: RING-H2 finger protein ATL45-like     46.2    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009106302.1|  PREDICTED: RING-H2 finger protein ATL8           45.8    4e-04   Brassica rapa
emb|CDX87603.1|  BnaA07g32700D                                        45.8    4e-04   
emb|CDX88272.1|  BnaC06g37160D                                        45.8    4e-04   
emb|CDX69143.1|  BnaC01g03100D                                        45.8    4e-04   
ref|XP_009101519.1|  PREDICTED: RING-H2 finger protein ATL45          46.2    7e-04   Brassica rapa



>ref|XP_010270525.1| PREDICTED: RING-H2 finger protein ATL80 [Nelumbo nucifera]
Length=189

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICVVGLV VARCAWLRR+  GA G
Sbjct  27   DFVVILAALLCALICVVGLVAVARCAWLRRVSGGAAG  63



>emb|CAN59779.1| hypothetical protein VITISV_024654 [Vitis vinifera]
Length=312

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICV+GLV VARCAWLRRI   AN
Sbjct  27   DFVVILAALLCALICVLGLVAVARCAWLRRISGAAN  62



>ref|XP_009359625.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009359626.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X3 [Pyrus 
x bretschneideri]
Length=215

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAALLCAVICVVGL+ VARCAWLRR+  G
Sbjct  34   DFVVILAALLCAVICVVGLLAVARCAWLRRVSGG  67



>ref|XP_009359623.1| PREDICTED: RING-H2 finger protein ATL80-like isoform X1 [Pyrus 
x bretschneideri]
Length=227

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAALLCAVICVVGL+ VARCAWLRR+  G
Sbjct  34   DFVVILAALLCAVICVVGLLAVARCAWLRRVSGG  67



>ref|XP_006342165.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=180

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G
Sbjct  23   DFVVILAALLCALICVLGLVAVARCAWIRRISARATG  59



>ref|XP_002274304.2| PREDICTED: RING-H2 finger protein ATL8 [Vitis vinifera]
Length=228

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICV+GLV VARCAWLRRI   AN
Sbjct  27   DFVVILAALLCALICVLGLVAVARCAWLRRISGAAN  62



>ref|XP_009766634.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana sylvestris]
Length=191

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G
Sbjct  34   DFVVILAALLCALICVLGLVAVARCAWIRRISARATG  70



>ref|XP_009595867.1| PREDICTED: RING-H2 finger protein ATL80 [Nicotiana tomentosiformis]
Length=191

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G
Sbjct  34   DFVVILAALLCALICVLGLVAVARCAWIRRISARATG  70



>ref|XP_004238452.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum lycopersicum]
Length=183

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICV+GLV VARCAW+RRI A A G
Sbjct  25   DFVVILAALLCALICVLGLVAVARCAWIRRISARATG  61



>ref|XP_010266252.1| PREDICTED: RING-H2 finger protein ATL80 [Nelumbo nucifera]
Length=189

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            DF+VILAALLCA+ICVVGLV VARCAWLRR   GA
Sbjct  27   DFVVILAALLCALICVVGLVAVARCAWLRRASGGA  61



>ref|XP_002307200.1| hypothetical protein POPTR_0005s10190g [Populus trichocarpa]
 gb|ABK93092.1| unknown [Populus trichocarpa]
 gb|EEE94196.1| hypothetical protein POPTR_0005s10190g [Populus trichocarpa]
Length=200

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICVVGL+  ARCAWLRR+  GA+
Sbjct  24   DFVVILAALLCALICVVGLIAAARCAWLRRVTGGAS  59



>ref|XP_007158027.1| hypothetical protein PHAVU_002G118000g [Phaseolus vulgaris]
 gb|ESW30021.1| hypothetical protein PHAVU_002G118000g [Phaseolus vulgaris]
Length=220

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICVVGLV VARCAWLRR   G N
Sbjct  31   DFVVILAALLCALICVVGLVAVARCAWLRRGPGGGN  66



>ref|XP_002510714.1| protein with unknown function [Ricinus communis]
 gb|EEF52901.1| protein with unknown function [Ricinus communis]
Length=194

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ + AN 
Sbjct  36   DFVVILAALLCALICVLGLIAVARCAWLRRLSSMANS  72



>ref|XP_010686796.1| PREDICTED: RING-H2 finger protein ATL80 [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICV+GLV VARCAWLRR+  GA 
Sbjct  29   DFVVILAALLCALICVLGLVAVARCAWLRRLAGGAT  64



>gb|AFK44145.1| unknown [Medicago truncatula]
Length=116

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICVVGL+ VARCAWLRR     N 
Sbjct  32   DFVVILAALLCALICVVGLIAVARCAWLRRDSGAGNS  68



>gb|EYU23603.1| hypothetical protein MIMGU_mgv1a014346mg [Erythranthe guttata]
Length=192

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICV+GLV VARCAW+RR+  G++
Sbjct  30   DFVVILAALLCALICVLGLVTVARCAWIRRLAGGSS  65



>ref|XP_002276539.1| PREDICTED: RING-H2 finger protein ATL80 [Vitis vinifera]
 emb|CBI21575.3| unnamed protein product [Vitis vinifera]
Length=182

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAALLCA+ICVVGL+ VARCAWLRR  AG
Sbjct  27   DFVVILAALLCALICVVGLIAVARCAWLRRGSAG  60



>ref|XP_008379650.1| PREDICTED: RING-H2 finger protein ATL80-like [Malus domestica]
Length=216

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAALLCAVICVVGL+ VARCAWLRR   G
Sbjct  34   DFVVILAALLCAVICVVGLLAVARCAWLRRGSEG  67



>ref|XP_009604464.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=184

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +3

Query  27   MALPRRFLsgnhsspnppsptktaateppsssatpesDFIVILAALLCAVICVVGLVMVA  206
            M LP RFL   +S   P  P  ++  EPPSS++    DF++I AALLCA+ICV+GL+ VA
Sbjct  1    MTLPPRFLLSTNSFSTPQPPVNSSVAEPPSSASVEP-DFVIITAALLCALICVIGLISVA  59

