BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF017J01

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1  97.8    1e-20   Elaeis guineensis
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...  97.4    2e-20   
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...  97.1    3e-20   Elaeis guineensis
ref|XP_010912524.1|  PREDICTED: transmembrane 9 superfamily membe...  95.1    7e-20   
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...  95.1    9e-20   Sesamum indicum [beniseed]
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member       94.7    1e-19   Medicago truncatula
ref|XP_007221993.1|  hypothetical protein PRUPE_ppa003254mg           94.4    2e-19   Prunus persica
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                  94.4    2e-19   Gossypium arboreum [tree cotton]
gb|KJB79238.1|  hypothetical protein B456_013G038900                  94.4    2e-19   Gossypium raimondii
gb|KJB12212.1|  hypothetical protein B456_002G006200                  94.4    2e-19   Gossypium raimondii
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...  94.0    3e-19   Phoenix dactylifera
ref|XP_008218557.1|  PREDICTED: transmembrane 9 superfamily member 3  93.6    3e-19   Prunus mume [ume]
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...  93.6    3e-19   Setaria italica
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...  93.6    3e-19   Phoenix dactylifera
emb|CDY44835.1|  BnaCnng11910D                                        89.0    3e-19   Brassica napus [oilseed rape]
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500        93.2    5e-19   Sorghum bicolor [broomcorn]
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...  93.2    5e-19   Brachypodium distachyon [annual false brome]
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240        92.8    6e-19   Sorghum bicolor [broomcorn]
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...  92.8    6e-19   Cicer arietinum [garbanzo]
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...  92.8    6e-19   Cicer arietinum [garbanzo]
ref|XP_010101151.1|  Transmembrane 9 superfamily member 3             92.8    6e-19   
gb|KDP38816.1|  hypothetical protein JCGZ_04973                       92.8    7e-19   Jatropha curcas
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3  92.8    7e-19   Eucalyptus grandis [rose gum]
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...  92.8    7e-19   Setaria italica
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...  92.4    8e-19   Zea mays [maize]
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...  92.4    8e-19   Elaeis guineensis
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...  92.4    9e-19   Elaeis guineensis
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...  92.4    1e-18   Zea mays [maize]
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg           92.4    1e-18   Citrus clementina [clementine]
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...  92.4    1e-18   Citrus sinensis [apfelsine]
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...  92.4    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...  92.4    1e-18   Nicotiana tomentosiformis
gb|AFW71773.1|  hypothetical protein ZEAMMB73_948581                  91.7    1e-18   
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    1e-18   Nicotiana sylvestris
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1  92.0    1e-18   Fragaria vesca subsp. vesca
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                  92.0    1e-18   Arabis alpina [alpine rockcress]
gb|KCW57093.1|  hypothetical protein EUGRSUZ_I02743                   91.7    1e-18   Eucalyptus grandis [rose gum]
gb|KDO50082.1|  hypothetical protein CISIN_1g012251mg                 91.3    1e-18   Citrus sinensis [apfelsine]
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...  92.0    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    2e-18   Nicotiana sylvestris
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    2e-18   
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg           91.7    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730        91.7    2e-18   Sorghum bicolor [broomcorn]
ref|XP_008667101.1|  PREDICTED: uncharacterized protein LOC100192...  91.7    2e-18   
gb|ACG29787.1|  transmembrane 9 superfamily protein member 3 prec...  91.7    2e-18   Zea mays [maize]
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...  91.7    2e-18   Brassica rapa
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969            91.7    2e-18   
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                  91.3    2e-18   Glycine soja [wild soybean]
emb|CDY03772.1|  BnaC01g28890D                                        91.3    2e-18   
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...  91.3    3e-18   Setaria italica
gb|KJB47458.1|  hypothetical protein B456_008G027700                  91.3    3e-18   Gossypium raimondii
