BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF017J02

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99148.1|  unnamed protein product                                124   1e-31   Coffea canephora [robusta coffee]
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          121   1e-30   Sesamum indicum [beniseed]
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          120   2e-30   Vitis vinifera
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          115   5e-28   Sesamum indicum [beniseed]
gb|ADJ68049.1|  auxin responsive protein                                112   4e-27   Catharanthus roseus [chatas]
emb|CBI26357.3|  unnamed protein product                                109   5e-26   Vitis vinifera
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   109   7e-26   
gb|KJB38278.1|  hypothetical protein B456_006G246000                    107   6e-25   Gossypium raimondii
gb|KJB38279.1|  hypothetical protein B456_006G246000                    105   1e-24   Gossypium raimondii
gb|AEE25653.1|  auxin-responsive protein                                105   1e-24   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    105   1e-24   Gossypium raimondii
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    104   4e-24   Gossypium arboreum [tree cotton]
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          101   7e-23   Nicotiana tomentosiformis
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         100   2e-22   Jatropha curcas
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          100   2e-22   Prunus mume [ume]
ref|NP_001240213.1|  auxin-induced protein ali50                      99.8    2e-22   Glycine max [soybeans]
gb|KHN05057.1|  Auxin-responsive protein IAA14                        99.4    4e-22   Glycine soja [wild soybean]
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     100   4e-22   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...  98.2    8e-22   Cicer arietinum [garbanzo]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...  98.2    9e-22   
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2      97.4    9e-22   
gb|KHN30563.1|  Auxin-responsive protein IAA14                        97.8    1e-21   Glycine soja [wild soybean]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like   97.4    1e-21   Eucalyptus grandis [rose gum]
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like    97.1    1e-21   Nicotiana tomentosiformis
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like   97.1    2e-21   Nicotiana sylvestris
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg           96.3    4e-21   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                  96.3    4e-21   Gossypium arboreum [tree cotton]
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like   95.5    7e-21   Nicotiana sylvestris
gb|AFK42031.1|  unknown                                               94.7    1e-20   Medicago truncatula
ref|NP_001280875.1|  auxin-responsive protein IAA14-like              95.1    1e-20   Malus domestica [apple tree]
gb|KJB28413.1|  hypothetical protein B456_005G046500                  95.1    1e-20   Gossypium raimondii
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...  95.1    1e-20   Populus euphratica
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...  95.1    1e-20   Populus euphratica
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like   94.4    2e-20   
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein               93.6    2e-20   Medicago truncatula
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg              94.4    2e-20   Erythranthe guttata [common monkey flower]
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein               94.0    3e-20   Medicago truncatula
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein           94.0    3e-20   Medicago truncatula
emb|CDY63910.1|  BnaC01g43640D                                        94.0    3e-20   Brassica napus [oilseed rape]
ref|XP_008341049.1|  PREDICTED: auxin-responsive protein IAA7-like    92.0    4e-20   
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                  93.2    5e-20   Arabis alpina [alpine rockcress]
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like    92.4    1e-19   Malus prunifolia
gb|AFK37379.1|  unknown                                               92.0    1e-19   Medicago truncatula
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...  92.4    1e-19   Populus euphratica
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...  92.0    1e-19   Populus euphratica
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like   91.7    2e-19   
ref|NP_974355.1|  auxin-responsive protein IAA7                       90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188945.1|  auxin-responsive protein IAA7                       91.3    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100             91.3    3e-19   Arabis alpina [alpine rockcress]
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)         91.3    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024           90.9    4e-19   Arabidopsis lyrata subsp. lyrata
ref|NP_001288823.1|  auxin-responsive protein IAA7                    90.9    4e-19   Brassica rapa
gb|ADL70639.1|  indole-3-acetic acid inducible 14                     89.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like   90.5    4e-19   Cucumis melo [Oriental melon]
gb|AFZ78617.1|  hypothetical protein                                  90.9    4e-19   Populus tomentosa [Chinese white poplar]
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7         90.5    5e-19   Camelina sativa [gold-of-pleasure]
gb|ADL70642.1|  indole-3-acetic acid inducible 14                     89.4    5e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56942.1|  AT4G14550                                            89.7    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70640.1|  indole-3-acetic acid inducible 14                     89.4    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg           90.9    6e-19   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative         90.5    7e-19   Ricinus communis
ref|XP_002311658.1|  aux/IAA family protein                           90.1    7e-19   Populus trichocarpa [western balsam poplar]
ref|NP_001266070.1|  IAA14                                            90.1    7e-19   Solanum lycopersicum
gb|ADB93627.2|  indole-3-acetic acid inducible 14                     89.4    7e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93628.1|  indole-3-acetic acid inducible 14                     89.0    8e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93625.2|  indole-3-acetic acid inducible 14                     89.0    9e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93629.2|  indole-3-acetic acid inducible 14                     89.0    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g           89.7    9e-19   Phaseolus vulgaris [French bean]
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like    89.7    9e-19   Camelina sativa [gold-of-pleasure]
gb|ADL70641.1|  indole-3-acetic acid inducible 14                     88.6    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...  89.0    1e-18   
emb|CAB46059.1|  IAA7 like protein                                    89.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16             89.4    2e-18   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...  89.0    2e-18   Cucumis sativus [cucumbers]
ref|NP_193191.2|  auxin-responsive protein IAA14                      89.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAC84710.1|  aux/IAA protein                                      89.0    2e-18   Populus tremula x Populus tremuloides
ref|XP_002315736.1|  aux/IAA family protein                           88.6    3e-18   Populus trichocarpa [western balsam poplar]
gb|AFK44393.1|  unknown                                               88.2    3e-18   Lotus japonicus
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like   88.2    4e-18   
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like    87.8    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  88.2    5e-18   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like   87.4    6e-18   Solanum tuberosum [potatoes]
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg           87.8    6e-18   
gb|AFZ78616.1|  hypothetical protein                                  87.0    7e-18   Populus tomentosa [Chinese white poplar]
emb|CDY10349.1|  BnaC05g29300D                                        87.4    8e-18   Brassica napus [oilseed rape]
ref|NP_001268036.1|  uncharacterized protein LOC100250231             87.0    9e-18   Vitis vinifera
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like    87.0    9e-18   Brassica rapa
gb|KJB82526.1|  hypothetical protein B456_013G200700                  86.3    1e-17   Gossypium raimondii
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like   87.0    1e-17   Cucumis melo [Oriental melon]
gb|AAM21317.1|AF373100_1  auxin-regulated protein                     87.0    1e-17   Populus tremula x Populus tremuloides
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like   86.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like   86.3    1e-17   Tarenaya hassleriana [spider flower]
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg              86.3    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like   86.3    2e-17   Vitis vinifera
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14        85.9    2e-17   Camelina sativa [gold-of-pleasure]
emb|CAN72026.1|  hypothetical protein VITISV_014421                   86.3    2e-17   Vitis vinifera
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like   85.9    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg           85.5    3e-17   Eutrema salsugineum [saltwater cress]
gb|KJB82525.1|  hypothetical protein B456_013G200700                  85.5    3e-17   Gossypium raimondii
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg              85.9    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like   85.5    4e-17   Populus euphratica
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g           85.5    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451           85.1    5e-17   
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg           84.3    7e-17   Capsella rubella
gb|AEE25654.1|  auxin-responsive protein                              84.3    9e-17   Gossypium hirsutum [American cotton]
gb|AFS44507.1|  auxin repressor                                       84.0    1e-16   Fragaria x ananassa
gb|KJB44872.1|  hypothetical protein B456_007G276900                  83.6    1e-16   Gossypium raimondii
gb|KJB44873.1|  hypothetical protein B456_007G276900                  83.6    2e-16   Gossypium raimondii
ref|XP_010102292.1|  Auxin-responsive protein IAA16                   83.6    2e-16   Morus notabilis
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                  83.2    2e-16   Gossypium arboreum [tree cotton]
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g           83.2    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14        82.8    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like   82.8    3e-16   Populus euphratica
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like   82.4    4e-16   Fragaria vesca subsp. vesca
ref|XP_010087762.1|  Auxin-responsive protein IAA7                    82.4    5e-16   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like   82.0    7e-16   Nelumbo nucifera [Indian lotus]
gb|ABH01143.1|  auxin-regulated protein                               80.5    2e-15   Populus tomentosa [Chinese white poplar]
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg           80.5    2e-15   Capsella rubella
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like   80.5    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg           79.7    4e-15   Capsella rubella
emb|CDY47148.1|  BnaA08g05350D                                        79.7    4e-15   Brassica napus [oilseed rape]
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14        79.7    4e-15   Brassica rapa
gb|ABR08763.1|  auxin-resistance protein 3                            78.2    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70687.1|  indole-3-acetic acid inducible 17                     77.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401           79.3    4e-15   
gb|ADL70689.1|  indole-3-acetic acid inducible 17                     77.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ABR08758.1|  auxin-resistance protein 3                            77.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93635.1|  indole-3-acetic acid inducible 17                     78.2    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70685.1|  indole-3-acetic acid inducible 17                     78.2    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70684.1|  indole-3-acetic acid inducible 17                     77.8    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KJB11146.1|  hypothetical protein B456_001G242900                  79.3    6e-15   Gossypium raimondii
emb|CAH59413.1|  auxin resistance protein                             79.0    6e-15   Plantago major [cart-track plant]
emb|CDY62130.1|  BnaC08g47390D                                        79.0    6e-15   Brassica napus [oilseed rape]
ref|NP_001266049.1|  IAA9 protein                                     79.0    7e-15   Solanum lycopersicum
gb|KDP23667.1|  hypothetical protein JCGZ_23500                       79.0    7e-15   Jatropha curcas
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member          79.0    7e-15   Ipomoea nil [qian niu]
gb|AEE25650.1|  auxin-responsive protein                              79.0    7e-15   Gossypium hirsutum [American cotton]
gb|KJB11145.1|  hypothetical protein B456_001G242900                  79.0    8e-15   Gossypium raimondii
emb|CDY15493.1|  BnaA08g27770D                                        78.6    8e-15   Brassica napus [oilseed rape]
gb|KJB11141.1|  hypothetical protein B456_001G242900                  79.0    8e-15   Gossypium raimondii
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                 78.2    8e-15   Citrus sinensis [apfelsine]
emb|CAN63268.1|  hypothetical protein VITISV_013635                   78.6    8e-15   Vitis vinifera
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like   78.6    9e-15   Elaeis guineensis
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg           78.6    9e-15   Citrus clementina [clementine]
gb|KJB11142.1|  hypothetical protein B456_001G242900                  78.2    1e-14   Gossypium raimondii
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like      78.2    1e-14   Sesamum indicum [beniseed]
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17        78.2    1e-14   Brassica rapa
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2      78.2    1e-14   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                     77.8    2e-14   Solanum tuberosum [potatoes]
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1      78.2    2e-14   
emb|CDY32537.1|  BnaA09g50590D                                        77.8    2e-14   Brassica napus [oilseed rape]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like   77.8    2e-14   Brassica rapa
gb|EPS64756.1|  hypothetical protein M569_10024                       77.4    2e-14   Genlisea aurea
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14        77.4    2e-14   Tarenaya hassleriana [spider flower]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1          77.4    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171921.1|  auxin-responsive protein IAA17                      77.0    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like   77.0    3e-14   Brassica rapa
emb|CDX89832.1|  BnaA10g02500D                                        77.0    3e-14   
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17        77.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like   77.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16        77.0    3e-14   Nicotiana tomentosiformis
gb|KDP21369.1|  hypothetical protein JCGZ_21840                       76.3    5e-14   Jatropha curcas
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like   76.3    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like      75.9    8e-14   Populus euphratica
ref|NP_001288939.1|  auxin-responsive protein IAA16                   75.9    8e-14   Brassica rapa
emb|CDY18214.1|  BnaC05g02370D                                        75.5    9e-14   Brassica napus [oilseed rape]
emb|CDY50750.1|  BnaAnng10570D                                        75.9    1e-13   Brassica napus [oilseed rape]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16             75.5    1e-13   
emb|CDY41894.1|  BnaC05g47100D                                        75.5    1e-13   Brassica napus [oilseed rape]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g           75.5    1e-13   Phaseolus vulgaris [French bean]
emb|CDY10068.1|  BnaC08g43830D                                        75.1    1e-13   Brassica napus [oilseed rape]
ref|XP_002302075.1|  auxin-induced protein aux28                      75.1    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative            75.1    2e-13   Ricinus communis
emb|CDY63072.1|  BnaCnng41350D                                        76.6    2e-13   Brassica napus [oilseed rape]
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like   74.7    2e-13   Brassica rapa
emb|CDY30017.1|  BnaC01g39910D                                        74.7    2e-13   Brassica napus [oilseed rape]
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760        74.7    2e-13   Amborella trichopoda
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                    74.7    2e-13   Nicotiana tabacum [American tobacco]
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  74.3    2e-13   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16        74.7    2e-13   Prunus mume [ume]
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16        74.3    2e-13   Nicotiana sylvestris
ref|NP_187124.1|  auxin-responsive protein IAA16                      74.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg           74.3    3e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg           73.9    3e-13   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...  73.9    4e-13   Elaeis guineensis
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg           73.9    4e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like   73.9    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16        73.9    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...  73.9    4e-13   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                 73.6    4e-13   Citrus sinensis [apfelsine]
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like   73.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16        73.9    5e-13   Pyrus x bretschneideri [bai li]
emb|CAC84711.1|  aux/IAA protein                                      73.6    5e-13   Populus tremula x Populus tremuloides
ref|NP_001280973.1|  auxin-responsive protein IAA16                   73.6    5e-13   Malus domestica [apple tree]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                  73.6    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g           73.2    6e-13   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like      72.8    8e-13   Populus euphratica