Query  207  RCAWLRRIRAGANG  248
            RCAWLRR+  GA G
Sbjct  60   RCAWLRRV-GGATG  72



>ref|XP_007156261.1| hypothetical protein PHAVU_003G271400g [Phaseolus vulgaris]
 gb|ESW28255.1| hypothetical protein PHAVU_003G271400g [Phaseolus vulgaris]
Length=199

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICVVGLV +ARCAWLRR  A   G
Sbjct  25   DFVVILAALLCALICVVGLVAIARCAWLRRPPASVGG  61



>ref|XP_004253118.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=186

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAALLC +ICV+GLV VARCAW+RRI  G
Sbjct  29   DFVVILAALLCGLICVIGLVAVARCAWIRRITGG  62



>ref|XP_004512286.1| PREDICTED: RING-H2 finger protein ATL8-like [Cicer arietinum]
Length=217

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICVVGLV VARCAWLRR     N
Sbjct  32   DFVVILAALLCALICVVGLVAVARCAWLRRDSGAGN  67



>ref|XP_003612411.1| Ring finger protein [Medicago truncatula]
 gb|AES95369.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
 gb|AFK36320.1| unknown [Medicago truncatula]
Length=215

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICVVGL+ VARCAWLRR     N
Sbjct  32   DFVVILAALLCALICVVGLIAVARCAWLRRDSGAGN  67



>ref|XP_003533404.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=203

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICVVGLV +ARCAWLRR  AG++
Sbjct  26   DFVVILAALLCALICVVGLVAIARCAWLRRGTAGSS  61



>gb|KDP36758.1| hypothetical protein JCGZ_08049 [Jatropha curcas]
Length=192

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICV+GL+ VARC WLRR+ + AN 
Sbjct  34   DFVVILAALLCALICVLGLIAVARCGWLRRLSSTANS  70



>emb|CDP01769.1| unnamed protein product [Coffea canephora]
Length=221

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICVVGL+ VARCAWLRR   G NG
Sbjct  44   DFVVILAALLCALICVVGLIAVARCAWLRRGTPG-NG  79



>ref|XP_011022135.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
Length=200

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAALLCA+ICVVGL+  ARCAWLRR+  G
Sbjct  24   DFVVILAALLCALICVVGLIAAARCAWLRRVTGG  57



>ref|XP_008242103.1| PREDICTED: RING-H2 finger protein ATL8 [Prunus mume]
Length=215

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCAVICV+GL+ VARCAWLRR  +GA G
Sbjct  33   DFVVILAALLCAVICVIGLLAVARCAWLRR-GSGAGG  68



>ref|XP_010064613.1| PREDICTED: RING-H2 finger protein ATL80, partial [Eucalyptus 
grandis]
Length=201

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ + ++G
Sbjct  29   DFVVILAALLCALICVLGLIAVARCAWLRRLSSFSSG  65



>ref|XP_003537694.1| PREDICTED: RING-H2 finger protein ATL8-like [Glycine max]
Length=226

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICVVGLV VARCAWLRR     N
Sbjct  32   DFVVILAALLCALICVVGLVAVARCAWLRRGSGAGN  67



>ref|XP_009775127.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=184

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  27   MALPRRFLsgnhsspnppsptktaateppsssatpesDFIVILAALLCAVICVVGLVMVA  206
            M LP RFL   +S   P  P K++A EPPSS++    DF++I AALLCA IC++GL+ V 
Sbjct  1    MTLPPRFLLSTNSFSTPQLPVKSSAAEPPSSASVEP-DFVIITAALLCAFICIIGLISVV  59

Query  207  RCAWLRRIRAGANG  248
            RCAWLRR+R    G
Sbjct  60   RCAWLRRVRERTGG  73



>ref|XP_004232585.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=193

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCA+ICVVGL+ VARCAWLRR
Sbjct  30   DFVVILAALLCALICVVGLIAVARCAWLRR  59



>ref|XP_006435418.1| hypothetical protein CICLE_v10004041mg [Citrus clementina]
 ref|XP_006473922.1| PREDICTED: RING-H2 finger protein ATL80-like [Citrus sinensis]
 gb|ESR48658.1| hypothetical protein CICLE_v10004041mg [Citrus clementina]
Length=198

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D++VILAALLCA+ICV+GL+ VARCAWLRR+  G
Sbjct  28   DYVVILAALLCALICVLGLIAVARCAWLRRLSGG  61



>ref|XP_007202550.1| hypothetical protein PRUPE_ppa011201mg [Prunus persica]
 gb|EMJ03749.1| hypothetical protein PRUPE_ppa011201mg [Prunus persica]
Length=220

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VILAALLCAVICV+GL+ VARCAWLRR  +GA G
Sbjct  33   DFVVILAALLCAVICVIGLLAVARCAWLRR-GSGAGG  68



>gb|KDO85202.1| hypothetical protein CISIN_1g043163mg, partial [Citrus sinensis]
Length=172

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D++VILAALLCA+ICV+GL+ VARCAWLRR+  G
Sbjct  2    DYVVILAALLCALICVLGLIAVARCAWLRRLSGG  35



>ref|XP_004287710.1| PREDICTED: RING-H2 finger protein ATL8 [Fragaria vesca subsp. 
vesca]
Length=208

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCAVICVVGL+ VARCAWLRR
Sbjct  31   DFVVILAALLCAVICVVGLLAVARCAWLRR  60



>ref|XP_007018117.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY15342.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=193

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+   +
Sbjct  33   DFVVILAALLCALICVLGLIAVARCAWLRRLSGSS  67



>ref|XP_009772726.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=198

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCA+ICVVGL+ VARCAWLRR
Sbjct  34   DFVVILAALLCALICVVGLIAVARCAWLRR  63