gb|KJB47460.1|  hypothetical protein B456_008G027700                  90.9    3e-18   Gossypium raimondii
ref|XP_007042269.1|  Transmembrane nine 1                             91.3    3e-18   
gb|KJB77692.1|  hypothetical protein B456_012G151500                  90.9    3e-18   Gossypium raimondii
gb|KHG20578.1|  Tm9sf3                                                91.3    3e-18   Gossypium arboreum [tree cotton]
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...  90.9    3e-18   
gb|KHG27380.1|  Tm9sf3                                                90.9    3e-18   Gossypium arboreum [tree cotton]
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  90.9    3e-18   Malus domestica [apple tree]
gb|KHG20579.1|  Tm9sf3                                                90.9    4e-18   Gossypium arboreum [tree cotton]
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1  90.9    4e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB77693.1|  hypothetical protein B456_012G151500                  90.5    4e-18   Gossypium raimondii
ref|XP_008781557.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    4e-18   
gb|KHG16990.1|  Transmembrane 9 superfamily member 3                  88.2    4e-18   Gossypium arboreum [tree cotton]
gb|KJB47461.1|  hypothetical protein B456_008G027700                  90.5    4e-18   Gossypium raimondii
gb|EMT15069.1|  Transmembrane 9 superfamily member 3                  90.5    4e-18   
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...  90.5    5e-18   Brachypodium distachyon [annual false brome]
ref|NP_001066292.1|  Os12g0175700                                     90.1    5e-18   
ref|XP_008781558.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    6e-18   Phoenix dactylifera
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...  90.1    7e-18   Glycine max [soybeans]
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    8e-18   Pyrus x bretschneideri [bai li]
dbj|BAJ96423.1|  predicted protein                                    89.7    8e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86318.1|  predicted protein                                    89.7    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY46193.1|  BnaA01g23150D                                        89.4    9e-18   Brassica napus [oilseed rape]
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...  89.7    9e-18   Solanum lycopersicum
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...  89.4    1e-17   Solanum tuberosum [potatoes]
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3  89.4    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...  89.4    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAX96186.1|  Endomembrane protein 70                               89.4    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...  88.6    1e-17   Nelumbo nucifera [Indian lotus]
ref|NP_001065897.1|  Os11g0181100                                     89.0    1e-17   
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    1e-17   Nicotiana tomentosiformis
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    1e-17   
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...  88.6    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350        88.6    2e-17   Amborella trichopoda
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...  88.6    2e-17   Solanum lycopersicum
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...  88.2    3e-17   Glycine max [soybeans]
ref|NP_001131352.1|  uncharacterized protein LOC100192672 precursor   87.0    3e-17   
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                  88.2    3e-17   Glycine soja [wild soybean]
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...  88.2    3e-17   Solanum tuberosum [potatoes]
emb|CDY20592.1|  BnaC08g14660D                                        87.8    4e-17   Brassica napus [oilseed rape]
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3  87.8    4e-17   Nelumbo nucifera [Indian lotus]
emb|CDY19333.1|  BnaC05g08420D                                        87.8    4e-17   Brassica napus [oilseed rape]
emb|CDY20974.1|  BnaA08g25510D                                        87.8    4e-17   Brassica napus [oilseed rape]
emb|CDX94774.1|  BnaC07g17830D                                        87.8    4e-17   
emb|CAN77106.1|  hypothetical protein VITISV_037096                   87.8    4e-17   Vitis vinifera
gb|KJB79240.1|  hypothetical protein B456_013G038900                  87.4    5e-17   Gossypium raimondii
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...  87.4    5e-17   Tarenaya hassleriana [spider flower]
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg           87.4    5e-17   Eutrema salsugineum [saltwater cress]
emb|CDY14555.1|  BnaC03g49040D                                        87.0    7e-17   Brassica napus [oilseed rape]