ref|XP_006383686.1|  auxin-induced protein aux28                      72.8    8e-13   Populus trichocarpa [western balsam poplar]
gb|KDO48908.1|  hypothetical protein CISIN_1g026005mg                 72.0    1e-12   Citrus sinensis [apfelsine]
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg           73.2    1e-12   
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...  72.4    1e-12   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                  72.4    1e-12   Arabis alpina [alpine rockcress]
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg           72.0    1e-12   
gb|EPS60474.1|  hypothetical protein M569_14329                       72.0    1e-12   Genlisea aurea
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg           72.4    1e-12   Citrus clementina [clementine]
ref|XP_010923479.1|  PREDICTED: auxin-responsive protein IAA30-li...  72.0    2e-12   Elaeis guineensis
gb|KGN60808.1|  hypothetical protein Csa_2G010920                     72.0    2e-12   Cucumis sativus [cucumbers]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like   72.0    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...  72.0    2e-12   Elaeis guineensis
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg           71.6    2e-12   Citrus clementina [clementine]
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg           71.6    2e-12   Citrus clementina [clementine]
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like   71.6    2e-12   Phoenix dactylifera
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                 71.6    2e-12   Citrus sinensis [apfelsine]
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg           71.6    2e-12   
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                 71.2    3e-12   Citrus sinensis [apfelsine]
dbj|BAJ34138.1|  unnamed protein product                              71.2    3e-12   Eutrema halophilum
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                 71.2    3e-12   Citrus sinensis [apfelsine]
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                 70.9    4e-12   Citrus sinensis [apfelsine]
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...  70.9    4e-12   Cucumis melo [Oriental melon]
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...  70.9    4e-12   Cucumis melo [Oriental melon]
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like   70.9    5e-12   
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  70.5    6e-12   Tarenaya hassleriana [spider flower]
gb|ABD98055.1|  auxin-regulated protein                               70.1    8e-12   Striga asiatica [witchweed]
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like   69.7    9e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like   69.7    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006575865.1|  PREDICTED: auxin-induced protein AUX28-like      68.9    1e-11   
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                  68.6    2e-11   Arabis alpina [alpine rockcress]
gb|KHG04941.1|  Auxin-induced AUX28                                   68.9    2e-11   Gossypium arboreum [tree cotton]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg           68.6    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like   68.6    3e-11   Phoenix dactylifera
gb|ACU18407.1|  unknown                                               68.6    3e-11   Glycine max [soybeans]
gb|KHN18836.1|  Auxin-induced protein AUX28                           68.2    3e-11   Glycine soja [wild soybean]
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like   67.8    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB42200.1|  hypothetical protein B456_007G141900                  67.4    7e-11   Gossypium raimondii
ref|NP_001239753.1|  uncharacterized protein LOC100781847             67.0    8e-11   Glycine max [soybeans]
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like   67.0    8e-11   Sesamum indicum [beniseed]
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like   67.0    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16        67.0    1e-10   Fragaria vesca subsp. vesca
ref|NP_001237212.1|  uncharacterized protein LOC100499872             66.2    2e-10   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...  66.2    2e-10   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like   65.5    3e-10   Tarenaya hassleriana [spider flower]
gb|AFK36086.1|  unknown                                               65.1    5e-10   Lotus japonicus
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17        65.1    5e-10   Tarenaya hassleriana [spider flower]
ref|NP_001241599.1|  uncharacterized protein LOC100803065             65.1    6e-10   Glycine max [soybeans]
gb|KHN22078.1|  Auxin-responsive protein IAA16                        64.7    6e-10   Glycine soja [wild soybean]
dbj|BAI94494.1|  Aux/IAA protein                                      64.7    7e-10   Dianthus caryophyllus [carnation]
gb|AFK36684.1|  unknown                                               63.5    9e-10   Lotus japonicus
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like      64.3    9e-10   Cicer arietinum [garbanzo]
ref|NP_001275031.1|  auxin-responsive protein IAA14-like              63.2    2e-09   Solanum tuberosum [potatoes]
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like      63.5    2e-09   Fragaria vesca subsp. vesca
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like   63.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011081682.1|  PREDICTED: auxin-responsive protein IAA14        62.8    2e-09   Sesamum indicum [beniseed]
ref|XP_002299625.1|  auxin-induced protein IAA4                       63.2    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g           63.2    3e-09   Phaseolus vulgaris [French bean]
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg              62.8    3e-09   Erythranthe guttata [common monkey flower]
gb|AFZ78621.1|  hypothetical protein                                  62.4    3e-09   Populus tomentosa [Chinese white poplar]
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...  62.0    4e-09   Theobroma cacao [chocolate]
ref|NP_001266039.1|  IAA7 protein                                     62.4    4e-09   Solanum lycopersicum
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like   61.6    7e-09   Cucumis sativus [cucumbers]
ref|XP_008462707.1|  PREDICTED: auxin-induced protein AUX28-like ...  61.2    9e-09   Cucumis melo [Oriental melon]
ref|XP_011045352.1|  PREDICTED: auxin-responsive protein IAA1         60.8    1e-08   Populus euphratica
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...  61.2    1e-08   Cucumis melo [Oriental melon]
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1         60.8    1e-08   Nelumbo nucifera [Indian lotus]
gb|ACJ83896.1|  unknown                                               61.2    1e-08   Medicago truncatula
gb|ACL81167.1|  auxin-responsive protein IAA1                         61.2    1e-08   Mirabilis jalapa
ref|XP_003562220.2|  PREDICTED: auxin-responsive protein IAA30-like   60.5    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g           60.8    2e-08   Phaseolus vulgaris [French bean]
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like    60.1    2e-08   Nelumbo nucifera [Indian lotus]
gb|AGV54230.1|  auxin-induced protein AUX28                           60.5    2e-08   Phaseolus vulgaris [French bean]
ref|NP_001050713.2|  Os03g0633500                                     60.5    2e-08   
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...  60.5    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like      60.5    2e-08   Glycine max [soybeans]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like   60.8    2e-08   Eucalyptus grandis [rose gum]
ref|XP_004172702.1|  PREDICTED: auxin-induced protein AUX28-like      59.7    2e-08   
gb|AGV54609.1|  auxin-induced protein                                 60.5    3e-08   Phaseolus vulgaris [French bean]
ref|NP_001267662.1|  auxin-induced protein AUX28-like                 59.7    3e-08   Cucumis sativus [cucumbers]
gb|AFK44192.1|  unknown                                               60.1    3e-08   Medicago truncatula
ref|XP_008809254.1|  PREDICTED: auxin-responsive protein IAA1-like    59.3    3e-08   Phoenix dactylifera
ref|NP_001236693.1|  auxin-induced protein AUX28                      60.1    3e-08   
gb|AFK43673.1|  unknown                                               60.1    4e-08   
gb|KHN02537.1|  Auxin-induced protein AUX28                           59.7    4e-08   
gb|ACU21378.1|  unknown                                               59.7    4e-08   
gb|AAC49055.1|  IAA14                                                 58.9    4e-08   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative          58.5    5e-08   
ref|XP_010925112.1|  PREDICTED: auxin-responsive protein IAA1-like    58.5    6e-08   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like   59.3    6e-08   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like      58.9    7e-08   
dbj|BAJ97201.1|  predicted protein                                    58.2    1e-07   
gb|AAC36584.1|  putative IAA-related protein                          57.0    1e-07   
ref|XP_011072281.1|  PREDICTED: auxin-responsive protein IAA1-like    57.4    2e-07   
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative          57.4    2e-07   
gb|KJB56687.1|  hypothetical protein B456_009G132200                  56.6    2e-07   
dbj|BAK05607.1|  predicted protein                                    57.4    2e-07   
gb|EYU24679.1|  hypothetical protein MIMGU_mgv1a023210mg              56.2    2e-07   
emb|CAE00638.1|  IAA1 protein                                         57.4    3e-07   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like      57.4    3e-07   
gb|ABY65168.1|  At1g04250-like protein                                55.1    4e-07   
ref|NP_001266055.1|  IAA10 protein                                    56.6    4e-07   
emb|CAD30274.1|  IAA16 protein                                        56.6    4e-07   
gb|KJB56686.1|  hypothetical protein B456_009G132200                  56.6    4e-07   
ref|XP_006427106.1|  hypothetical protein CICLE_v10026522mg           56.2    5e-07   
ref|XP_004981819.1|  PREDICTED: auxin-responsive protein IAA13-li...  56.6    6e-07   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein               56.2    7e-07   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like      56.6    7e-07   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...  56.2    7e-07   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein               56.2    8e-07   
gb|ABY65124.1|  At1g04250                                             53.9    9e-07   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like      56.6    9e-07   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like      55.8    1e-06   
ref|NP_001290520.1|  auxin-responsive protein IAA1                    55.5    1e-06   
emb|CBI35213.3|  unnamed protein product                              54.7    1e-06   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like   55.8    1e-06   
gb|EAZ27868.1|  hypothetical protein OsJ_11821                        55.1    2e-06   
emb|CDP06818.1|  unnamed protein product                              54.7    3e-06   
gb|KDO58189.1|  hypothetical protein CISIN_1g044582mg                 53.9    3e-06   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like   54.3    4e-06   
emb|CBI28126.3|  unnamed protein product                              53.9    4e-06   
gb|KDP37176.1|  hypothetical protein JCGZ_06232                       53.9    4e-06   
gb|AFK42876.1|  unknown                                               54.3    4e-06   
gb|ACF87179.1|  unknown                                               54.7    4e-06   
gb|ACJ84642.1|  unknown                                               54.3    4e-06   
ref|XP_009385622.1|  PREDICTED: auxin-responsive protein IAA1         53.9    4e-06   
ref|XP_002284861.1|  PREDICTED: auxin-responsive protein IAA1-like    53.9    4e-06   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like      54.3    4e-06   
ref|XP_006650321.1|  PREDICTED: auxin-responsive protein IAA11-like   53.9    4e-06   
dbj|BAJ84870.1|  predicted protein                                    53.9    5e-06   
dbj|BAK01326.1|  predicted protein                                    53.9    5e-06   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like   53.9    5e-06   
gb|ACU19136.1|  unknown                                               53.9    5e-06   
ref|XP_007013279.1|  Indoleacetic acid-induced protein 16, putative   53.5    6e-06   
ref|XP_006465436.1|  PREDICTED: auxin-responsive protein IAA17-like   52.8    7e-06   
gb|EMS64858.1|  Auxin-responsive protein IAA30                        53.9    8e-06   
gb|KHN31465.1|  Auxin-responsive protein IAA16                        53.5    8e-06   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like   52.8    8e-06   
gb|AAM96891.1|  auxin-responsive protein IAA1                         52.4    9e-06   
gb|EMT20161.1|  Auxin-responsive protein IAA30                        53.9    9e-06   
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like   52.8    1e-05   
gb|EPS59988.1|  auxin-regulated protein                               53.5    1e-05   
ref|NP_001266034.1|  IAA6 protein                                     53.1    1e-05   
ref|NP_001266077.1|  IAA15                                            52.8    2e-05   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like   52.8    2e-05   
gb|AEA86335.1|  auxin-responsive protein IAA                          50.1    2e-05   
ref|XP_009611025.1|  PREDICTED: auxin-responsive protein IAA17-like   51.2    3e-05   
ref|XP_004146959.1|  PREDICTED: auxin-induced protein 22D-like        50.8    4e-05   
ref|NP_001067209.1|  Os12g0601300                                     51.6    5e-05   
ref|XP_009782640.1|  PREDICTED: auxin-responsive protein IAA17-like   50.8    5e-05   
ref|XP_010936161.1|  PREDICTED: auxin-induced protein 22D             50.4    5e-05   
ref|XP_010323008.1|  PREDICTED: IAA2 isoform X1                       49.3    7e-05   
gb|ADL36587.1|  ARF domain class transcription factor                 49.7    7e-05   
ref|NP_001266042.1|  IAA2                                             49.3    7e-05   
ref|XP_002531289.1|  Auxin-induced protein 22D, putative              50.1    7e-05   
emb|CBW30571.1|  auxin-responsive protein iaa27                       50.4    8e-05   
gb|ABI84256.1|  aux/IAA protein                                       48.9    8e-05   
tpg|DAA55064.1|  TPA: hypothetical protein ZEAMMB73_489535            50.1    9e-05   
ref|XP_009395806.1|  PREDICTED: auxin-responsive protein IAA1-like    50.1    1e-04   
ref|XP_009765454.1|  PREDICTED: auxin-responsive protein IAA4-like    49.3    1e-04   
ref|XP_006343103.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  50.1    1e-04   
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  50.1    2e-04   
ref|XP_008811586.1|  PREDICTED: auxin-responsive protein IAA1-like    49.3    2e-04   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  50.1    2e-04   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like   49.7    2e-04   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like   49.7    2e-04   
gb|ABD98054.1|  auxin-regulated protein                               49.7    2e-04   
ref|XP_009416094.1|  PREDICTED: auxin-responsive protein IAA1-lik...  48.9    2e-04   
ref|XP_009612692.1|  PREDICTED: auxin-responsive protein IAA4-like    48.5    2e-04   
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like   49.3    3e-04   
emb|CDY18679.1|  BnaA09g07160D                                        49.3    3e-04   
tpg|DAA55065.1|  TPA: hypothetical protein ZEAMMB73_489535            48.9    3e-04   
gb|ACF88333.1|  unknown                                               48.9    3e-04   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member   48.9    3e-04   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like   48.9    3e-04   
ref|XP_009416093.1|  PREDICTED: auxin-responsive protein IAA1-lik...  48.5    3e-04   
ref|XP_008451269.1|  PREDICTED: auxin-induced protein 22D-like        48.1    3e-04   
ref|XP_003637872.1|  Auxin-responsive aux/iaa gene family member      47.8    5e-04   
emb|CDO99147.1|  unnamed protein product                              47.8    5e-04   
gb|ACJ84063.1|  unknown                                               46.6    5e-04   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590        48.5    5e-04   
gb|KHN03839.1|  Auxin-induced protein 22D                             47.8    5e-04   
ref|XP_010110305.1|  Auxin-responsive protein IAA17                   47.8    6e-04   
ref|NP_001242395.1|  uncharacterized protein LOC100799875             47.8    6e-04   
gb|ADC29391.2|  indole-3-acetic acid inducible 8                      47.8    6e-04   
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member      47.8    7e-04   
gb|KHN18839.1|  Auxin-induced protein 22D                             47.4    8e-04   
ref|NP_001242729.1|  uncharacterized protein LOC100780752             47.4    8e-04   
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700        48.1    8e-04   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...  47.8    8e-04   
gb|ADL70562.1|  indole-3-acetic acid inducible 8                      47.8    8e-04   
gb|ADL70561.1|  indole-3-acetic acid inducible 8                      47.8    8e-04   
ref|NP_850028.1|  auxin-responsive protein IAA8                       47.8    8e-04   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like      47.8    8e-04   
gb|ACU19616.1|  unknown                                               47.8    8e-04   
gb|ADL70569.1|  indole-3-acetic acid inducible 8                      47.8    8e-04   
gb|ADL70568.1|  indole-3-acetic acid inducible 8                      47.4    8e-04   
gb|ADL70563.1|  indole-3-acetic acid inducible 8                      47.8    8e-04   
gb|ADL70564.1|  indole-3-acetic acid inducible 8                      47.8    9e-04   
gb|ADL70566.1|  indole-3-acetic acid inducible 8                      47.8    9e-04   
gb|ADC29393.2|  indole-3-acetic acid inducible 8                      47.8    9e-04   
gb|KEH27147.1|  auxin response factor                                 47.8    9e-04   
gb|AFK45766.1|  unknown                                               47.8    9e-04   
gb|ADL70570.1|  indole-3-acetic acid inducible 8                      47.8    9e-04   
gb|ADL70572.1|  indole-3-acetic acid inducible 8                      47.8    9e-04   
gb|ADC29392.2|  indole-3-acetic acid inducible 8                      47.4    9e-04   
gb|ADL70573.1|  indole-3-acetic acid inducible 8                      47.8    9e-04   
gb|ADL70565.1|  indole-3-acetic acid inducible 8                      47.8    9e-04   
ref|NP_001189579.1|  auxin-responsive protein IAA8                    47.8    0.001   
ref|NP_179852.1|  auxin-responsive protein IAA8                       47.8    0.001   
gb|ADL70567.1|  indole-3-acetic acid inducible 8                      47.8    0.001   
ref|XP_006412880.1|  hypothetical protein EUTSA_v10025542mg           47.8    0.001   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like   47.8    0.001   
ref|XP_006658338.1|  PREDICTED: auxin-responsive protein IAA24-like   47.0    0.001   
gb|ADL70571.1|  indole-3-acetic acid inducible 8                      47.8    0.001   
gb|ADC29389.2|  indole-3-acetic acid inducible 8                      47.4    0.001   
ref|XP_007144687.1|  hypothetical protein PHAVU_007G176700g           47.0    0.001   