>gb|KJB14191.1| hypothetical protein B456_002G113500 [Gossypium raimondii]
Length=189

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+
Sbjct  30   DFVVILAALLCALICVLGLIAVARCAWLRRL  60



>gb|AFW90598.1| E3 ubiquitin ligase [Solanum tuberosum]
Length=170

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCA+ICVVGL+ VARCAWLRR
Sbjct  7    DFVVILAALLCALICVVGLIAVARCAWLRR  36



>ref|XP_002526834.1| protein with unknown function [Ricinus communis]
 gb|EEF35569.1| protein with unknown function [Ricinus communis]
Length=207

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            D +VILAALLCA+ICVVGL+ VARCAWLRR  + +N
Sbjct  28   DLVVILAALLCALICVVGLIAVARCAWLRRTGSASN  63



>ref|XP_006342531.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=192

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAALLC +ICV+GL  VARCAW+RRI  G
Sbjct  35   DFVVILAALLCGLICVIGLAAVARCAWIRRIAGG  68



>ref|XP_009601753.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=197

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCA+ICVVGL+ VARCAWLRR
Sbjct  34   DFVVILAALLCALICVVGLIAVARCAWLRR  63



>ref|XP_011074071.1| PREDICTED: RING-H2 finger protein ATL80-like [Sesamum indicum]
Length=188

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICV+GL+ VARCAW+RRI AG N
Sbjct  34   DFVVILAALLCALICVLGLIAVARCAWIRRI-AGRN  68



>ref|XP_009413072.1| PREDICTED: RING-H2 finger protein ATL80-like [Musa acuminata 
subsp. malaccensis]
Length=191

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            D +VILAALLCA+ICVVGL +VARCAWLRR   GA
Sbjct  29   DVVVILAALLCALICVVGLALVARCAWLRRASPGA  63



>ref|XP_002526830.1| protein with unknown function [Ricinus communis]
 gb|EEF35565.1| protein with unknown function [Ricinus communis]
Length=258

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            D +VILAALLCA+ICVVGL+ VARCAWLRR
Sbjct  79   DLVVILAALLCALICVVGLIAVARCAWLRR  108



>ref|XP_008812592.1| PREDICTED: RING-H2 finger protein ATL80-like [Phoenix dactylifera]
Length=188

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            D +VILAALLCA+ICVVGL +VARCAWLRR  A A 
Sbjct  28   DVVVILAALLCALICVVGLALVARCAWLRRSSASAQ  63



>ref|XP_004234505.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum lycopersicum]
Length=178

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DFIVILAALLCAVICV GL++VARC WLRR
Sbjct  34   DFIVILAALLCAVICVSGLIVVARCTWLRR  63



>ref|XP_011041176.1| PREDICTED: RING-H2 finger protein ATL8 [Populus euphratica]
Length=194

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA  236
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ +
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRLSS  64



>ref|XP_009589982.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana tomentosiformis]
Length=201

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCAVICV GL++VARC WLRR
Sbjct  42   DFVVILAALLCAVICVSGLIVVARCTWLRR  71



>ref|XP_004159747.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
Length=180

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR-IRAGAN  245
            DF+VILAALLCA+IC+VGL+ VARCAWLRR  +A AN
Sbjct  26   DFVVILAALLCALICMVGLITVARCAWLRRGNQASAN  62



>ref|XP_006343322.1| PREDICTED: RING-H2 finger protein ATL8-like [Solanum tuberosum]
Length=178

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DFIVILAALLCAVICV GL++VARC WLRR
Sbjct  34   DFIVILAALLCAVICVSGLIVVARCTWLRR  63



>ref|XP_003547882.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=201

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCA+ICVVGLV +ARCAWLRR
Sbjct  25   DFVVILAALLCALICVVGLVAIARCAWLRR  54



>ref|XP_002306993.2| hypothetical protein POPTR_0005s27660g [Populus trichocarpa]
 gb|EEE93989.2| hypothetical protein POPTR_0005s27660g [Populus trichocarpa]
Length=194

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA  236
            DF+VILAALLCA+ICV+GL+ VARCAWLRR+ +
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRLSS  64



>ref|XP_009338623.1| PREDICTED: RING-H2 finger protein ATL80-like [Pyrus x bretschneideri]
Length=215

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCAVICVVGL+ VARCAWLRR   G
Sbjct  34   DLVVILAALLCAVICVVGLLAVARCAWLRRGPGG  67



>ref|XP_009795598.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana sylvestris]
Length=182

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF VILAALLC +ICV+GLV VARC+W+RR   G
Sbjct  35   DFFVILAALLCGLICVLGLVSVARCSWIRRFSTG  68



>ref|XP_009776172.1| PREDICTED: RING-H2 finger protein ATL8-like [Nicotiana sylvestris]
Length=201

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCAVICV GL++VARC WLRR
Sbjct  42   DFVVILAALLCAVICVSGLIVVARCTWLRR  71



>ref|XP_002301903.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE81176.1| zinc finger family protein [Populus trichocarpa]
Length=200

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA  236
            DF+VILAALLCA+ICV+GL+ VARCAWLRR  +
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRFSS  64



>ref|XP_004146217.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 gb|KGN55591.1| hypothetical protein Csa_3G000150 [Cucumis sativus]
Length=181

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR-IRAGAN  245
            DF+VILAALLCA+IC+VGL+ VARCAWLRR  +A AN
Sbjct  26   DFVVILAALLCALICMVGLIAVARCAWLRRGNQASAN  62



>ref|XP_008392292.1| PREDICTED: RING-H2 finger protein ATL80-like [Malus domestica]
Length=215

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCAVICVVGL+ VARCAWLRR   G
Sbjct  34   DLVVILAALLCAVICVVGLLAVARCAWLRRGPXG  67



>ref|XP_008449155.1| PREDICTED: RING-H2 finger protein ATL80 [Cucumis melo]
Length=178