dbj|BAJ87519.1|  predicted protein                                    87.0    7e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...  87.0    7e-17   Brassica rapa
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                  86.7    9e-17   Arabis alpina [alpine rockcress]
emb|CDY34667.1|  BnaC08g42260D                                        86.7    1e-16   Brassica napus [oilseed rape]
ref|XP_010492170.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    1e-16   Camelina sativa [gold-of-pleasure]
gb|EYU28222.1|  hypothetical protein MIMGU_mgv1a003468mg              86.3    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    1e-16   Brassica rapa
emb|CDX97924.1|  BnaA06g06750D                                        85.9    2e-16   
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1  85.9    2e-16   Vitis vinifera
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg           85.9    2e-16   Capsella rubella
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233           85.9    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1  85.9    2e-16   
emb|CDY34861.1|  BnaA09g47870D                                        85.5    2e-16   Brassica napus [oilseed rape]
ref|XP_002530674.1|  endomembrane protein emp70, putative             85.9    2e-16   Ricinus communis
ref|XP_006664390.1|  PREDICTED: transmembrane 9 superfamily membe...  85.1    3e-16   Oryza brachyantha
emb|CDY54580.1|  BnaCnng27350D                                        85.1    3e-16   Brassica napus [oilseed rape]
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...  85.1    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404975.1|  PREDICTED: transmembrane 9 superfamily membe...  84.7    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3  84.7    5e-16   Cucumis melo [Oriental melon]
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...  84.7    5e-16   
ref|NP_563881.1|  transmembrane nine 1                                84.3    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member       84.3    6e-16   Medicago truncatula
ref|XP_009404976.1|  PREDICTED: transmembrane 9 superfamily membe...  84.3    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047104.1|  Os02g0552000                                     84.3    6e-16   
gb|KGN57596.1|  hypothetical protein Csa_3G222780                     84.3    8e-16   
ref|XP_007159578.1|  hypothetical protein PHAVU_002G249200g           84.0    8e-16   Phaseolus vulgaris [French bean]
ref|XP_009124655.1|  PREDICTED: transmembrane 9 superfamily membe...  84.0    9e-16   
gb|EEE57172.1|  hypothetical protein OsJ_07106                        83.6    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  83.6    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g           83.6    1e-15   Phaseolus vulgaris [French bean]
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...  83.2    2e-15   Glycine max [soybeans]
gb|EYU22789.1|  hypothetical protein MIMGU_mgv1a003460mg              83.2    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...  83.2    2e-15   Glycine max [soybeans]
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...  82.8    2e-15   Camelina sativa [gold-of-pleasure]
gb|EPS65883.1|  hypothetical protein M569_08888                       82.8    2e-15   Genlisea aurea
gb|EMS58779.1|  Transmembrane 9 superfamily member 3                  82.8    2e-15   Triticum urartu
ref|XP_011074960.1|  PREDICTED: transmembrane 9 superfamily membe...  82.4    3e-15   Sesamum indicum [beniseed]
ref|XP_001785045.1|  predicted protein                                81.6    5e-15   
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...  81.6    5e-15   Cicer arietinum [garbanzo]
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...  81.6    6e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...  81.3    8e-15   Populus euphratica
ref|XP_002304054.2|  hypothetical protein POPTR_0003s011001g          80.5    1e-14   
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                  80.1    2e-14   
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331           79.7    2e-14   
emb|CDO97576.1|  unnamed protein product                              79.3    3e-14   Coffea canephora [robusta coffee]
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...  79.3    4e-14   Glycine max [soybeans]
ref|XP_006384984.1|  endomembrane protein 70                          79.0    4e-14   
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...  79.0    4e-14   Glycine max [soybeans]
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520           79.0    4e-14   Selaginella moellendorffii
gb|EPS62158.1|  hypothetical protein M569_12635                       78.6    6e-14   Genlisea aurea
ref|XP_006367366.1|  PREDICTED: transmembrane 9 superfamily membe...  78.6    6e-14   Solanum tuberosum [potatoes]
ref|XP_004250432.1|  PREDICTED: transmembrane 9 superfamily member 3  78.6    6e-14   Solanum lycopersicum