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +3

Query  162  MGSMLAE-HGGLNLKATElclglpgggggN--ESESLKVTGKRGFSETVDLKLNLQSAAD  332
            M +ML E HGGLNLKATELCLGLPGGGG    ++ESLK+TGKRGFSETVDLKLNLQ   +
Sbjct  1    MTTMLGEEHGGLNLKATELCLGLPGGGGCAGADTESLKITGKRGFSETVDLKLNLQP-NE  59

Query  333  SSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVRNYRKNIMA  464
              +DLKEKMK+P+KE  KDP+KPP +KAQVVGWPPVR++RKNIMA
Sbjct  60   PVVDLKEKMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKNIMA  104



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 87/109 (80%), Gaps = 7/109 (6%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  323
            MEVGRKMG +LAE  GLNLK TELCLGLPGGGGG +    K+TGKRGFSETVDLKLNLQ 
Sbjct  1    MEVGRKMGGLLAEEQGLNLKETELCLGLPGGGGGAD----KITGKRGFSETVDLKLNLQP  56

Query  324  AADSSLDLKEK--MKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
               ++LDLKE   M  P   P KDP+KPP+KAQVVGWPPVR++RKNIMA
Sbjct  57   NESAALDLKETSAMDKPVLPP-KDPVKPPAKAQVVGWPPVRSFRKNIMA  104



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  323
            MEVGRKM SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS
Sbjct  1    MEVGRKMSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQS  59

Query  324  AADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
              +S +DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMA
Sbjct  60   K-ESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMA  110



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 90/117 (77%), Gaps = 10/117 (9%)
 Frame = +3

Query  144  MEVGRKMGSMLAEH--GGLNLKATElclglpgggggNESES---LKVTGKRGFSETVDLK  308
            MEVGR M  MLAE    GLNLK TELCLGLPGGGGG ES +   +K+TGKRGFSETVDLK
Sbjct  1    MEVGRNMAGMLAEEHDDGLNLKETELCLGLPGGGGGGESTATDPIKITGKRGFSETVDLK  60

Query  309  LNL-QSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            L L QS   ++LDLKE +K+ S E    P KDPIKPP+KAQVVGWPPVR++RKN M+
Sbjct  61   LKLHQSNEPAALDLKENIKNSSHENPMLPPKDPIKPPAKAQVVGWPPVRSFRKNAMS  117



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  EHGGLNLKATElclglpgggggNESE----SLKVTGKRGFSETVDLKLNLQSAADSSLDL  347
            E  GLNLK TELCLGLPGGGGG   E    S+++TGKRGFSETVDLKLNLQS   SS+DL
Sbjct  2    EVHGLNLKETELCLGLPGGGGGGTGEITDQSMRITGKRGFSETVDLKLNLQSNDQSSVDL  61

Query  348  KEKMKS-PSKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             EK+K+ PSKE N KDP+KPP+KAQVVGWPPVR +RKNIMA
Sbjct  62   NEKVKNPPSKETNSKDPVKPPAKAQVVGWPPVRAFRKNIMA  102



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  341
            M SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS  +S +
Sbjct  1    MSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQSK-ESVV  58

Query  342  DLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMA
Sbjct  59   DLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMA  104



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 83/119 (70%), Gaps = 13/119 (11%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElc------lglpgggggNESESLKVTGKRGFSETVDL  305
            MEV RKM +ML     LN K TELC       G  GGGGGNE E+ K TGKRGFSETVDL
Sbjct  1    MEVSRKMANMLGAERDLNFKETELCLGLPGGGGGGGGGGGNEVETPKTTGKRGFSETVDL  60

Query  306  KLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            KLNLQS  ++ +DL + +++ SKE        KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   KLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVRSYRKNIMA  118



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 84/119 (71%), Gaps = 12/119 (10%)
 Frame = +3

Query  141  SMEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETV  299
            SMEVGRKM +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETV
Sbjct  45   SMEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETV  104

Query  300  DLKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            DLKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  105  DLKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMA  162



>gb|KJB38279.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=217

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 82/118 (69%), Gaps = 12/118 (10%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElc----lglpgggggNESESL---KVTGKRGFSETVD  302
            MEVGRKM +ML     LN K TELC     G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  303  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMA  117



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 83/118 (70%), Gaps = 12/118 (10%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  302
            MEVGRKM +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  303  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMA  117



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 83/118 (70%), Gaps = 12/118 (10%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  302
            MEVGRKM +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  303  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMA  117



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 12/118 (10%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  302
            MEVGRKM +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  303  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQ+VGWPPVR+YRKNIMA
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSYRKNIMA  117



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 76/113 (67%), Gaps = 14/113 (12%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESLKVTGKRGFSETVDLKL  311
            MEV RKM         LNLK TELCLG           +++    +  KRGFSETVDLKL
Sbjct  1    MEVSRKMD--------LNLKETELCLGLPGGEVRAAIADQNNIDSINKKRGFSETVDLKL  52

Query  312  NLQSAADSSLDLK-EKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            NLQS   S LDLK +KMK+PSKE  NKD  KPP+KAQVVGWPPVR++RKNIMA
Sbjct  53   NLQSNDSSGLDLKKDKMKNPSKETCNKDSAKPPAKAQVVGWPPVRSFRKNIMA  105



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 75/103 (73%), Gaps = 9/103 (9%)
 Frame = +3

Query  177  AEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  356
             E   LN K TELCLGLPGGG   E E+ K TGKRGF+ETVDLKLNLQ A D  +DL E 
Sbjct  8    GERADLNFKETELCLGLPGGGK-TEVETPKATGKRGFAETVDLKLNLQ-AKDGVMDLNEN  65

Query  357  MKSPSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            +K+ SK+ N       KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  66   IKNASKDKNHLPTSTIKDPAKPPAKAQVVGWPPVRSYRKNIMA  108



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 80/112 (71%), Gaps = 11/112 (10%)
 Frame = +3

Query  150  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA  329
            V RKM +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  
Sbjct  6    VSRKMPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKE  65

Query  330  DSSLDLKEKMK-SPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                DL +K+K + SKE N      K P KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  66   ----DLNDKVKNNASKEKNNLLTCTKYPAKPPAKAQVVGWPPVRSYRKNIMA  113



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 72/103 (70%), Gaps = 6/103 (6%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  341
            M +ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D   
Sbjct  1    MTTMLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED---  57

Query  342  DLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  58   -LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 13/110 (12%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclglpggggg-------NESESLKVTGKRGFSETVDLKLNLQ  320
            M +ML +  GLNLK TELCLGLPGG          +E E+ + TGKRGFSETVDLKLNL 
Sbjct  1    MATMLTKEHGLNLKETELCLGLPGGELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLH  60

Query  321  SAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  61   SKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  106



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 77/113 (68%), Gaps = 15/113 (13%)
 Frame = +3

Query  159  KMGSMLAEHGGLNLKATElc---------lglpgggggNESESLKVTGKRGFSETVDLKL  311
            +M +ML +  GLNLK TELC          G  GGGGG E E+ + TGKRGFSETVDLKL
Sbjct  84   EMATMLTKEHGLNLKETELCLGLPGGGGGGGGGGGGGGGEVETPRATGKRGFSETVDLKL  143

Query  312  NLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            NL S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  144  NLHSKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  192



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATE-lclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  338
            M +++ +  GLNLK TE       GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  339  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  101



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATE-lclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  338
            M +++ +  GLNLK TE       GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  339  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  101



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 7/79 (9%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKPPS  407
            NE E+ K TGKRGFSETVDLKLNLQS  ++ +DL + +++ SKE        KDP KPP+
Sbjct  4    NEVETPKTTGKRGFSETVDLKLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPA  62

Query  408  KAQVVGWPPVRNYRKNIMA  464
            KAQVVGWPPVR+YRKNIMA
Sbjct  63   KAQVVGWPPVRSYRKNIMA  81



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = +3

Query  171  MLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLK  350
            ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D    L 
Sbjct  1    MLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED----LN  56

Query  351  EKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  57   ENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  96



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 75/98 (77%), Gaps = 8/98 (8%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSET-VDLKLNLQSA-ADSSLDLKEKMKS  365
            LN K TELCLGLPGGGGG E E+ + TGKRGFSET VDLKLNLQ+  A S +DLKE MKS
Sbjct  10   LNFKETELCLGLPGGGGGAEVEAPRATGKRGFSETEVDLKLNLQAKDASSVVDLKEAMKS  69

Query  366  PSK------EPNKDPIKPPSKAQVVGWPPVRNYRKNIM  461
              K       P KDP KPP+KAQVVGWPPVR+YRKN+M
Sbjct  70   NEKTLLAGASPAKDPAKPPAKAQVVGWPPVRSYRKNMM  107



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 60/72 (83%), Gaps = 5/72 (7%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGW  428
            K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +     NKD +KPP+KAQVVGW
Sbjct  20   KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIANCNKDSVKPPAKAQVVGW  79

Query  429  PPVRNYRKNIMA  464
            PPVR++RKN+MA
Sbjct  80   PPVRSFRKNVMA  91



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 60/71 (85%), Gaps = 4/71 (6%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKE---PNKDPIKPPSKAQVVGWP  431
            K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +    NKD +KPP+KAQVVGWP
Sbjct  20   KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIASNKDSVKPPAKAQVVGWP  79

Query  432  PVRNYRKNIMA  464
            PVR++RKN+MA
Sbjct  80   PVRSFRKNVMA  90



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 76/107 (71%), Gaps = 9/107 (8%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  341
            M +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  D + 
Sbjct  1    MPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKEDLND  60

Query  342  DLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            ++K      SKE N      KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   NVK---NIASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSYRKNIMA  104



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  246  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVV  422
            NE ES  K TGKRG+SETVDLKLNLQS  +  +DL + +++ SKE N  P KPP+KAQV+
Sbjct  38   NEVESSPKTTGKRGYSETVDLKLNLQSK-EGCMDLNQNLENGSKEKNHHPAKPPAKAQVL  96

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR+YRKNIMA
Sbjct  97   GWPPVRSYRKNIMA  110



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 4/67 (6%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRN  443
            +T KRGFSETVDLKLNLQS  D S   KEK+K+PSKE  NKD  KPP+K QVVGWPPVR+
Sbjct  42   ITKKRGFSETVDLKLNLQSNLDLS---KEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRS  98