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR-IRAGAN  245
            DF+VILAALLCA+IC+VGL+ VARCAWLRR  +A AN
Sbjct  26   DFVVILAALLCALICMVGLIAVARCAWLRRGNQASAN  62



>ref|XP_004145558.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 ref|XP_004172116.1| PREDICTED: RING-H2 finger protein ATL80-like [Cucumis sativus]
 gb|KGN55526.1| hypothetical protein Csa_4G664340 [Cucumis sativus]
Length=185

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF++ILAALLCA+ICV+GLV VARCAWLR +     G
Sbjct  26   DFVIILAALLCALICVLGLVAVARCAWLRHLAGDGGG  62



>ref|XP_011034822.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
 ref|XP_011034823.1| PREDICTED: RING-H2 finger protein ATL8-like [Populus euphratica]
Length=198

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA  236
            DF+VILAALLCA+ICV+GL+ VARCAWLRR  +
Sbjct  32   DFMVILAALLCALICVLGLIAVARCAWLRRFSS  64



>ref|XP_003517122.1| PREDICTED: RING-H2 finger protein ATL8-like [Glycine max]
Length=223

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICVVGLV VARCAW R+   G +
Sbjct  32   DFVVILAALLCALICVVGLVAVARCAWFRQGSGGGS  67



>ref|XP_010094527.1| RING-H2 finger protein ATL80 [Morus notabilis]
 gb|EXB56281.1| RING-H2 finger protein ATL80 [Morus notabilis]
Length=186

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            DF+VILAALLCA+ICV+GLV +ARCAWLRR+
Sbjct  27   DFVVILAALLCALICVLGLVAIARCAWLRRL  57



>ref|XP_006366657.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum tuberosum]
Length=183

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D+++I+AALLCA+IC++GL+ VARCAWLRR   GA G
Sbjct  38   DYVIIIAALLCALICIIGLISVARCAWLRRT-GGATG  73



>ref|XP_010498523.1| PREDICTED: RING-H2 finger protein ATL80-like [Camelina sativa]
Length=198

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D IVILAALLCA+ICV+GLV V+RC WLRR+ AG
Sbjct  29   DLIVILAALLCALICVLGLVAVSRCVWLRRLAAG  62



>ref|XP_010911522.1| PREDICTED: RING-H2 finger protein ATL44-like [Elaeis guineensis]
Length=183

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            D +VILAALLCA+ICVVGL +VARCAWLRR    A 
Sbjct  28   DVVVILAALLCALICVVGLALVARCAWLRRSSPSAQ  63



>gb|EPS68943.1| hypothetical protein M569_05824 [Genlisea aurea]
Length=198

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF+VILAA+LCA+ICV+GL+ VARCAW+RR+  G
Sbjct  37   DFVVILAAMLCALICVLGLIAVARCAWIRRLGGG  70



>ref|XP_004253245.1| PREDICTED: RING-H2 finger protein ATL80-like [Solanum lycopersicum]
Length=183

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D+++I+AALLC VIC++GL+ VARCAWLRR      G
Sbjct  38   DYVIIIAALLCGVICIIGLISVARCAWLRRTGGSTGG  74



>ref|XP_008453009.1| PREDICTED: RING-H2 finger protein ATL80 [Cucumis melo]
Length=185

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF++ILAALLCA+ICV+GLV VARCAWLR +     G
Sbjct  26   DFVIILAALLCALICVLGLVAVARCAWLRHLAGDGAG  62



>ref|XP_009150790.1| PREDICTED: RING-H2 finger protein ATL44-like [Brassica rapa]
 emb|CDY66407.1| BnaA06g39270D [Brassica napus]
Length=187

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G N 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTTGENS  63



>ref|XP_002532473.1| protein with unknown function [Ricinus communis]
 gb|EEF29897.1| protein with unknown function [Ricinus communis]
Length=204

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCA+ICVVGL+ VARCAWLR 
Sbjct  28   DFVVILAALLCALICVVGLIAVARCAWLRH  57



>ref|XP_009620555.1| PREDICTED: RING-H2 finger protein ATL80-like [Nicotiana tomentosiformis]
Length=182

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            DF VILAAL+C +ICV+GLV VARCAW+RR   G
Sbjct  35   DFFVILAALVCGLICVLGLVSVARCAWIRRFATG  68



>gb|ADI71977.1| E3 ubiquitin ligase [Capsicum annuum]
Length=197

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            DF+V+LAALLCA+ICV+GLV VARC W+RRI
Sbjct  34   DFVVVLAALLCALICVLGLVAVARCNWIRRI  64



>ref|XP_010477335.1| PREDICTED: RING-H2 finger protein ATL80 [Camelina sativa]
Length=198

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCA+ICV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLAAG  62



>ref|XP_006416360.1| hypothetical protein EUTSA_v10009964mg [Eutrema salsugineum]
 gb|ESQ34713.1| hypothetical protein EUTSA_v10009964mg [Eutrema salsugineum]
Length=200

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCA+ICV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLAAG  62



>ref|NP_179337.1| RING-H2 finger protein ATL44 [Arabidopsis thaliana]
 sp|O22755.1|ATL44_ARATH RecName: Full=RING-H2 finger protein ATL44; AltName: Full=RING-H2 
zinc finger protein RHA3a [Arabidopsis thaliana]
 gb|AAK44054.1|AF370239_1 putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAC68673.1| RING-H2 finger protein RHA3a [Arabidopsis thaliana]
 gb|AAD32903.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAL33807.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEC06631.1| RING-H2 finger protein ATL44 [Arabidopsis thaliana]
Length=185

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  V RCAWLRR  AG + 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTAGGDS  63



>ref|XP_010462813.1| PREDICTED: RING-H2 finger protein ATL80-like [Camelina sativa]
Length=221

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCA+ICV+GLV V+RC WLRR+ AG
Sbjct  29   DLVVILAALLCALICVLGLVAVSRCVWLRRLAAG  62



>ref|XP_011100182.1| PREDICTED: RING-H2 finger protein ATL80-like [Sesamum indicum]
Length=185