ref|XP_009763454.1|  PREDICTED: transmembrane 9 superfamily membe...  78.6    6e-14   Nicotiana sylvestris
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1  78.6    6e-14   Populus euphratica
ref|XP_009113237.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  78.2    9e-14   
ref|XP_009593535.1|  PREDICTED: transmembrane 9 superfamily membe...  76.3    9e-14   Nicotiana tomentosiformis
ref|XP_011096274.1|  PREDICTED: transmembrane 9 superfamily membe...  77.4    1e-13   Sesamum indicum [beniseed]
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3             77.0    2e-13   Auxenochlorella protothecoides
ref|XP_006648727.1|  PREDICTED: transmembrane 9 superfamily membe...  77.0    2e-13   
ref|XP_009631162.1|  PREDICTED: transmembrane 9 superfamily membe...  75.5    6e-13   Nicotiana tomentosiformis
ref|XP_007509634.1|  predicted protein                                75.5    8e-13   Bathycoccus prasinos
ref|XP_004241844.1|  PREDICTED: transmembrane 9 superfamily membe...  74.7    1e-12   Solanum lycopersicum
gb|KIZ05019.1|  Transmembrane 9 superfamily member 3                  69.3    1e-11   Monoraphidium neglectum
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511            71.2    2e-11   Chlorella variabilis
ref|XP_001698971.1|  EMP/nonaspanin domain family protein             70.9    3e-11   Chlamydomonas reinhardtii
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991            69.7    7e-11   Coccomyxa subellipsoidea C-169
gb|EWM22128.1|  transmembrane 9 superfamily member 3                  69.3    8e-11   Nannochloropsis gaditana
ref|XP_002945998.1|  hypothetical protein VOLCADRAFT_72231            68.9    1e-10   Volvox carteri f. nagariensis
ref|XP_006643045.1|  PREDICTED: solute carrier family 22 member 1...  68.9    1e-10   
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                   68.6    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...  68.6    2e-10   Eucalyptus grandis [rose gum]
ref|XP_009788011.1|  PREDICTED: transmembrane 9 superfamily membe...  68.6    2e-10   Nicotiana sylvestris
ref|XP_002509072.1|  predicted protein                                68.2    2e-10   Micromonas commoda
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022           67.4    3e-10   Volvox carteri f. nagariensis
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...  67.0    5e-10   Xenopus tropicalis [western clawed frog]
ref|XP_003061693.1|  predicted protein                                67.0    5e-10   Micromonas pusilla CCMP1545
ref|XP_001689987.1|  EMP/nonaspanin domain family protein             67.0    6e-10   Chlamydomonas reinhardtii
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b       67.0    6e-10   Phoenix dactylifera
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1  66.2    1e-09   Esox lucius
ref|XP_007255923.1|  PREDICTED: transmembrane 9 superfamily member 1  66.2    1e-09   
emb|CDQ70386.1|  unnamed protein product                              66.2    1e-09   Oncorhynchus mykiss
ref|XP_006356503.1|  PREDICTED: transmembrane 9 superfamily membe...  65.9    1e-09   Solanum tuberosum [potatoes]
ref|XP_006849485.1|  hypothetical protein AMTR_s00024p00115620        65.5    2e-09   
ref|NP_001003550.1|  transmembrane 9 superfamily member 1             65.1    2e-09   Danio rerio [leopard danio]
ref|XP_001630700.1|  predicted protein                                64.7    3e-09   Nematostella vectensis
gb|AAF98161.1|AF269152_1  transmembrane protein TM9SF1                64.7    3e-09   Mus musculus [mouse]
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...  64.7    3e-09   Elaeis guineensis
ref|XP_006519679.1|  PREDICTED: transmembrane 9 superfamily membe...  64.3    4e-09   Mus musculus [mouse]
ref|NP_001012155.1|  transmembrane 9 superfamily member 1 precursor   64.3    4e-09   Rattus norvegicus [brown rat]
ref|XP_011243511.1|  PREDICTED: transmembrane 9 superfamily membe...  63.9    4e-09   Mus musculus [mouse]
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...  64.3    4e-09   Elaeis guineensis
gb|ERE89416.1|  transmembrane 9 superfamily member 1 isoform 2        64.3    4e-09   Cricetulus griseus [Chinese hamsters]
ref|XP_006252052.1|  PREDICTED: transmembrane 9 superfamily membe...  64.3    5e-09   
ref|XP_006988599.1|  PREDICTED: transmembrane 9 superfamily membe...  64.3    5e-09   
ref|XP_003502106.1|  PREDICTED: transmembrane 9 superfamily member 1  63.9    5e-09   Cricetulus griseus [Chinese hamsters]
ref|XP_005370493.1|  PREDICTED: transmembrane 9 superfamily membe...  63.9    6e-09   
ref|NP_083056.2|  transmembrane 9 superfamily member 1 precursor      63.9    6e-09   Mus musculus [mouse]
ref|XP_005085662.1|  PREDICTED: transmembrane 9 superfamily member 1  63.5    7e-09   
ref|XP_009827098.1|  hypothetical protein, variant                    63.5    7e-09   Aphanomyces astaci
ref|XP_009827097.1|  hypothetical protein H257_04344                  63.2    1e-08   Aphanomyces astaci