Query  444  YRKNIMA  464
            YRKNIMA
Sbjct  99   YRKNIMA  105



>gb|AFK42031.1| unknown [Medicago truncatula]
Length=214

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +3

Query  189  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  353
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  354  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 72/106 (68%), Gaps = 5/106 (5%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  335
            M SML     LNL+ TELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D 
Sbjct  1    MMSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  336  SLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMA  106



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  246  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVV  422
            NE ES  K TGKRG+SETVDLKLNLQS  +  +DL + +++ SKE N  P KPP+KAQV+
Sbjct  38   NEVESSPKTTGKRGYSETVDLKLNLQSK-EGCMDLNQNLENGSKEKNHLPAKPPAKAQVL  96

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR+YRKNIMA
Sbjct  97   GWPPVRSYRKNIMA  110



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 73/104 (70%), Gaps = 10/104 (10%)
 Frame = +3

Query  180  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  356
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  357  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++A
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLA  112



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 73/104 (70%), Gaps = 10/104 (10%)
 Frame = +3

Query  180  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  356
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  357  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++A
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLA  112



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 72/106 (68%), Gaps = 5/106 (5%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  335
            M SML     LNL+ TELCLGL   G     E E+ K TGKRGFSETVDLKLNLQS  D 
Sbjct  1    MTSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETVDLKLNLQSKEDL  60

Query  336  SLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIM+
Sbjct  61   NDNVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMS  106



>gb|KEH42779.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=204

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +3

Query  189  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  353
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  354  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 77/108 (71%), Gaps = 7/108 (6%)
 Frame = +3

Query  150  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS--  323
            VGRKM  +     GLN   TELCLGLPGGGGG  ++ +K TGKRGFSETVDLKLNLQS  
Sbjct  4    VGRKMAGL----HGLNFMETELCLGLPGGGGGESTDPIKTTGKRGFSETVDLKLNLQSNE  59

Query  324  -AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
              + S L      +  +  P KDPIKPP+KAQVVGWPPVR++RKNI++
Sbjct  60   PPSSSDLINISSTEINAMLPPKDPIKPPAKAQVVGWPPVRSFRKNIIS  107



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +3

Query  189  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  353
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  354  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +3

Query  189  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  353
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  354  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCL LPGG    ++ +    G KRGFSETVDL LNLQS  + ++DL     S 
Sbjct  6    MNLKATELCLSLPGGAETLDTPAKSAVGNKRGFSETVDLMLNLQSNKERAIDLNNATASK  65

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM  461
             K   KDP+KPP+KAQVVGWPPVRNYRKNIM
Sbjct  66   QKTLLKDPVKPPAKAQVVGWPPVRNYRKNIM  96



>ref|XP_008341049.1| PREDICTED: auxin-responsive protein IAA7-like [Malus domestica]
Length=173

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 75/109 (69%), Gaps = 12/109 (11%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclglpgggggNESE-SLKVTGKRGFSETVDLKLNLQSAADSS  338
            M SML     LNL+ TELCLGLPGGG    +E   K TGKRGFSETVDLKL LQS  D  
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDD--  58

Query  339  LDLKEKMKS-PSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
              L + +K+  S+E N      KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  59   --LNDNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMA  105



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATELCLGLPGGTEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEEAVDLNNIAAAP  65

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM  461
             +   KDP KPP+KAQVVGWPPVRNYRKN+M
Sbjct  66   KESLLKDPTKPPAKAQVVGWPPVRNYRKNMM  96



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 71/106 (67%), Gaps = 5/106 (5%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  335
            M SML     LNL+  ELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D 
Sbjct  1    MMSMLGVERDLNLREAELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  336  SLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNVMA  106



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +3

Query  189  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  353
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  354  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            K  S  K   KDP KPP+KAQVVGWPPVR+Y+KN+MA
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMA  99



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 74/106 (70%), Gaps = 11/106 (10%)
 Frame = +3

Query  177  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  350
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  351  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMA  112



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 74/106 (70%), Gaps = 11/106 (10%)
 Frame = +3

Query  177  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  350
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  351  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMA  112



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 73/105 (70%), Gaps = 4/105 (4%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclglpgggggNESE-SLKVTGKRGFSETVDLKLNLQSAADSS  338
            M SML     LNL+ TELCLGLPGGG    +E   K TGKRGFSETVDLKL LQS  D +
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  339  LDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             ++K    + K+      KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   DNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMA  105



>ref|NP_974355.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76709.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=210

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  369  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIM  461
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMM  97



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  369  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIM  461
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMM  97



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS   + +DL     S 
Sbjct  1    MNLKETELCLGLPGGLETVESPAKSGVGNKRGFSETVDLKLNLQSNKQAPIDLNVAGTSR  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKNIMA
Sbjct  61   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNIMA  92



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  1    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  60

Query  369  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIM  461
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M
Sbjct  61   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMM  92



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL     +P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNNVAAAP  65

Query  369  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIM  461
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M
Sbjct  66   KEKTTLKDPSKPPTKAQVVGWPPVRNYRKNMM  97



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = +3

Query  192  LNLKATElclglpgggggNES-ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG   NE+ E   V  KRGFSETVDL LNLQS  + ++DL   + S 
Sbjct  6    INLKATELCLGLPGGAEANENLEKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASA  64

Query  369  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIM  461
            SK+    KDP KPP+KAQVVGWPPVRNYRKNI+
Sbjct  65   SKDKTLLKDPAKPPAKAQVVGWPPVRNYRKNII  97



>gb|ADL70639.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=171

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 67/112 (60%), Gaps = 16/112 (14%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  323
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  324  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                ++DL  K    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+
Sbjct  50   KTGVTVDLTPKNSDTSTDEENLITSKDPAKPPAKAQVVGWPPVRSYRKNAMS  101



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 9/75 (12%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIKPPSKAQV  419
            K TGKRGF+ETVDLKLNLQ A D  +DL + +K+  SK+ N       KDP KPP+KAQV
Sbjct  39   KATGKRGFAETVDLKLNLQ-AKDGVMDLNDNIKNITSKDKNHLPAAAIKDPAKPPAKAQV  97

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR+YRKN+MA
Sbjct  98   VGWPPVRSYRKNVMA  112



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  369  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIM  461
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIM  97



>gb|ADL70642.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70650.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>dbj|BAH56942.1| AT4G14550 [Arabidopsis thaliana]
Length=183

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>gb|ADL70640.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVR  440
            V  KRGFSETVDL LNLQS  + S+DL     SP KE N  KDP KPP+KAQVVGWPPVR
Sbjct  83   VGSKRGFSETVDLMLNLQSNKEGSVDLNNVAASP-KEKNLIKDPAKPPAKAQVVGWPPVR  141

Query  441  NYRKNIM  461
            NYRKNIM
Sbjct  142  NYRKNIM  148



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 5/96 (5%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDL---KEKMK  362
            +N + TEL LGLPGG   N+SE  KV GKRGFSETVDLKLNL +   S  D+   +E MK
Sbjct  15   INFEETELRLGLPGGSNVNDSEFAKVNGKRGFSETVDLKLNLSTKEPSGKDVIVGEETMK  74

Query  363  SPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
              +  P+   DP KPP+KAQVVGWPP+R++RKN+MA
Sbjct  75   EKATVPSSSNDPAKPPAKAQVVGWPPIRSFRKNVMA  110



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 9/75 (12%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIKPPSKAQV  419
            K TGKRGF+ETVDLKLNLQ A +  +DL E +K+  SK+ N       KDP KPP+KAQV
Sbjct  39   KATGKRGFAETVDLKLNLQ-AKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQV  97

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR+YRKN+MA
Sbjct  98   VGWPPVRSYRKNVMA  112



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMKS---PSKE--PNKDPIKPPSKAQVV  422
            KV GKRGFSETVDLKLN   A+D  S      KMKS    +KE   NKDPIKPP+KAQVV
Sbjct  32   KVNGKRGFSETVDLKLNFHQASDDISCAMENNKMKSSVTTTKEVVCNKDPIKPPAKAQVV  91

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKN+MA
Sbjct  92   GWPPVRSFRKNVMA  105



>gb|ADB93627.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=191

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>gb|ADB93628.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70647.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70648.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70649.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70651.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=189

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>gb|ADB93625.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADB93626.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70643.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70644.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70645.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70646.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>gb|ADB93629.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETIESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 74/111 (67%), Gaps = 14/111 (13%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElc--------lglpgggggNESESLKVTGKRGFSETVDLKLNL  317
            M +ML +   LNLK TELC         G  GGGGG+E E+ + TGKRGFSETVDLKLNL
Sbjct  1    MATMLGKEHHLNLKETELCLGLPGAGGGGGSGGGGGSEVETPRATGKRGFSETVDLKLNL  60

Query  318  QSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            Q+  D    L E +K+  +E    KDP K P+KAQVVGWPPVR+YRKN+M 
Sbjct  61   QAKED----LNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNMMT  107



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NL+ATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLRATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  369  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIM  461
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIM  97



>gb|ADL70641.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPG     ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGCTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNVNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 67/112 (60%), Gaps = 16/112 (14%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  323
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  324  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                ++DL  +    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+
Sbjct  50   KPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMS  101



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP--NKDPIKPPSKAQV  419
            N+ E  K  GKRGFSETVDLKLNL +A ++  D  EK+K  S     + DP KPP+KAQV
Sbjct  32   NDGEMTKNNGKRGFSETVDLKLNLSTAKEAVADEAEKVKKKSTVAPRSADPAKPPAKAQV  91

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR++RKNIMA
Sbjct  92   VGWPPVRSFRKNIMA  106



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 67/112 (60%), Gaps = 16/112 (14%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  323
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  324  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                ++DL  +    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+
Sbjct  50   KPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMS  101



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 71/105 (68%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  EHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKE  353
            E   LN KATELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   ERADLNYKATELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  354  KMKSPSKEPN--------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             + + + E          KDP KPP+KAQVVGWPPVR+YRKN++A
Sbjct  69   NINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLA  113



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 9/75 (12%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIKPPSKAQV  419
            K TGKRGF+ETVDLKLNLQ A +  +DL E +K+  SK+ N       KDP KPP+KAQV
Sbjct  40   KATGKRGFAETVDLKLNLQ-AKEGVMDLNENIKNIASKDKNHLPADTIKDPAKPPAKAQV  98

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR+YRKN++A
Sbjct  99   VGWPPVRSYRKNVLA  113



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = +3

Query  162  MGSMLAE-HGGLNLKATElc----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSA  326
            M ++L +    LNLK TELC     G  GGGG ++ E+ +  GKRGFSETVDLKLNLQS 
Sbjct  1    MATLLGKVQNDLNLKETELCLGLPGGGGGGGGSDQVETPRSNGKRGFSETVDLKLNLQSK  60

Query  327  ADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             D    L + +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+M 
Sbjct  61   ED----LNDDVKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMV  104



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 56/83 (67%), Gaps = 14/83 (17%)
 Frame = +3

Query  258  SLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------KDPI  395
            SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       KDP 
Sbjct  37   SLKASGKRGFSETVDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSKDPA  96

Query  396  KPPSKAQVVGWPPVRNYRKNIMA  464
            KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  97   KPPAKAQVVGWPPVRSYRKNVMA  119



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKATELCLGLPGG    ES +    G KR FSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRSFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  369  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIM  461
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIM  97



>ref|XP_004150437.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
Length=264

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 57/86 (66%), Gaps = 14/86 (16%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------K  386
            +  SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       K
Sbjct  34   DQTSLKASGKRGFSETVDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSK  93

Query  387  DPIKPPSKAQVVGWPPVRNYRKNIMA  464
            DP KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  94   DPAKPPAKAQVVGWPPVRSYRKNVMA  119



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMK---SPSKE--PNKDPIKPPSKAQVV  422
            K+ GKRGFSETVDLKLN   A D  S      KMK   + +KE   NKDPIKPP+KAQVV
Sbjct  34   KINGKRGFSETVDLKLNFHQANDDISCAMENNKMKNSVTTTKEVVCNKDPIKPPAKAQVV  93

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKN+MA
Sbjct  94   GWPPVRSFRKNVMA  107



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            V  KRGFSETVD KLNLQS     +DL   +    KE  KDP KPP+KAQVVGWPPVRNY
Sbjct  55   VGNKRGFSETVDFKLNLQSNKQGHVDLN--VTVAHKEKTKDPAKPPAKAQVVGWPPVRNY  112

Query  447  RKNIMA  464
            RK++MA
Sbjct  113  RKSVMA  118



>gb|AFZ78616.1| hypothetical protein [Populus tomentosa]
Length=211

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 70/105 (67%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  EHGGLNLKATElclgl-pgggggNESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKE  353
            E   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  354  KMKSPSKEPN--------KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             + + + E          KDP KPP+KAQVVGWPPVR+YRKN++A
Sbjct  69   NINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLA  113



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 67/91 (74%), Gaps = 4/91 (4%)
 Frame = +3

Query  198  LKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK  374
            L ATELCLGLPGG   NE+ +    G KRGFSETVDL LNLQS  + ++DL   + S SK
Sbjct  12   LYATELCLGLPGGAEANENLAKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASASK  70

Query  375  EPN--KDPIKPPSKAQVVGWPPVRNYRKNIM  461
            E    KDP KPP+KAQVVGWPPVRNYRKNI+
Sbjct  71   ETTLLKDPAKPPAKAQVVGWPPVRNYRKNII  101



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  440
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KTSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  441  NYRKNIMA  464
            ++RKNI+ 
Sbjct  98   SFRKNILT  105



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NL ATELCLGLPGG    ES +   V  KRGFSET+DL LNLQ   + ++DL     S 
Sbjct  6    MNLNATELCLGLPGGTKAVESPAKSSVRNKRGFSETMDLMLNLQCNKEETVDLNNATASK  65