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            DF+VILAAL+CA+ICV+GLV VARC+W+RR 
Sbjct  26   DFVVILAALICALICVLGLVAVARCSWIRRF  56



>ref|XP_009395296.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=183

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            D IVILAALLCA+ICV+GL +VARCAWLR   A A
Sbjct  30   DLIVILAALLCALICVLGLALVARCAWLRPSPAAA  64



>ref|XP_002886113.1| ring-H2 finger A3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62372.1| ring-H2 finger A3A [Arabidopsis lyrata subsp. lyrata]
Length=185

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  V RCAWLRR  AG + 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTAGGDS  63



>ref|NP_173506.1| RING-H2 finger protein ATL80 [Arabidopsis thaliana]
 sp|Q9LM69.1|ATL80_ARATH RecName: Full=RING-H2 finger protein ATL80 [Arabidopsis thaliana]
 gb|AAF80624.1|AC069251_17 F2D10.34 [Arabidopsis thaliana]
 gb|AAK76523.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30028.1| RING-H2 finger protein ATL80 [Arabidopsis thaliana]
Length=197

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCA+ICV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLAAG  62



>ref|XP_010537218.1| PREDICTED: RING-H2 finger protein ATL80-like [Tarenaya hassleriana]
Length=184

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRA  236
            D +VILAALLCA++CV+GL+ V+RCAWLRR+ A
Sbjct  23   DLVVILAALLCALVCVLGLIAVSRCAWLRRLSA  55



>ref|XP_003629097.1| Ring finger protein [Medicago truncatula]
 gb|AET03573.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=203

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIR-AGAN  245
            DF+VILAALLCA+I VVGL  +ARCAWLRR   AGA+
Sbjct  25   DFVVILAALLCALISVVGLTAIARCAWLRRTPVAGAS  61



>ref|XP_010908037.1| PREDICTED: RING-H2 finger protein ATL8-like [Elaeis guineensis]
Length=196

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            D +VILAALLCA+ICVVGL +VARCAWLRR
Sbjct  50   DVVVILAALLCALICVVGLALVARCAWLRR  79



>ref|XP_010935347.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL8-like 
[Elaeis guineensis]
Length=182

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            D +VILA LLCA+ICVVGL +VARCAW+RR  + A+
Sbjct  28   DVVVILATLLCALICVVGLALVARCAWIRRFSSTAH  63



>emb|CDY33648.1| BnaC08g19480D [Brassica napus]
Length=197

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D ++ILAALLCA+ICV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVIILAALLCALICVLGLIAVSRCVWLRRLAAG  62



>gb|KFK44194.1| hypothetical protein AALP_AA1G226700 [Arabis alpina]
Length=201

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCA+ICV+GL+ V+RC WLRR+ +G
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRLASG  62



>emb|CDY69366.1| BnaAnng30200D [Brassica napus]
Length=187

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  V RCAWLR+   G N 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRQFTTGENS  63



>ref|XP_002890411.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66670.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCA+ICV+GL+ V+RC WLRR  AG
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCVWLRRFAAG  62



>emb|CDX96619.1| BnaA08g21620D [Brassica napus]
Length=197

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D ++ILAALLCA+ICV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVIILAALLCALICVLGLIAVSRCVWLRRLAAG  62



>ref|XP_004509462.1| PREDICTED: RING-H2 finger protein ATL80-like [Cicer arietinum]
Length=205

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILAALLCA+I VVGL  +ARCAWLRR
Sbjct  28   DFVVILAALLCALISVVGLTAIARCAWLRR  57



>ref|XP_010534292.1| PREDICTED: RING-H2 finger protein ATL80-like [Tarenaya hassleriana]
Length=191

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VILAALLCA+ICV+GL+ V+RCAWLRR  A  + 
Sbjct  29   DLVVILAALLCALICVLGLIAVSRCAWLRRFTAADSS  65



>emb|CDY31495.1| BnaC05g16040D [Brassica napus]
Length=198

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            D +VILAAL+CA+ICV+GL+ V+RC WLRR+ AG 
Sbjct  29   DLVVILAALICALICVLGLIAVSRCVWLRRLAAGT  63



>ref|XP_009109289.1| PREDICTED: RING-H2 finger protein ATL45-like [Brassica rapa]
 emb|CDY24813.1| BnaA08g14970D [Brassica napus]
Length=193

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D IVIL+ALLCA+ICV GL  VARCAW+RR+ AG N 
Sbjct  26   DMIVILSALLCALICVAGLAAVARCAWIRRL-AGVNS  61



>ref|XP_009110211.1| PREDICTED: RING-H2 finger protein ATL80 [Brassica rapa]
Length=197

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D ++ILAALLCA+ICV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVIILAALLCALICVLGLIAVSRCVWLRRLAAG  62



>ref|XP_006303328.1| hypothetical protein CARUB_v10010177mg [Capsella rubella]
 gb|EOA36226.1| hypothetical protein CARUB_v10010177mg [Capsella rubella]
Length=234

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VILAALLCA+ICV+GLV V+RC WLRR  AG
Sbjct  64   DLVVILAALLCALICVLGLVAVSRCVWLRRHAAG  97



>ref|XP_009149561.1| PREDICTED: RING-H2 finger protein ATL80 [Brassica rapa]
 gb|AGW83699.1| RING zinc finger protein [Brassica rapa subsp. chinensis]
Length=202

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            D +VILAAL+CA+ICV+GL+ V+RC WLRR+ AG 
Sbjct  29   DLVVILAALICALICVLGLIAVSRCVWLRRLAAGT  63



>emb|CDY29504.1| BnaA06g14660D [Brassica napus]
Length=202

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            D +VILAAL+CA+ICV+GL+ V+RC WLRR+ AG 
Sbjct  29   DLVVILAALICALICVLGLIAVSRCVWLRRLAAGT  63



>ref|XP_010432277.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=212

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N 
Sbjct  26   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNS  61