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...  63.2    1e-08   Alligator sinensis
emb|CDP05443.1|  unnamed protein product                              62.8    1e-08   Coffea canephora [robusta coffee]
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...  62.8    1e-08   Phoenix dactylifera
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg           62.8    1e-08   Citrus clementina [clementine]
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1  62.8    1e-08   Alligator mississippiensis
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg              62.4    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_005836386.1|  hypothetical protein GUITHDRAFT_67884            62.4    2e-08   Guillardia theta CCMP2712
ref|XP_003755940.1|  PREDICTED: transmembrane 9 superfamily member 1  62.0    2e-08   
ref|XP_008787888.1|  PREDICTED: putative phagocytic receptor 1b i...  62.0    2e-08   Phoenix dactylifera
ref|XP_009524748.1|  hypothetical protein PHYSODRAFT_299515           62.0    2e-08   Phytophthora sojae
gb|KJB15313.1|  hypothetical protein B456_002G170500                  62.0    2e-08   Gossypium raimondii
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...  62.0    3e-08   Nicotiana sylvestris
ref|XP_001380199.1|  PREDICTED: transmembrane 9 superfamily membe...  62.0    3e-08   Monodelphis domestica
emb|CBY17963.1|  unnamed protein product                              62.0    3e-08   Oikopleura dioica
ref|XP_007439478.1|  PREDICTED: transmembrane 9 superfamily membe...  58.5    3e-08   
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1  62.0    3e-08   Nannospalax galili
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b       62.0    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...  62.0    3e-08   Nicotiana tomentosiformis
ref|XP_008868877.1|  hypothetical protein H310_05822                  62.0    3e-08   Aphanomyces invadans
gb|EPY89936.1|  importin-4                                            62.4    3e-08   Camelus ferus
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b       61.6    3e-08   Nelumbo nucifera [Indian lotus]
gb|KJB15310.1|  hypothetical protein B456_002G170500                  61.6    3e-08   Gossypium raimondii
gb|ELK32462.1|  Importin-4                                            62.0    3e-08   Myotis davidii
emb|CCA19624.1|  endomembrane protein 70like protein putative         61.6    3e-08   Albugo laibachii Nc14
gb|KDP38192.1|  hypothetical protein JCGZ_04835                       61.6    3e-08   Jatropha curcas
ref|XP_011407645.1|  PREDICTED: transmembrane 9 superfamily membe...  61.2    3e-08   
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                  61.6    3e-08   Toxocara canis
ref|XP_002903970.1|  endomembrane protein 70-like protein, putative   61.6    3e-08   Phytophthora infestans T30-4
gb|ELK11218.1|  Importin-4                                            62.0    3e-08   Pteropus alecto
gb|KFO27482.1|  Importin-4                                            62.0    3e-08   Fukomys damarensis [Damara mole rat]
ref|XP_004139482.1|  PREDICTED: putative phagocytic receptor 1b-like  61.6    3e-08   Cucumis sativus [cucumbers]
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...  61.6    3e-08   Aplysia californica
gb|ELW69279.1|  Importin-4                                            62.0    3e-08   Tupaia chinensis
ref|XP_002290902.1|  endomembrane protein EMP70 precusor              61.6    3e-08   Thalassiosira pseudonana CCMP1335
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...  61.6    3e-08   
emb|CCI39562.1|  unnamed protein product                              61.6    3e-08   Albugo candida
gb|EMP30576.1|  Transmembrane 9 superfamily member 1                  61.6    4e-08   Chelonia mydas [green seaturtle]
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...  61.6    4e-08   
ref|XP_001699211.1|  EMP/nonaspanin domain family protein             61.6    4e-08   Chlamydomonas reinhardtii
gb|KHN24548.1|  Putative phagocytic receptor 1b                       61.6    4e-08   Glycine soja [wild soybean]
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like  61.6    4e-08   Glycine max [soybeans]
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b       61.2    4e-08   Eucalyptus grandis [rose gum]
gb|ERG85277.1|  transmembrane 9 superfamily member 3                  61.2    4e-08   
ref|XP_006835458.1|  PREDICTED: charged multivesicular body prote...  61.6    4e-08   Chrysochloris asiatica
gb|KHG04463.1|  Putative phagocytic receptor 1b                       61.6    4e-08   Gossypium arboreum [tree cotton]
ref|XP_002521898.1|  transporter, putative                            61.2    4e-08   
ref|XP_002521900.1|  transporter, putative                            61.2    4e-08   Ricinus communis
ref|XP_002115408.1|  hypothetical protein TRIADDRAFT_29152            61.2    4e-08   Trichoplax adhaerens