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM  461
             K   KDP KPP+KAQVVGWPPVRNYRKN+M
Sbjct  66   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNMM  96



>gb|KJB82526.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=194

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            N+ E+ K  GKRGFSETV+LKLNL S    + D  EKMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SEKMKEKS---STDPAKPPAKAQVVG  87

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKNIMA
Sbjct  88   WPPVRSFRKNIMA  100



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 56/83 (67%), Gaps = 14/83 (17%)
 Frame = +3

Query  258  SLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------KDPI  395
            SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       KDP 
Sbjct  37   SLKSSGKRGFSETVDLKLNLQSKDGGGGGGVGVGVDLNENVKNVSTNVDGEKSLCSKDPA  96

Query  396  KPPSKAQVVGWPPVRNYRKNIMA  464
            KPP+KAQVVGWPPVR+YRKN+MA
Sbjct  97   KPPAKAQVVGWPPVRSYRKNVMA  119



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 10/80 (13%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  404
            N+SE+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDSEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  405  SKAQVVGWPPVRNYRKNIMA  464
            SKAQVVGWPP+R++RKN+MA
Sbjct  92   SKAQVVGWPPIRSFRKNVMA  111



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  83

Query  447  RKNIMA  464
            RKN+MA
Sbjct  84   RKNVMA  89



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  428
            ES +     KRGFSETVDLKLNLQ+  +  +DL    K  S   +KD  KPP+KAQVVGW
Sbjct  32   ESPAKAAGNKRGFSETVDLKLNLQTNKEGVVDLNNVAKDKSLLVSKDHAKPPAKAQVVGW  91

Query  429  PPVRNYRKNIMA  464
            PPVRNYRKN+MA
Sbjct  92   PPVRNYRKNMMA  103



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 54/73 (74%), Gaps = 10/73 (14%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSA---ADSSLDLKE------KMKSPSKEPNKDPIKPPSKAQVVG  425
            GKRGFSETVDLKLNL SA    DS++DLKE      K   PS  P  D +KPP+KAQVVG
Sbjct  25   GKRGFSETVDLKLNLSSAEIGLDSAIDLKENNFNKEKNLLPSSSPT-DSVKPPAKAQVVG  83

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKN+MA
Sbjct  84   WPPVRSFRKNVMA  96



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 17/117 (15%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHG---GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLN  314
            MEV RKM +M  E      LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLN
Sbjct  1    MEVARKMATMHGEEREKPDLNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLN  55

Query  315  LQSAADSSLDLKEKMKSPSKEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMA  464
            L S  ++ +D   K+KS  KE +K       DP +PP+KAQVVGWPPVR++RKN++A
Sbjct  56   L-SGKEAGVD-DNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLA  110



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  27   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  86

Query  447  RKNIMA  464
            RKN+MA
Sbjct  87   RKNVMA  92



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  440
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KSSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  441  NYRKNIMA  464
            ++RKNI+ 
Sbjct  98   SFRKNILT  105



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPSKPPAKAQVVGWPPVRNY  83

Query  447  RKNIMA  464
            RKN+MA
Sbjct  84   RKNVMA  89



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLKAT+LCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATDLCLGLPGGAEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEGTVDLNNVSAAP  65

Query  369  -SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM  461
              K   KD  KPP+KAQVVGWPPVRNYRKNIM
Sbjct  66   KEKTLLKDHSKPPAKAQVVGWPPVRNYRKNIM  97



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            N+ E+ K  GKRGFSETV+LKLNL S    + D  EKMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SEKMKEKS---STDPAKPPAKAQVVG  87

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKNIMA
Sbjct  88   WPPVRSFRKNIMA  100



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 76/119 (64%), Gaps = 16/119 (13%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  323
            MEV RKM   +AE  GLN K TELCLGLPGGGGG E +++K+ GKRGFSETVDLKLNLQS
Sbjct  1    MEVCRKM---VAEERGLNFKETELCLGLPGGGGGGEPDAVKINGKRGFSETVDLKLNLQS  57

Query  324  AADSSLDLKEKMKSPSKEPNKDPIKPP-------------SKAQVVGWPPVRNYRKNIM  461
               +S DL       + + N    K               +KAQVVGWPPVR++RKNI+
Sbjct  58   NDSASTDLNNGGGGGAMKNNNSAEKTAANMVPPKDPVKPPAKAQVVGWPPVRSFRKNIV  116



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 8/79 (10%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKPPS  407
            N++E+ K  GKRGFSETVDLKLNL S  ++  D  ++ K  +KE      PN DP KPPS
Sbjct  35   NDAEAAKSNGKRGFSETVDLKLNL-STKETGKDGSDQEKVATKEKTVAPRPN-DPAKPPS  92

Query  408  KAQVVGWPPVRNYRKNIMA  464
            KAQVVGWPP+R++RKN+MA
Sbjct  93   KAQVVGWPPIRSFRKNVMA  111



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 10/80 (13%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  404
            N+ E+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDGEAAKGNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  405  SKAQVVGWPPVRNYRKNIMA  464
            SKAQVVGWPP+R++RKN+MA
Sbjct  92   SKAQVVGWPPIRSFRKNVMA  111



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    E  S    G KRGFSETV LKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGAETVECPSKSGVGNKRGFSETVGLKLNLQSNKQGPVDLNVNGAPK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMA  92



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  368
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS      DL       
Sbjct  1    MNLKETELCLGLPGGAETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVSGSIK  60

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             K   +DP KPP+KAQVVGWPPVRNYRK +MA
Sbjct  61   EKTLLQDPTKPPTKAQVVGWPPVRNYRKTVMA  92



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            N+ E+ K  GKRGFSETV+LKLNL S    + D  +KMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SDKMKEKS---STDPAKPPAKAQVVG  87

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKNIMA
Sbjct  88   WPPVRSFRKNIMA  100



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 8/72 (11%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  428
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  30   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  86

Query  429  PPVRNYRKNIMA  464
            PPVR+YRKN+MA
Sbjct  87   PPVRSYRKNVMA  98



>gb|KJB44872.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=210

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 6/73 (8%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            N++E+ K  GKRG+S+ VDLKLNL +  ++S+D  EKMK       K+  KPP+KAQVVG
Sbjct  32   NDNETAKNNGKRGYSDMVDLKLNLSTTKEASVDEAEKMKE------KNTAKPPAKAQVVG  85

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKNIM 
Sbjct  86   WPPVRSFRKNIMT  98



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 6/73 (8%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            N++E+ K  GKRG+S+ VDLKLNL +  ++S+D  EKMK       K+  KPP+KAQVVG
Sbjct  32   NDNETAKNNGKRGYSDMVDLKLNLSTTKEASVDEAEKMKE------KNTAKPPAKAQVVG  85

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKNIM 
Sbjct  86   WPPVRSFRKNIMT  98



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = +3

Query  255  ESLKVTGKRGFSETVDLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGW  428
            E+ K  GKRGF ETVDLKLNL S    SLD   K+++K+    P+ D +KPP+KAQVVGW
Sbjct  44   EATKNNGKRGFPETVDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGW  103

Query  429  PPVRNYRKNIMA  464
            PPVR++RKNI++
Sbjct  104  PPVRSFRKNIVS  115



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 10/76 (13%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQS---AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQ  416
            NE E+ K  GKRGFSETV+LKLNL S    A+ S ++KEK        + D  KPP+KAQ
Sbjct  32   NEGETTKNNGKRGFSETVNLKLNLSSKETVAEDSDEMKEK-------SSTDTAKPPAKAQ  84

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR++RKNIMA
Sbjct  85   VVGWPPVRSFRKNIMA  100



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 53/78 (68%), Gaps = 7/78 (9%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQS-----AADSSLDLKEKMKSPSKEPNKDPIKPPSK  410
            N+ E  K  GKRGFSETVDLKLNL +       D    +KEK  +P    + DP KPP+K
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGGDEEKVMKEKTVAPP--ASTDPAKPPAK  91

Query  411  AQVVGWPPVRNYRKNIMA  464
            AQVVGWPP+R++RKN+MA
Sbjct  92   AQVVGWPPIRSFRKNVMA  109



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 7/71 (10%)
 Frame = +3

Query  258  SLKVTG-KRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWP  431
            S K  G KRGFSETVDLKLNLQ+   +  +DL     + + + +KDP KPPSKAQVVGWP
Sbjct  31   SAKAAGNKRGFSETVDLKLNLQTNKQEGVMDL-----TNASKVSKDPAKPPSKAQVVGWP  85

Query  432  PVRNYRKNIMA  464
            PVRNYRKN+MA
Sbjct  86   PVRNYRKNVMA  96



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 3/76 (4%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK-MKSPSKEP--NKDPIKPPSKAQ  416
            N+ E  K  GKRGFSETVDLKLNL +       ++EK MK  +  P  + DP KPP+KAQ
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQ  93

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPP+R++RKN+MA
Sbjct  94   VVGWPPIRSFRKNVMA  109



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 8/72 (11%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  428
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  37   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  93

Query  429  PPVRNYRKNIMA  464
            PPVR++RKN+MA
Sbjct  94   PPVRSFRKNVMA  105



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNL--QSAADSSLDLKEKMKS-PSKEPN-----KDPIKPPSKAQVV  422
             TGKRG+SETVDLKLNL  QS  +   ++  K  S P KE N     KDP KPP+KAQVV
Sbjct  41   TTGKRGYSETVDLKLNLHRQSVKEDLNEINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVV  100

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR+YRKNIMA
Sbjct  101  GWPPVRSYRKNIMA  114



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 74/120 (62%), Gaps = 15/120 (13%)
 Frame = +3

Query  144  MEVGRKMGSMLA---EHGGLNLKATE----lclglpgggggNESESLKVTG-KRGFSETV  299
            MEV RKM S L    +   LN + TE    L  G  GG G     + K+ G KRGF+ETV
Sbjct  1    MEVCRKMASRLGGGPDEYSLNFEETELRLGLPGGGGGGDGDTTPSATKINGAKRGFAETV  60

Query  300  DLKLNLQSAADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            DLKLNL +  +S LD  EK  SP KE N      DP KPP+KAQVVGWPPVR++RKNI++
Sbjct  61   DLKLNLPTK-ESVLDPAEKKNSP-KEKNLLPCSNDPAKPPAKAQVVGWPPVRSFRKNILS  118



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 10/81 (12%)
 Frame = +3

Query  246  NESESLKVTGKRG--FSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKP  401
            N+ E+ K  GKRG  FSETVDLKLNL S  D+  D  ++ K+  KE      PN DP KP
Sbjct  35   NDPEAAKSNGKRGQRFSETVDLKLNL-STKDTGKDGSDQEKAAMKEKAVAPRPN-DPAKP  92

Query  402  PSKAQVVGWPPVRNYRKNIMA  464
            PSKAQVVGWPP+R++RKN+MA
Sbjct  93   PSKAQVVGWPPIRSFRKNVMA  113



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 16/97 (16%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL------DLKE  353
            +N +ATEL LGLPGG  G +  ++K  GKRGFSETVDLKLNL S A  S+      D+KE
Sbjct  2    INFEATELRLGLPGGNHGGDMAAVKNNGKRGFSETVDLKLNLSSTAMDSVSGAQLEDIKE  61

Query  354  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            K          D +KPP+K QVVGWPPVR++RKN+M+
Sbjct  62   K----------DVVKPPAKTQVVGWPPVRSFRKNVMS  88



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 80/119 (67%), Gaps = 14/119 (12%)
 Frame = +3

Query  144  MEVGRKMGSMLA---EHGGLNLKATElclglpgggggNESESL----KVTGKRGFSETVD  302
            MEV RKM +ML    +   LN + TEL LGLPGGGGG+E ES     K  GKRGF ETVD
Sbjct  1    MEVCRKMANMLGAERDEYSLNFEETELRLGLPGGGGGSEGESTPSPTKNGGKRGFCETVD  60

Query  303  LKLNLQSAADSSLDLKEKMKSPSKEPNKDPI-----KPPSKAQVVGWPPVRNYRKNIMA  464
            LKLNL S  +S +D  EK  SP KE N  P      KPP+KAQVVGWPPVR++RKNI++
Sbjct  61   LKLNLPSK-ESVMDPSEKKNSP-KEKNLLPCTNDLAKPPAKAQVVGWPPVRSFRKNILS  117



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 11/72 (15%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSA-----ADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  428
            VTG KRGFSETVDLKLNL +        ++LD KEK        +KDP KPP+KAQVVGW
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTLDSKEKSSC-----SKDPAKPPAKAQVVGW  81

Query  429  PPVRNYRKNIMA  464
            PPVR+YRKN+M 
Sbjct  82   PPVRSYRKNVMV  93



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  456  IMA  464
            +M 
Sbjct  94   VMT  96



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  456  IMA  464
            +M 
Sbjct  94   VMT  96



>gb|ABR08763.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 16/76 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  13   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPTKA  67

Query  414  QVVGWPPVRNYRKNIM  461
            QVVGWPPVR+YRKN+M
Sbjct  68   QVVGWPPVRSYRKNVM  83



>gb|ADL70687.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70690.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=132

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 16/76 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  9    VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  63

Query  414  QVVGWPPVRNYRKNIM  461
            QVVGWPPVR+YRKN+M
Sbjct  64   QVVGWPPVRSYRKNVM  79



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 51/77 (66%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +  ++          + D KEK   P     KDP KPPSKA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHDVVTFDSKEKSSCP-----KDPAKPPSKA  81

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  82   QVVGWPPVRSYRKNVMV  98



>gb|ADL70689.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=138

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 16/76 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  15   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  69