>ref|XP_008786682.1| PREDICTED: RING-H2 finger protein ATL44 [Phoenix dactylifera]
Length=181

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            D +VILAALLCA+ICVVGL +VARCAWLRR
Sbjct  29   DVVVILAALLCALICVVGLALVARCAWLRR  58



>ref|XP_010029567.1| PREDICTED: RING-H2 finger protein ATL8-like [Eucalyptus grandis]
 gb|KCW56484.1| hypothetical protein EUGRSUZ_I02211 [Eucalyptus grandis]
Length=201

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VILA LLCA+IC VGLV VARCAWLRR
Sbjct  25   DFVVILAVLLCALICAVGLVAVARCAWLRR  54



>ref|XP_010446920.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=199

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D +VIL+ALLCA+ICV GL  VARCAWLRR+
Sbjct  27   DMVVILSALLCALICVAGLAAVARCAWLRRL  57



>ref|XP_006409305.1| hypothetical protein EUTSA_v10023141mg [Eutrema salsugineum]
 gb|ESQ50758.1| hypothetical protein EUTSA_v10023141mg [Eutrema salsugineum]
Length=185

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G + 
Sbjct  28   DMVVILSALLCALICVAGLAAVLRCAWLRRFTTGGDS  64



>ref|XP_006285317.1| hypothetical protein CARUB_v10006700mg [Capsella rubella]
 gb|EOA18215.1| hypothetical protein CARUB_v10006700mg [Capsella rubella]
Length=199

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N 
Sbjct  25   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNS  60



>emb|CDY31863.1| BnaC07g15130D [Brassica napus]
Length=167

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +++LAALLCA+IC +GL+ V+RC WLRR+ AG
Sbjct  29   DLVIVLAALLCAMICFLGLIAVSRCVWLRRLAAG  62



>ref|XP_009384604.1| PREDICTED: RING-H2 finger protein ATL44-like [Musa acuminata 
subsp. malaccensis]
Length=192

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            D +VILAALLCA+ICVVGL +VARCAW+RR
Sbjct  29   DMVVILAALLCALICVVGLALVARCAWIRR  58



>gb|ABK56013.1| zinc finger protein [Brassica rapa]
Length=196

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +V LAALLCA++CV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVVTLAALLCAMVCVLGLIAVSRCVWLRRLAAG  62



>ref|XP_009103326.1| PREDICTED: RING-H2 finger protein ATL80-like [Brassica rapa]
Length=196

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +V LAALLCA++CV+GL+ V+RC WLRR+ AG
Sbjct  29   DLVVTLAALLCAMVCVLGLIAVSRCVWLRRLAAG  62



>emb|CDY41651.1| BnaC03g62330D [Brassica napus]
Length=193

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  VARCAW+RR+ AG N 
Sbjct  26   DMVVILSALLCALICVSGLAAVARCAWIRRL-AGVNS  61



>ref|XP_010437466.1| PREDICTED: RING-H2 finger protein ATL45-like [Camelina sativa]
Length=202

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N 
Sbjct  27   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNS  62



>ref|XP_009138362.1| PREDICTED: RING-H2 finger protein ATL45-like [Brassica rapa]
 emb|CDY40631.1| BnaA03g53320D [Brassica napus]
Length=190

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  VARCAWLRR+  G N 
Sbjct  26   DMVVILSALLCALICVAGLAAVARCAWLRRL-TGVNS  61



>ref|XP_006298646.1| hypothetical protein CARUB_v10014735mg [Capsella rubella]
 gb|EOA31544.1| hypothetical protein CARUB_v10014735mg [Capsella rubella]
Length=187

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G + 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTGGGDS  63



>ref|XP_010489373.1| PREDICTED: RING-H2 finger protein ATL44-like [Camelina sativa]
Length=193

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G + 
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTGGGDS  63



>ref|XP_007135973.1| hypothetical protein PHAVU_009G007400g [Phaseolus vulgaris]
 gb|ESW07967.1| hypothetical protein PHAVU_009G007400g [Phaseolus vulgaris]
Length=185

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIR  233
            DF+VILAALLCA+ICV+GLV VARC  LRR+R
Sbjct  24   DFVVILAALLCALICVLGLVAVARCGCLRRLR  55



>ref|NP_001241583.1| uncharacterized protein LOC100794614 [Glycine max]
 gb|ACU23399.1| unknown [Glycine max]
Length=184

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICV+GLV VARC  LRR+R  ++
Sbjct  23   DFVVILAALLCALICVLGLVAVARCGCLRRLRLSSS  58



>ref|XP_002867072.1| ring-H2 finger A3B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43331.1| ring-H2 finger A3B [Arabidopsis lyrata subsp. lyrata]
Length=200

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D +VIL+ALLCA+ICV GL  VARCAWLRR+
Sbjct  25   DMVVILSALLCALICVAGLAAVARCAWLRRL  55



>ref|XP_006390200.1| hypothetical protein EUTSA_v10019183mg [Eutrema salsugineum]
 gb|ESQ27486.1| hypothetical protein EUTSA_v10019183mg [Eutrema salsugineum]
Length=190

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI----RAGANG  248
            D +VI+AALLCA+ICV+GLV V+RC WLRR+    RA AN 
Sbjct  27   DLVVIIAALLCALICVLGLVAVSRCLWLRRLVSGNRAAANS  67



>emb|CDX72540.1| BnaC07g45620D [Brassica napus]
Length=190

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++IL+ALLCA+ICV GL  VARCAWLRR+
Sbjct  26   DMVIILSALLCALICVAGLAAVARCAWLRRL  56



>ref|XP_006412098.1| hypothetical protein EUTSA_v10027339mg [Eutrema salsugineum]
 gb|ESQ53551.1| hypothetical protein EUTSA_v10027339mg [Eutrema salsugineum]
Length=197

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA++CV GL  VARCAW+RR+ AG N 
Sbjct  26   DMVVILSALLCALVCVAGLAAVARCAWIRRL-AGVNS  61



>gb|KDP43788.1| hypothetical protein JCGZ_22415 [Jatropha curcas]
Length=209

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWL  221
            DF+VILAALLCA+ICVVGL+ VARCAWL
Sbjct  28   DFVVILAALLCALICVVGLIAVARCAWL  55



>ref|XP_008804625.1| PREDICTED: RING-H2 finger protein ATL8 [Phoenix dactylifera]
Length=177

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            D +VILA LLCA+ICVVGL +VARCAWLRR
Sbjct  28   DVVVILATLLCALICVVGLALVARCAWLRR  57



>ref|XP_009104676.1| PREDICTED: RING-H2 finger protein ATL8-like [Brassica rapa]
Length=185

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            + IVI+AALLCA+ICV+GLV V+RC WLRRI A 
Sbjct  27   NLIVIIAALLCALICVLGLVAVSRCTWLRRIAAP  60



>emb|CDX68098.1| BnaA07g21380D [Brassica napus]
Length=185

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            + IVI+AALLCA+ICV+GLV V+RC WLRRI A 
Sbjct  27   NLIVIIAALLCALICVLGLVAVSRCTWLRRIAAP  60



>ref|NP_195273.1| putative RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 sp|Q9ZT49.1|ATL45_ARATH RecName: Full=RING-H2 finger protein ATL45; AltName: Full=RING-H2 
zinc finger protein RHA3b [Arabidopsis thaliana]
 gb|AAC68674.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 emb|CAB54876.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 emb|CAB80264.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 gb|AAM64643.1| RING-H2 finger protein RHA3b [Arabidopsis thaliana]
 gb|AAY57612.1| RING finger family protein [Arabidopsis thaliana]
 gb|ABR46213.1| At4g35480 [Arabidopsis thaliana]
 gb|AEE86520.1| putative RING-H2 finger protein RHA3b [Arabidopsis thaliana]
Length=200

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D +VIL+ALLCA++CV GL  VARCAWLRR+
Sbjct  25   DMVVILSALLCALVCVAGLAAVARCAWLRRL  55



>emb|CDX85948.1| BnaC06g21860D [Brassica napus]
Length=185

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            + IVI+AALLCA+ICV+GLV V+RC WLRRI A 
Sbjct  27   NLIVIIAALLCALICVLGLVAVSRCTWLRRIAAP  60



>emb|CDY01352.1| BnaA07g11250D [Brassica napus]
Length=196

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +V LAALLCA++C+ GL+ V+RC WLRR+ AG
Sbjct  29   DLVVTLAALLCAMVCIFGLIAVSRCVWLRRLAAG  62



>ref|XP_010515011.1| PREDICTED: RING-H2 finger protein ATL44 [Camelina sativa]
Length=194

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G
Sbjct  27   DMVVILSALLCALICVAGLAAVVRCAWLRRFTGG  60



>gb|KFK42061.1| hypothetical protein AALP_AA2G206300 [Arabis alpina]
Length=175

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI--RAGANG  248
            + +VI+AALLCA IC +GLV+V+RCAWLRR+  R  AN 
Sbjct  27   ELVVIIAALLCAAICFLGLVVVSRCAWLRRLANRTAANS  65



>ref|XP_010467517.1| PREDICTED: RING-H2 finger protein ATL44-like [Camelina sativa]
Length=190

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAG  239
            D +VIL+ALLCA+ICV GL  V RCAWLRR   G
Sbjct  27   DMVVILSALLCALICVAGLAAVLRCAWLRRFTGG  60



>emb|CDY49431.1| BnaC07g06500D [Brassica napus]
Length=188

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            D +VIL+ALLCA+ICV GL  V RCA LRR  AG N
Sbjct  28   DMVVILSALLCALICVAGLAAVVRCACLRRFTAGGN  63



>emb|CDY45988.1| BnaA02g18080D [Brassica napus]
Length=186

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI--RAGANG  248
            D +V++AALLCA+ICV+GL+ V+RC WLRR+  R+ AN 
Sbjct  27   DLVVVIAALLCALICVLGLLAVSRCVWLRRLANRSAANS  65



>ref|XP_008779008.1| PREDICTED: RING-H2 finger protein ATL8-like [Phoenix dactylifera]
Length=199

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            D +V+LAALLCA++CV+GL +VARCAWLRR     +
Sbjct  29   DVVVVLAALLCALVCVLGLALVARCAWLRRPSGDPS  64



>ref|XP_003603861.1| RING-H2 finger protein ATL1B [Medicago truncatula]
 gb|AES74112.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=193

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGAN  245
            DF+VILAALLCA+ICV+GLV V RC  LRR+R  + 
Sbjct  28   DFVVILAALLCALICVLGLVAVTRCGCLRRLRLSST  63



>ref|XP_009420835.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            D +V+LAALLCA+ICV+GL +VARCAW+RR
Sbjct  28   DVVVVLAALLCALICVIGLAIVARCAWIRR  57



>ref|XP_002887637.1| hypothetical protein ARALYDRAFT_316562 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63896.1| hypothetical protein ARALYDRAFT_316562 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++ILA LLCA+ C++GL+ V+RCAWLRRI
Sbjct  27   DLVLILAVLLCALTCIIGLIAVSRCAWLRRI  57



>ref|XP_010548197.1| PREDICTED: RING-H2 finger protein ATL44-like [Tarenaya hassleriana]
Length=180

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGA  242
            D +VIL+ALLCA+ICVVGLV VARC+W+ R    +
Sbjct  25   DMVVILSALLCALICVVGLVAVARCSWIHRFTGDS  59



>ref|XP_004983797.1| PREDICTED: RING-H2 finger protein ATL45-like [Setaria italica]
Length=267

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIR-AGANG  248
            D +VILAALLCA+ICVVGL  VARCA  RR R AGA+G
Sbjct  44   DVVVILAALLCALICVVGLAAVARCARSRRNRGAGADG  81