Query  414  QVVGWPPVRNYRKNIM  461
            QVVGWPPVR+YRKN+M
Sbjct  70   QVVGWPPVRSYRKNVM  85



>gb|ABR08758.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08759.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08760.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08761.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08762.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08764.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08765.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08766.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08767.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08768.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08769.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08770.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08771.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08772.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08773.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08774.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08775.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08776.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08777.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08778.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08779.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 16/76 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  13   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  67

Query  414  QVVGWPPVRNYRKNIM  461
            QVVGWPPVR+YRKN+M
Sbjct  68   QVVGWPPVRSYRKNVM  83



>gb|ADB93635.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93636.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93637.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93638.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93639.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70683.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70686.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70691.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70693.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70694.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=150

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  82   QVVGWPPVRSYRKNVMV  98



>gb|ADL70685.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70695.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=149

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  26   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  80

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  81   QVVGWPPVRSYRKNVMV  97



>gb|ADL70684.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70688.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70692.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=144

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  21   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  75

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  76   QVVGWPPVRSYRKNVMV  92



>gb|KJB11146.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=285

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSS-LD-LKEKMKSPSKEPN-----KDPIKPPSKAQVV  422
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  452
            GKRG+ +TVDLKLNL     SS DL  +      + N  P+KPP+KAQVVGWPPVRN+RK
Sbjct  37   GKRGYEQTVDLKLNL-----SSKDLPNQTDLAENKKNDQPVKPPAKAQVVGWPPVRNFRK  91

Query  453  NIMA  464
            N+MA
Sbjct  92   NVMA  95



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFSE V+LKL L S    S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKQGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  456  IMA  464
            +M 
Sbjct  94   VMT  96



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 11/84 (13%)
 Frame = +3

Query  246  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL----------DLKEKMKSPSKEPNKDP  392
            NE ES  K  GKR FSETVDLKLNL ++ DS+L          ++KEK  +     + DP
Sbjct  32   NELESSNKNNGKRVFSETVDLKLNLSNSKDSTLMDNININQVDNMKEKKNNIVVPSSNDP  91

Query  393  IKPPSKAQVVGWPPVRNYRKNIMA  464
             KPP+KAQVVGWPPVR++RKN+M 
Sbjct  92   AKPPAKAQVVGWPPVRSFRKNVMT  115



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 4/65 (6%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN-KDPIKPPSKAQVVGWPPVRNYR  449
            GKRGFSETVDLKLNL +        +EKMK  +  P+  DP KPP+KAQVVGWPP+R++R
Sbjct  46   GKRGFSETVDLKLNLSTKESGK---EEKMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSFR  102

Query  450  KNIMA  464
            KN+M+
Sbjct  103  KNVMS  107



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 14/99 (14%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK---  362
            LN +ATEL LGLPGGGGGN+ E++K  GKR FS+TVDLKL L S+ +S++D  E +K   
Sbjct  2    LNFEATELRLGLPGGGGGNDGEAVKSNGKRAFSDTVDLKLKL-SSKESNVDQVENLKDNN  60

Query  363  -----SPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                 SPS     D  KPP+KAQVVGWPPVR+YRKNI++
Sbjct  61   NNVVTSPS-----DSTKPPAKAQVVGWPPVRSYRKNILS  94



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  422
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  422
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 9/97 (9%)
 Frame = +3

Query  189  GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADS-----SLDLKE  353
            GLNL+ TELCLGLPG     ++ S     KRGFSETVDLKLNL +  +S     S D+  
Sbjct  6    GLNLRETELCLGLPG----GDTASPLTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVVS  61

Query  354  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
             +        KDP KPP+KAQVVGWPPVR+YRKN+M 
Sbjct  62   AISKEKSSCTKDPTKPPAKAQVVGWPPVRSYRKNVMG  98



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  422
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>gb|KDO53919.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=200

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 7/73 (10%)
 Frame = +3

Query  264  KVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKSP---SKEPNKDPIKPPS-KAQVVG  425
            K + KRGF ET  +DLKLNLQS  +SS+DL E  K+P   +K  +KDP KP + KAQVVG
Sbjct  40   KASNKRGFCETAVIDLKLNLQSK-ESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVG  98

Query  426  WPPVRNYRKNIMA  464
            WPPVR+YRKN MA
Sbjct  99   WPPVRSYRKNAMA  111



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 14/98 (14%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  371
            LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLNL S  ++ +D   K+KS  
Sbjct  11   LNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLNL-SGKEAGVD-DNKVKSLQ  63

Query  372  KEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMA  464
            KE +K       DP +PP+KAQVVGWPPVR++RKN++A
Sbjct  64   KEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLA  101



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 77/114 (68%), Gaps = 14/114 (12%)
 Frame = +3

Query  162  MGSMLA---EHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAAD  332
            M S+L    E  GL L+ TEL LGLPGGGGG    S K +GKRGFSET+DLKL L + AD
Sbjct  1    MASLLVRGKEDYGLGLEETELRLGLPGGGGGEGDVS-KNSGKRGFSETIDLKLKLHTVAD  59

Query  333  SS---LDLKEKMK-SPSKEPN-----KDPIKPPS-KAQVVGWPPVRNYRKNIMA  464
            S    ++  EKMK SP  + N      DP KPP+ KAQVVGWPPVR++RKN+MA
Sbjct  60   SKEVVMEASEKMKRSPPSQNNILTCTNDPEKPPAPKAQVVGWPPVRSFRKNMMA  113



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 7/73 (10%)
 Frame = +3

Query  264  KVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKSP---SKEPNKDPIKPPS-KAQVVG  425
            K + KRGF ET  +DLKLNLQS  +SS+DL E  K+P   +K  +KDP KP + KAQVVG
Sbjct  40   KASNKRGFCETAVIDLKLNLQSK-ESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVG  98

Query  426  WPPVRNYRKNIMA  464
            WPPVR+YRKN MA
Sbjct  99   WPPVRSYRKNAMA  111



>gb|KJB11142.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11143.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=227

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  422
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSLD---LKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  431
            GKRG+ ETVDLKLNL +    +LD   LKEK  S  K     PN D +KPP+KAQVVGWP
Sbjct  39   GKRGYEETVDLKLNLSTKDVGNLDQSDLKEKTLSKEKNLLPCPN-DSVKPPAKAQVVGWP  97

Query  432  PVRNYRKNIMA  464
            PVR++RKN+MA
Sbjct  98   PVRSFRKNVMA  108



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 65/98 (66%), Gaps = 11/98 (11%)
 Frame = +3

Query  189  GLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS-----SLDLK  350
            GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL +  +S     S D+ 
Sbjct  6    GLNLRETELCLGLPGGDTASP-----VTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVV  60

Query  351  EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
              +        KDP KPP+KAQVVGWPPVR+YRKN+M 
Sbjct  61   SAISKEKSSCPKDPTKPPAKAQVVGWPPVRSYRKNVMG  98



>ref|XP_007050422.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOX94579.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=260

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKEPNKDPIKPPSKAQVVGWPPV  437
            +V  KRGFSETVDLKLNL S   S +D  EK K+  P      DP KPP+KAQVVGWPPV
Sbjct  92   EVARKRGFSETVDLKLNLSSKESSGVDPNEKEKNLLPCA---TDPAKPPAKAQVVGWPPV  148

Query  438  RNYRKNIMA  464
            R++RKN+ A
Sbjct  149  RSFRKNMFA  157



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 9/82 (11%)
 Frame = +3

Query  246  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL--------DLKEKMKSPSKEPNKDPIK  398
            NE ES  K  GKR FSETVDLKLNL ++ DS+L        ++KEK  +     + DP K
Sbjct  32   NEVESTNKNNGKRVFSETVDLKLNLSNSKDSTLMDNINQVDNMKEKKNNIVVPSSNDPAK  91

Query  399  PPSKAQVVGWPPVRNYRKNIMA  464
             P+KAQVVGWPPVR++RKN+M 
Sbjct  92   SPAKAQVVGWPPVRSFRKNVMT  113



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 5/69 (7%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKEPNKDPIKPPSKAQVVGWPPV  437
            +V  KRGFSETVDLKLNL S   S +D  EK K+  P      DP KPP+KAQVVGWPPV
Sbjct  105  EVARKRGFSETVDLKLNLSSKESSGVDPNEKEKNLLPCAT---DPAKPPAKAQVVGWPPV  161

Query  438  RNYRKNIMA  464
            R++RKN+ A
Sbjct  162  RSFRKNMFA  170



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 6/72 (8%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  428
            VTG KRGFSETVDLKLNL +  +S+   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  429  PPVRNYRKNIMA  464
            PPVR+YRKN+M 
Sbjct  87   PPVRSYRKNVMG  98



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 6/72 (8%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  428
            VTG KRGFSETVDLKLNL +  +S+   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  429  PPVRNYRKNIMA  464
            PPVR+YRKN+M 
Sbjct  87   PPVRSYRKNVMG  98



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 6/71 (8%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  431
            KVTGKRGF +TVDLKL LQS  D S   +E + +PS +    P K   KPPSKAQVVGWP
Sbjct  14   KVTGKRGFFQTVDLKLKLQS--DQSDLEEENLTTPSSDKPHLPPKHLSKPPSKAQVVGWP  71

Query  432  PVRNYRKNIMA  464
            PVR++RKN++ 
Sbjct  72   PVRSFRKNVIC  82



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSSL-DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRN  443
            V  KRGFSETVDLKLNLQ+  +  + DL            KD  KPP+KAQVVGWPPVRN
Sbjct  38   VGNKRGFSETVDLKLNLQTNEEGRVVDLNAGDPKNFAGATKDKNKPPAKAQVVGWPPVRN  97

Query  444  YRKNIMA  464
            YRKN+MA
Sbjct  98   YRKNMMA  104



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  26   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  80

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  81   QVVGWPPVRSYRKNVMV  97



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  82   QVVGWPPVRSYRKNVMV  98



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGWPPVR  440
            KRGFSETVDLKLNL +  +S    K  + + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  441  NYRKNIMA  464
            +YRKN+M 
Sbjct  86   SYRKNVMG  93



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGWPPVR  440
            KRGFSETVDLKLNL +  +S    K  + + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  441  NYRKNIMA  464
            +YRKN+M 
Sbjct  86   SYRKNVMG  93



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  82   QVVGWPPVRSYRKNVMV  98



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  82   QVVGWPPVRSYRKNVMV  98



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  246  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  419
            NE E + K  GKR FSETVDLKLNL S+ DS++D + +KMK        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDKMKEKKNIAPTDPSKPPAKAQV  91

Query  420  VGWPPVRNYRKNIM  461
            VGWPPVR++RKN++
Sbjct  92   VGWPPVRSFRKNVL  105



>gb|KDP21369.1| hypothetical protein JCGZ_21840 [Jatropha curcas]
Length=251

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSS-LDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRN  443
            KRGFS+TVDL+LN+ S  +S+  D  +K K+  +E N    DP KPP+KAQVVGWPPVR+
Sbjct  39   KRGFSQTVDLELNISSKEESAAFDPNQKTKNLPREKNLLAADPAKPPAKAQVVGWPPVRS  98

Query  444  YRKNIMA  464
            YRKN++A
Sbjct  99   YRKNMLA  105



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 15/77 (19%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +  ++          + D K+K+ S  K    DP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKISSCPK----DPAKPPAKA  82

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN+M 
Sbjct  83   QVVGWPPVRSYRKNVMV  99



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  446
            KRGFSETVDLKL L S    +    EK +S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKERGAGPNHEKTRSLQREKNILATDPAKPPAKAQVVGWPPVRSF  93

Query  447  RKNIMA  464
            RKN++A
Sbjct  94   RKNMLA  99



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 17/75 (23%)
 Frame = +3

Query  258  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  419
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR++RKN+M+
Sbjct  72   VGWPPVRSFRKNVMS  86



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPNK---DPIKPPSKAQVVGWPPVR  440
            KRGFSETVDLKLNL +  +S    K  + + S SK+ NK   DP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVR  85

Query  441  NYRKNIMA  464
            +YRKN+M 
Sbjct  86   SYRKNVMG  93



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 11/72 (15%)
 Frame = +3

Query  258  SLKVTGKRGFSETVDLKLNLQSAA---DSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  428
            ++K  GKRGFSETVDLKLNL S A    S +DL E MK       +  +KPP+KAQVVGW
Sbjct  83   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDL-ENMK-------EKVVKPPAKAQVVGW  134

Query  429  PPVRNYRKNIMA  464
            PPVR++RKN+M+
Sbjct  135  PPVRSFRKNVMS  146



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 17/73 (23%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KYNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKV-----------VKPPAKAQVVG  73

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKN+M+
Sbjct  74   WPPVRSFRKNVMS  86



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 17/75 (23%)
 Frame = +3

Query  258  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  419
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTAMDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR++RKN+M+
Sbjct  72   VGWPPVRSFRKNVMS  86



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 52/87 (60%), Gaps = 17/87 (20%)
 Frame = +3

Query  252  SESLKVTGKRGFSET----VDLKLNLQS-------------AADSSLDLKEKMKSPSKEP  380
            + S   TGKRGFS+T    VDLKLNL S             A D++        +PS  P
Sbjct  41   TSSASFTGKRGFSDTTTASVDLKLNLSSTSNNVSATPSSDMAKDNTASAAANTTTPSSPP  100

Query  381  NKDPIKPPSKAQVVGWPPVRNYRKNIM  461
             KDP KPP+KAQVVGWPPVR++RKNI+
Sbjct  101  VKDPAKPPAKAQVVGWPPVRSFRKNIV  127



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 6/72 (8%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  428
            VTG KRGFSETVDLKLNL +  + +   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPEINEGSKPHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  429  PPVRNYRKNIMA  464
            PPVR+YRKN+M 
Sbjct  87   PPVRSYRKNVMG  98