>ref|NP_177767.1| RING-H2 finger protein ATL8 [Arabidopsis thaliana]
 sp|Q8LC69.2|ATL8_ARATH RecName: Full=RING-H2 finger protein ATL8 [Arabidopsis thaliana]
 gb|AAF16660.1|AC012394_9 putative RING zinc finger protein; 36546-35989 [Arabidopsis thaliana]
 gb|AAG51946.1|AC015450_7 putative RING zinc finger protein; 5217-5774 [Arabidopsis thaliana]
 dbj|BAC43477.1| putative RING finger protein [Arabidopsis thaliana]
 gb|AAO63979.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEE35838.1| RING-H2 finger protein ATL8 [Arabidopsis thaliana]
Length=185

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++ILA LLCA+ C++GL+ V+RCAWLRRI
Sbjct  27   DLVLILAVLLCALTCIIGLIAVSRCAWLRRI  57



>gb|AAM63811.1| putative RING zinc finger protein [Arabidopsis thaliana]
Length=186

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++ILA LLCA+ C++GL+ V+RCAWLRRI
Sbjct  27   DLVLILAVLLCALTCIIGLIAVSRCAWLRRI  57



>ref|XP_006302871.1| hypothetical protein CARUB_v10021002mg [Capsella rubella]
 gb|EOA35769.1| hypothetical protein CARUB_v10021002mg [Capsella rubella]
Length=186

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++ILA LLCA+ CV+GL+ V+RCAWLRRI
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRI  57



>ref|XP_010530985.1| PREDICTED: RING-H2 finger protein ATL44-like [Tarenaya hassleriana]
Length=182

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D +VIL+ALLCA+ICV GLV VARC W+RR 
Sbjct  26   DMVVILSALLCALICVAGLVAVARCVWIRRF  56



>emb|CDY24337.1| BnaA07g02620D [Brassica napus]
Length=188

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  + RC+ LRR  AG N 
Sbjct  28   DMVVILSALLCALICVAGLAAIVRCSCLRRFTAGGNS  64



>ref|XP_010416561.1| PREDICTED: RING-H2 finger protein ATL8 [Camelina sativa]
Length=186

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++ILA LLCA+ CV+GL+ V+RCAWLRRI
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRI  57



>ref|XP_003527275.1| PREDICTED: RING-H2 finger protein ATL80-like [Glycine max]
Length=184

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            DF+VI AALLCA+IC++GLV V RC  LRR+R  ++ 
Sbjct  23   DFVVIFAALLCALICILGLVAVTRCGCLRRLRLSSSN  59



>ref|XP_010471794.1| PREDICTED: RING-H2 finger protein ATL8-like [Camelina sativa]
Length=186

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++ILA LLCA+ CV+GL+ V+RCAWLRRI
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRI  57



>ref|XP_009121114.1| PREDICTED: RING-H2 finger protein ATL44 [Brassica rapa]
Length=226

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRIRAGANG  248
            D +VIL+ALLCA+ICV GL  + RC+ LRR  AG N 
Sbjct  66   DMVVILSALLCALICVAGLAAIVRCSCLRRFTAGGNS  102



>emb|CDX75506.1| BnaA01g01960D [Brassica napus]
Length=193

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D IVILAALLCA+ICV GL  VARCA LRR+
Sbjct  26   DMIVILAALLCALICVAGLAAVARCACLRRL  56



>ref|XP_009128176.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL8-like 
[Brassica rapa]
Length=209

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D +V++AALLCA+ICV+GL+ V+RC WLRR+
Sbjct  27   DLVVVIAALLCALICVLGLLAVSRCVWLRRL  57



>gb|KHN20089.1| RING-H2 finger protein ATL80, partial [Glycine soja]
Length=133

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            DF+VI AALLCA+IC++GLV VARC  LRR
Sbjct  13   DFVVIFAALLCALICILGLVAVARCGCLRR  42



>ref|XP_010428701.1| PREDICTED: RING-H2 finger protein ATL8-like [Camelina sativa]
Length=186

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D ++ILA LLCA+ CV+GL+ V+RCAWLRR+
Sbjct  27   DLVLILAVLLCALTCVLGLIAVSRCAWLRRM  57



>ref|XP_009383554.1| PREDICTED: RING-H2 finger protein ATL45-like [Musa acuminata 
subsp. malaccensis]
Length=174

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRR  227
            D +VILAALLC +I VVGL +VARCAW RR
Sbjct  25   DIVVILAALLCGLISVVGLALVARCAWHRR  54



>ref|XP_009106302.1| PREDICTED: RING-H2 finger protein ATL8 [Brassica rapa]
Length=192

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWL  221
            D IVI+AALLCA+ICV+GLV V+RC+WL
Sbjct  27   DLIVIIAALLCALICVLGLVAVSRCSWL  54



>emb|CDX87603.1| BnaA07g32700D [Brassica napus]
Length=192

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWL  221
            D IVI+AALLCA+ICV+GLV V+RC+WL
Sbjct  27   DLIVIIAALLCALICVLGLVAVSRCSWL  54



>emb|CDX88272.1| BnaC06g37160D [Brassica napus]
Length=191

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWL  221
            D IVI+AALLCA+ICV+GLV V+RC+WL
Sbjct  27   DLIVIIAALLCALICVLGLVAVSRCSWL  54



>emb|CDX69143.1| BnaC01g03100D [Brassica napus]
Length=194

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D +VIL+ALLCA+ICV GL  VARCA LRR+
Sbjct  26   DMVVILSALLCALICVAGLAAVARCACLRRL  56



>ref|XP_009101519.1| PREDICTED: RING-H2 finger protein ATL45 [Brassica rapa]
Length=237

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  138  DFIVILAALLCAVICVVGLVMVARCAWLRRI  230
            D IVIL+ALLCA+ICV GL  VARCA LRR+
Sbjct  70   DMIVILSALLCALICVAGLAAVARCACLRRL  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557676237175