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  446
            KRGFSETVDLKL L S    +    EK  S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKESGADPNHEKTSSLQREKNLLATDPAKPPAKAQVVGWPPVRSF  93

Query  447  RKNIMA  464
            RKN++A
Sbjct  94   RKNMLA  99



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 5/77 (6%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN----KDPIKPPSKA  413
            N +   +V  KRGFSETVDLKLNL S+ +  +D  +  K+ S+E N     DP KPP+KA
Sbjct  35   NTASEGEVARKRGFSETVDLKLNL-SSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKA  93

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR++RK+++ 
Sbjct  94   QVVGWPPVRSFRKHMLT  110



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 69/112 (62%), Gaps = 26/112 (23%)
 Frame = +3

Query  162  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS-  335
            MGS+     GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL S  +S 
Sbjct  166  MGSV-----GLNLRETELCLGLPGGDTAS-----PVTGTKRGFSETVDLKLNLNSEPESK  215

Query  336  ---------SLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                     S   KEK   P     KDP KP +KAQVVGWPPVR+YRKN+M 
Sbjct  216  EGSKSHDVVSAVFKEKSSCP-----KDPTKPLAKAQVVGWPPVRSYRKNVMG  262



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 17/70 (24%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  434
            GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTAMGSVSEVDLVNMKEKV-----------VKPPAKAQVVGWPP  76

Query  435  VRNYRKNIMA  464
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 17/73 (23%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMDSVSELDLVNMKEKV-----------VKPPAKAQVVG  73

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKN+M+
Sbjct  74   WPPVRSFRKNVMS  86



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 17/102 (17%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA----------DSSL  341
            LN +ATEL LG PG    N   + K  GKRGFSETVDLKLNL   A          D+ +
Sbjct  7    LNFEATELRLGPPG----NGDSAGKGIGKRGFSETVDLKLNLMEPAPLDVPASTVKDTGV  62

Query  342  DLKEKMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMA  464
            DL EK++  +     DP KPP+ KAQVVGWPPVR++R+N++A
Sbjct  63   DLTEKLRGSNAV--ADPAKPPAHKAQVVGWPPVRSFRRNMLA  102



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  246  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  419
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR++RKN++ 
Sbjct  92   VGWPPVRSFRKNVLT  106



>ref|XP_004156465.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16-like 
[Cucumis sativus]
Length=239

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNLQSAADSS-----LDLKEKMKSPSKEPNKDPIKPPSKAQVVGWP  431
            + GKRGF ETVDLKLNL S   S+      +  +++K+ S++PN D  KPPSKAQVVGWP
Sbjct  37   LAGKRGFMETVDLKLNLASKWASAKGRGPTEFGKRLKTSSQQPN-DXAKPPSKAQVVGWP  95

Query  432  PVRNYRKNI  458
            PVR+ RKN+
Sbjct  96   PVRSSRKNL  104



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 53/84 (63%), Gaps = 12/84 (14%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNLQS---AADSSLDL--------KEKMKSPSKEPNKDPI  395
            + E+ K  GKRGFSETVDLKLN+ S   +AD S D         +EK  +       DP 
Sbjct  37   DGEAAKNNGKRGFSETVDLKLNISSQDQSADRSADQDQQLMELKREKNAAAPAPSANDPS  96

Query  396  KPP-SKAQVVGWPPVRNYRKNIMA  464
            KPP SKAQVVGWPPVR++RKNI+ 
Sbjct  97   KPPASKAQVVGWPPVRSFRKNIVT  120



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  246  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  419
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR++RKN++ 
Sbjct  92   VGWPPVRSFRKNVLT  106



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 17/73 (23%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKV-----------VKPPAKAQVVG  73

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKN+M+
Sbjct  74   WPPVRSFRKNVMS  86



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 17/70 (24%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  434
            GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVGWPP  76

Query  435  VRNYRKNIMA  464
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 17/70 (24%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  434
            GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVGWPP  76

Query  435  VRNYRKNIMA  464
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVV  422
            + T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVV
Sbjct  30   EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVV  89

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKNIM+
Sbjct  90   GWPPVRSFRKNIMS  103



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 52/78 (67%), Gaps = 17/78 (22%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPPSK  410
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP+K
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  411  AQVVGWPPVRNYRKNIMA  464
            AQVVGWPPVR+YRKN++ 
Sbjct  82   AQVVGWPPVRSYRKNVLV  99



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 10/91 (11%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  371
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  372  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                +  +KPP+K QVVGWPPVR++RKN+M+
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMS  82



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 10/91 (11%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  371
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  372  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                +  +KPP+K QVVGWPPVR++RKN+M+
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMS  82



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 7/74 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVV  422
            + T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVV
Sbjct  30   EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVV  89

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKNIM+
Sbjct  90   GWPPVRSFRKNIMS  103



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 47/69 (68%), Gaps = 11/69 (16%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  437
            KRGFSETVDLKLNL     SS D  EK+KS  KE N        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKNPLPRATDPPAKPPAKTQVVGWPPV  87

Query  438  RNYRKNIMA  464
            R++RKN++ 
Sbjct  88   RSFRKNMLG  96



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 10/91 (11%)
 Frame = +3

Query  192  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  371
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  372  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
                +  +KPP+K QVVGWPPVR++RKN+M+
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMS  82



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNLQSAADSSLD-------LKEKMKSPSKEPNKDPIKPPS  407
            + E+ K TGKRGF+ETVDLKLN+ S   S+ D        KEK  +P    N +P KPP+
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVEEMKKEKNVAPVPRSN-NPTKPPA  96

Query  408  -KAQVVGWPPVRNYRKNIMA  464
             KAQ VGWPPVR++RKNI+A
Sbjct  97   AKAQAVGWPPVRSFRKNILA  116



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  456  IMA  464
            ++A
Sbjct  96   MLA  98



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNL----QSAADSS--LDLK-EKMKSPSKEPNKDPIKP-P  404
            + E+ K TGKRGF+ETVDLKLN+    QSA D    +D+K EK  +P    N DP KP  
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVVDMKKEKDVAPVPRSN-DPTKPHA  96

Query  405  SKAQVVGWPPVRNYRKNIMA  464
            +KAQVVGWPPVR++R NI+A
Sbjct  97   AKAQVVGWPPVRSFRXNILA  116



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 49/77 (64%), Gaps = 16/77 (21%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  413
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWP VR+YRKN+M 
Sbjct  82   QVVGWPLVRSYRKNVMV  98



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  456  IMA  464
            ++A
Sbjct  96   MLA  98



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  456  IMA  464
            ++A
Sbjct  96   MLA  98



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  456  IMA  464
            ++A
Sbjct  96   MLA  98



>gb|KDO48908.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=171

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 53/81 (65%), Gaps = 11/81 (14%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNLQSAADSS---------LDLK-EKMKSPSKEPNKDPIK  398
            + E+ K  GKRGFSETVDLKLN+ S  +++         L+LK EK  +       DP K
Sbjct  81   DGEAAKNNGKRGFSETVDLKLNISSQDETADEDDQDQQLLELKKEKNAAAPAPGANDPSK  140

Query  399  PP-SKAQVVGWPPVRNYRKNI  458
            PP SKAQVVGWPPVR++RKNI
Sbjct  141  PPASKAQVVGWPPVRSFRKNI  161



>ref|XP_006471686.1| PREDICTED: auxin-responsive protein IAA16-like isoform X3 [Citrus 
sinensis]
Length=217

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 9/67 (13%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRN  443
            K  GKRGFSETVDLKLNL S   S ++L E MK       +  +KPP+KAQVVGWPPVR+
Sbjct  25   KNNGKRGFSETVDLKLNLSSTV-SEVEL-ENMK-------EKVVKPPAKAQVVGWPPVRS  75

Query  444  YRKNIMA  464
            +RKN+M+
Sbjct  76   FRKNVMS  82



>ref|XP_006432921.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 gb|ESR46161.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=213

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>gb|EPS60474.1| hypothetical protein M569_14329, partial [Genlisea aurea]
Length=212

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +3

Query  270  TGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYR  449
             GKRGF+ETVDLKLNL +A + +LD KEK K  + + + D  KPP KAQVVGWPPVR +R
Sbjct  28   CGKRGFAETVDLKLNL-AAKEMNLD-KEKEKKKNLQISADSSKPPMKAQVVGWPPVRAFR  85

Query  450  KNIMA  464
            +N + 
Sbjct  86   RNAIC  90



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>ref|XP_010923479.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Elaeis 
guineensis]
Length=232

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 9/76 (12%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  416
            K +GKRGFSET+DLKL L +  DS    +++ +KMK    + N      DP KP + KAQ
Sbjct  37   KNSGKRGFSETIDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQ  96

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR++RKNI+A
Sbjct  97   VVGWPPVRSFRKNILA  112



>gb|KGN60808.1| hypothetical protein Csa_2G010920 [Cucumis sativus]
Length=237

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF ETVDLKLNL S+  S+ +     E++K+ S++PN D  KPPSKAQVVGWPPVR+ 
Sbjct  40   KRGFMETVDLKLNLASSMASTKEEATNLEEIKTSSQQPN-DFAKPPSKAQVVGWPPVRSS  98

Query  447  RKNI  458
            RKN+
Sbjct  99   RKNL  102



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 6/76 (8%)
 Frame = +3

Query  255  ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK-SPSKE----PNKDPIKPPS-KAQ  416
            ++ K +GKR F ETVDLKL LQ+  D      EKMK SPS +       DP +P + KAQ
Sbjct  35   DATKNSGKRAFEETVDLKLKLQTTVDVEEVAAEKMKRSPSHKNVAASATDPERPRAPKAQ  94

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR+YRKNI+A
Sbjct  95   VVGWPPVRSYRKNILA  110



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 9/76 (12%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  416
            K +GKRGFSET+DLKL L +  DS    +++ +KMK    + N      DP KP + KAQ
Sbjct  37   KNSGKRGFSETIDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQ  96

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR++RKNI+A
Sbjct  97   VVGWPPVRSFRKNILA  112



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 11/69 (16%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  437
            KRGFSETVDLKLNL     SS D  EK+KS  KE +        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPV  87

Query  438  RNYRKNIMA  464
            R++RKN++ 
Sbjct  88   RSFRKNMLG  96



>ref|XP_006432922.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471685.1| PREDICTED: auxin-responsive protein IAA16-like isoform X2 [Citrus 
sinensis]
 gb|ESR46162.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=221

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 9/69 (13%)
 Frame = +3

Query  285  FSETVDLKLNLQSAADSS---LDLKEKMK-SPSKE----PNKDPIKPPS-KAQVVGWPPV  437
            FSET+DLKL LQ+ ADS    +++ EKMK SPS +       DP KPP+ KAQVVGWPPV
Sbjct  35   FSETIDLKLKLQTVADSKEVVMEVSEKMKRSPSHKNILPCTNDPEKPPAPKAQVVGWPPV  94

Query  438  RNYRKNIMA  464
            R++RKN+MA
Sbjct  95   RSFRKNMMA  103



>gb|KDO48906.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=217

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 11/69 (16%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  437
            KRGFSETVDLKLNL     SS D  EK+KS  KE +        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPV  87

Query  438  RNYRKNIMA  464
            R++RKN++ 
Sbjct  88   RSFRKNMLG  96



>gb|KDO48907.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=213

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 17/70 (24%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  434
            GKRGFSETVDLKLNL S A  S+      +LK K+           +KPP+K QVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTALDSVSEVDIQNLKGKV-----------VKPPAKTQVVGWPP  76

Query  435  VRNYRKNIMA  464
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>gb|KDO48904.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=221

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  447  RKNIMA  464
            RKNIMA
Sbjct  102  RKNIMA  107



>ref|XP_008455992.1| PREDICTED: auxin-responsive protein IAA16 isoform X2 [Cucumis 
melo]
Length=231

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF ETVDLKLNL S+  S+ +     E++KS S++PN D  KPPSK QVVGWPPVR+ 
Sbjct  41   KRGFMETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPN-DFAKPPSKTQVVGWPPVRSS  99

Query  447  RKNI  458
            RKN+
Sbjct  100  RKNL  103



>ref|XP_008455985.1| PREDICTED: auxin-responsive protein IAA16 isoform X1 [Cucumis 
melo]
Length=236

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  446
            KRGF ETVDLKLNL S+  S+ +     E++KS S++PN D  KPPSK QVVGWPPVR+ 
Sbjct  41   KRGFMETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPN-DFAKPPSKTQVVGWPPVRSS  99

Query  447  RKNI  458
            RKN+
Sbjct  100  RKNL  103



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 51/92 (55%), Gaps = 26/92 (28%)
 Frame = +3

Query  267  VTGKRGFSETVDLKLNL------------------QSAADSSLDLKEKM--------KSP  368
            V  KRGFSETVDLKLN                   Q+A  + LDL +          K  
Sbjct  49   VGNKRGFSETVDLKLNFSTNNNKNDHNNNINSGKEQTATSAPLDLMKNDNKADVSADKEI  108

Query  369  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  464
            S + N D +KPP+KAQVVGWPPVR+YRKN++A
Sbjct  109  SSKVNADSVKPPAKAQVVGWPPVRSYRKNMLA  140



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 8/67 (12%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQS-AADS-SLDLKEKMKSPSKEPNKDPIKPPSKAQV  419
            +E ++ K  GKRGFSETVDLKLNL S A DS S+D  EKMK       K  +KPP+K+QV
Sbjct  18   HEEKAAKNNGKRGFSETVDLKLNLSSMATDSGSMDGSEKMKE------KTTVKPPAKSQV  71

Query  420  VGWPPVR  440
            VGWPPVR
Sbjct  72   VGWPPVR  78



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 6/70 (9%)
 Frame = +3

Query  273  GKRGFSETVDLKLNLQSAADSSLDLKE-KMKSPSKEPNKDP-----IKPPSKAQVVGWPP  434
            GKRGF+ETVDLKL L S     LD    + K   KE N  P      +PP+KAQVVGWPP
Sbjct  40   GKRGFAETVDLKLKLSSKEIGDLDRGGLERKDLCKEKNLMPSPTESARPPAKAQVVGWPP  99

Query  435  VRNYRKNIMA  464
            VR++RKN+MA
Sbjct  100  VRSFRKNVMA  109



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 18/86 (21%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNK-------------D  389
            ++E++K +GKRGF+ETVDLKL LQ+     +D+KE +   + E  K             D
Sbjct  25   DAEAVKNSGKRGFAETVDLKLQLQTP----VDVKEAVAEAASEKVKRSVSQKSLVSCGSD  80

Query  390  PIKPPS-KAQVVGWPPVRNYRKNIMA  464
            P KP + KAQVVGWPPVR++RKNI++
Sbjct  81   PEKPSAPKAQVVGWPPVRSFRKNILS  106



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 71/101 (70%), Gaps = 8/101 (8%)
 Frame = +3

Query  186  GGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS  365
            G L L+ TEL LGLPGGGGG E+E+ K + KRGF+ET+DLKL LQ+  D+   + EK + 
Sbjct  4    GSLGLEETELRLGLPGGGGGGEAEAAKNSCKRGFAETIDLKLKLQTPVDAEEQIIEKARG  63

Query  366  --PSKE-----PNKDPIKPPS-KAQVVGWPPVRNYRKNIMA  464
              PS+         DP KPP+ KAQVVGWPPVR++RKNI++
Sbjct  64   SLPSQRNLGVFCGSDPEKPPAPKAQVVGWPPVRSFRKNILS  104



>ref|XP_006575865.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
Length=170

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +3

Query  276  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  416
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR++RKN+ A
Sbjct  96   VVGWPPVRSFRKNMFA  111



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNL----QSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQ  416
            E+ +     KRG+SETVDLKLNL    ++  + SL  KE   S   + +  P  PP+KAQ
Sbjct  14   ETTATVAGNKRGYSETVDLKLNLNNEPETNKEGSLVSKENTSSICPKDSTKP--PPAKAQ  71

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR+YRKN+M+
Sbjct  72   VVGWPPVRSYRKNVMS  87



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  144  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  323
            MEVG KMG M  E   +  K  E                 +V  KR FS TVDLKLNL S
Sbjct  1    MEVGVKMG-MKGEGDEVGGKEKEKMGYEETELRLGLPGDGEVVRKRDFSHTVDLKLNLIS  59

Query  324  AADSSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVRNYRKNIMA  464
               S  D K+K   PS   + DP KPP +KAQVVGWPPVR++RKN++A
Sbjct  60   T--SPTDDKDKNIVPS---HLDPAKPPPAKAQVVGWPPVRSFRKNMLA  102



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 20/81 (25%)
 Frame = +3

Query  267  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPP--  404
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP  
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  405  -SKAQVVGWPPVRNYRKNIMA  464
             S+AQVVGWPPVR+YRKN++ 
Sbjct  82   ISRAQVVGWPPVRSYRKNVLV  102



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +3

Query  270  TGKRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPN-----KDPIKPPS-KAQVV  422
            T KRGFS+T+DLKL L++    S D K   EKMK  + + N      DP KPP+ KAQVV
Sbjct  32   TKKRGFSKTIDLKLKLRTV--DSKDAKPEAEKMKRSASQKNLLACSSDPEKPPAPKAQVV  89

Query  423  GWPPVRNYRKNIMA  464
            GWPPVR++RKNIM+
Sbjct  90   GWPPVRSFRKNIMS  103



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +3

Query  276  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  416
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR++RKN+ A
Sbjct  96   VVGWPPVRSFRKNMFA  111



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 49/76 (64%), Gaps = 13/76 (17%)
 Frame = +3

Query  276  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  416
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  417  VVGWPPVRNYRKNIMA  464
            VVGWPPVR++RKN+ A
Sbjct  96   VVGWPPVRSFRKNMFA  111



>ref|XP_009398379.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=253

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 9/75 (12%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK---SPSK----EPNKDPIKPPS-KAQV  419
            K +GKR F+ET+DLKL LQ+A D+  D+   +K   SPS+        DP KPP+ KAQV
Sbjct  39   KNSGKRAFAETIDLKLKLQAAGDTK-DMAAALKMKRSPSQMSIAASATDPEKPPAPKAQV  97

Query  420  VGWPPVRNYRKNIMA  464
            VGWPPVR++R++++A
Sbjct  98   VGWPPVRSHRRSMLA  112



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 6/68 (9%)
 Frame = +3

Query  264  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVR  440
            +V  KR FS TVDLKLNL S   S  D K+K   PS   + DP KPP +KAQVVGWPPVR
Sbjct  40   EVVRKRDFSHTVDLKLNLIST--SPTDDKDKNIVPS---HLDPAKPPPAKAQVVGWPPVR  94

Query  441  NYRKNIMA  464
            ++RKN++A
Sbjct  95   SFRKNMLA  102



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 11/83 (13%)
 Frame = +3

Query  246  NESESLKVTG-KRGFSET--VDLKLNLQSAADSSLDLK-----EKMKSPSKEP---NKDP  392
            NES ++K +G KRGFSET  VDLKLNL S+ DS+ D       EK  + +  P     DP
Sbjct  22   NESTTVKGSGGKRGFSETASVDLKLNLSSSDDSASDSPSSASTEKTTTAAPPPPSRANDP  81

Query  393  IKPPSKAQVVGWPPVRNYRKNIM  461
             KPP+KAQVVGWPPVR++RKNI+
Sbjct  82   AKPPAKAQVVGWPPVRSFRKNIV  104



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 15/63 (24%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGF ET+D KLN  S               + E   D +KPP+KAQVVGWPPVR++RKN
Sbjct  32   KRGFEETLDFKLNFAS---------------NGENINDSVKPPAKAQVVGWPPVRSFRKN  76

Query  456  IMA  464
            IMA
Sbjct  77   IMA  79



>ref|XP_009417112.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 9/81 (11%)
 Frame = +3

Query  249  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPI--------KP-  401
            E ES K +GKRGF E VDLKL LQ+         E  +   + PN D I        KP 
Sbjct  29   EVESGKNSGKRGFVEIVDLKLQLQTPVGVQEAAAEAAEKVKRSPNDDSIVSCGSDPEKPS  88

Query  402  PSKAQVVGWPPVRNYRKNIMA  464
            P KAQVVGWPPVR++RKNI++
Sbjct  89   PPKAQVVGWPPVRSFRKNILS  109



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 14/73 (19%)
 Frame = +3

Query  270  TGKRGFSETVDLKLNL--------QSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  425
            +GKRGFSETVDLKLN         +S  D  +++K K K  S  P      P +KAQVVG
Sbjct  48   SGKRGFSETVDLKLNFSSENDDVSRSGRDGQVEIK-KEKDASAAP-----APRAKAQVVG  101

Query  426  WPPVRNYRKNIMA  464
            WPPVR++RKNI+A
Sbjct  102  WPPVRSFRKNIVA  114



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 13/76 (17%)
 Frame = +3

Query  273  GKRGFSET--VDLKLNLQSAADSSLDL-----------KEKMKSPSKEPNKDPIKPPSKA  413
             KRGFSET  VDLKLNL S  + S              + K  +    P  DP KPP+KA
Sbjct  25   AKRGFSETASVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPANDPAKPPAKA  84

Query  414  QVVGWPPVRNYRKNIM  461
            QVVGWPPVR++RKNI+
Sbjct  85   QVVGWPPVRSFRKNIV  100



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 13/76 (17%)
 Frame = +3

Query  273  GKRGFSET--VDLKLNLQSAADSSLDL-----------KEKMKSPSKEPNKDPIKPPSKA  413
             KRGFSET  VDLKLNL S  + S              + K  +    P  DP KPP+KA
Sbjct  25   AKRGFSETASVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPANDPAKPPAKA  84

Query  414  QVVGWPPVRNYRKNIM  461
            QVVGWPPVR++RKNI+
Sbjct  85   QVVGWPPVRSFRKNIV  100



>ref|XP_010522504.1| PREDICTED: auxin-responsive protein IAA17-like [Tarenaya hassleriana]
Length=235

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 42/68 (62%), Gaps = 5/68 (7%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK---EPNKDPI--KPPSKAQVVGWPPVR  440
            KRGFSETVDLKLNL +     +      + PS     PN      KPP+KAQVVGWPPVR
Sbjct  32   KRGFSETVDLKLNLNNEPHKDVGSALSEQDPSSLVSVPNDSSSCPKPPAKAQVVGWPPVR  91

Query  441  NYRKNIMA  464
             YRKN+M 
Sbjct  92   TYRKNMMG  99



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 47/79 (59%), Gaps = 12/79 (15%)
 Frame = +3

Query  264  KVTGKRGFSET------VDLKLNLQS------AADSSLDLKEKMKSPSKEPNKDPIKPPS  407
            +V  KRGFSET      VDL LNL S       AD S   K  ++        DP KPP+
Sbjct  38   EVVRKRGFSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPA  97

Query  408  KAQVVGWPPVRNYRKNIMA  464
            KAQVVGWPPVR++RKN++A
Sbjct  98   KAQVVGWPPVRSFRKNMLA  116



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 47/78 (60%), Gaps = 17/78 (22%)
 Frame = +3

Query  276  KRGFSETV-DLKLNLQSAADSSLDLKEKMKSPSKEPN--------------KDPIKPPSK  410
            KRGFSETV DLKLNL +      DL     +  K+P+              KDP KPP+K
Sbjct  33   KRGFSETVVDLKLNLNNEPRDHKDLGSV--TTEKDPSSLAAVPADNSSSCPKDPSKPPAK  90

Query  411  AQVVGWPPVRNYRKNIMA  464
            AQVVGWPPVR+YRKN+ A
Sbjct  91   AQVVGWPPVRSYRKNMTA  108



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 47/79 (59%), Gaps = 16/79 (20%)
 Frame = +3

Query  276  KRGFSET-------VDLKLNLQ------SAADSSLDLKEKMKSPSKEPNK---DPIKPPS  407
            KRGFSET       VDL LNL       +A     D +E  K+  KE N    DP KPP+
Sbjct  35   KRGFSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPA  94

Query  408  KAQVVGWPPVRNYRKNIMA  464
            KAQVVGWPPVR++RKN+ A
Sbjct  95   KAQVVGWPPVRSFRKNMFA  113



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 11/83 (13%)
 Frame = +3

Query  246  NESESLKVTG-KRGFSET--VDLKLNLQSAADSSLDLK-----EKMKSPSKEP---NKDP  392
            NES ++K +G KRGF ET  VDLKLNL S+ DS+ D       EK  + +  P     DP
Sbjct  22   NESTTVKGSGGKRGFPETASVDLKLNLSSSDDSASDSPSSASTEKTTTAAPLPPSRANDP  81

Query  393  IKPPSKAQVVGWPPVRNYRKNIM  461
             KPP+KAQVVGWPPVR++RKNI+
Sbjct  82   AKPPAKAQVVGWPPVRSFRKNIV  104



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 8/62 (13%)
 Frame = +3

Query  279  RGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNI  458
            RGFS+TVDL  N     D   D+K+     SK    D +KPP+KAQVVGWPPVR+YRKN+
Sbjct  48   RGFSDTVDLMKN-----DKKADVKD---VCSKVVVTDSVKPPAKAQVVGWPPVRSYRKNV  99

Query  459  MA  464
            M 
Sbjct  100  MT  101



>gb|AFK36684.1| unknown [Lotus japonicus]
Length=190

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 12/79 (15%)
 Frame = +3

Query  264  KVTGKRGFSET------VDLKLNLQS------AADSSLDLKEKMKSPSKEPNKDPIKPPS  407
            +V  KRGFSET      VDL LNL S       AD S   K  ++        DP KPP+
Sbjct  38   EVVRKRGFSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPA  97

Query  408  KAQVVGWPPVRNYRKNIMA  464
            KA+VVGWPPVR++RKN++A
Sbjct  98   KARVVGWPPVRSFRKNMLA  116



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +3

Query  267  VTGKRGFSET------VDLKLNLQSAAD--SSLDLKEKMKSPSKEPN---KDPIKPPSKA  413
            V  KRGFSET      +DL LNL +  +  S +D  +  K   KE      DP KPP+KA
Sbjct  35   VVRKRGFSETETQDHTMDLMLNLSTNKEPTSEVDPIDNTKILQKENTLLPADPAKPPAKA  94

Query  414  QVVGWPPVRNYRKNIMA  464
            QVVGWPPVR+YRKN++A
Sbjct  95   QVVGWPPVRSYRKNMLA  111



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 9/63 (14%)
 Frame = +3

Query  276  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  455
            KRGFS+TVDLKLNL + + +  +      S         +KPP+KAQVVGWPPVR++RKN
Sbjct  25   KRGFSQTVDLKLNLDNPSININNTSSNNDS---------LKPPTKAQVVGWPPVRSFRKN  75

Query  456  IMA  464
            IM+
Sbjct  76   IMS  78



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +3

Query  246  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN----KDPIKPPS  407
            +E+ES ++T     S  VDLKLNL S   SS   K K  M + +KE N     DP KPP+
Sbjct  39   SETES-QITTDDESSACVDLKLNLSSKDGSSTAEKSKSLMMNKNKEKNVDLPADPAKPPA  97

Query  408  KAQVVGWPPVRNYRKNIMA  464
            KAQVVGWPPVR++RKN+++
Sbjct  98   KAQVVGWPPVRSFRKNMLS  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750