ref|XP_008267651.1|  PREDICTED: transmembrane 9 superfamily membe...  61.6    4e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...  61.2    4e-08   Cucumis melo [Oriental melon]
ref|XP_004137376.1|  PREDICTED: putative phagocytic receptor 1b-like  61.2    4e-08   Cucumis sativus [cucumbers]
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                 61.2    4e-08   Dicentrarchus labrax [European sea bass]
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1  61.6    4e-08   
ref|XP_004584775.1|  PREDICTED: transmembrane 9 superfamily member 1  61.6    4e-08   
ref|XP_003802004.1|  PREDICTED: transmembrane 9 superfamily member 1  61.6    4e-08   
ref|XP_002156433.1|  PREDICTED: transmembrane 9 superfamily membe...  61.2    4e-08   Hydra vulgaris
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b       61.2    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYC27980.1|  hypothetical protein Y032_0008g273                    59.7    5e-08   Ancylostoma ceylanicum
dbj|BAH13215.1|  unnamed protein product                              61.2    5e-08   Homo sapiens [man]
gb|KDP38191.1|  hypothetical protein JCGZ_04834                       61.2    5e-08   Jatropha curcas
ref|XP_006823625.1|  PREDICTED: transmembrane 9 superfamily membe...  57.8    5e-08   Saccoglossus kowalevskii
ref|XP_002412937.1|  endosomal membrane protein EMP70, putative       61.2    5e-08   
ref|XP_004661882.1|  PREDICTED: transmembrane 9 superfamily member 1  60.8    5e-08   Jaculus jaculus
ref|XP_006883243.1|  PREDICTED: transmembrane 9 superfamily membe...  61.2    5e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006217338.1|  PREDICTED: charged multivesicular body prote...  61.2    5e-08   
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...  60.8    5e-08   Cucumis melo [Oriental melon]
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1  60.8    5e-08   Poecilia reticulata
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b       60.8    5e-08   Nicotiana sylvestris
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1  61.2    5e-08   Condylura cristata
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1  60.8    5e-08   Poecilia formosa
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...  61.2    6e-08   Erinaceus europaeus [common hedgehog]
ref|XP_004463432.1|  PREDICTED: transmembrane 9 superfamily membe...  61.2    6e-08   
ref|XP_006172880.1|  PREDICTED: charged multivesicular body prote...  61.2    6e-08   Camelus ferus
gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg              60.8    6e-08   Erythranthe guttata [common monkey flower]
ref|XP_003457937.2|  PREDICTED: transmembrane 9 superfamily membe...  60.8    6e-08   Oreochromis niloticus
ref|XP_004885399.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    6e-08   
ref|XP_004347030.2|  transmembrane protein TM9SF3                     60.8    6e-08   Capsaspora owczarzaki ATCC 30864
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    6e-08   
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    6e-08   
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    6e-08   
ref|XP_002062013.1|  GK16877                                          60.8    6e-08   
gb|KJB15311.1|  hypothetical protein B456_002G170500                  60.5    6e-08   
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    7e-08   
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor   60.8    7e-08   
ref|XP_010994078.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  60.8    7e-08   
ref|XP_009024297.1|  hypothetical protein HELRODRAFT_157541           60.8    7e-08   
ref|XP_010739917.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    7e-08   
ref|XP_007447941.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    7e-08   
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    7e-08   
ref|XP_009004051.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
gb|AAC51782.1|  multispanning membrane protein                        60.5    7e-08   
ref|XP_006739629.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    7e-08   
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...  60.5    7e-08   
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    7e-08   
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    7e-08   
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
dbj|BAF84799.1|  unnamed protein product                              60.5    7e-08   
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor   60.5    7e-08   
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    7e-08   
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    7e-08   
ref|XP_004647518.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
ref|XP_007947407.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    7e-08   
ref|XP_005377087.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    7e-08   
gb|KIH62674.1|  endomembrane protein 70                               60.5    7e-08   
ref|XP_009064505.1|  hypothetical protein LOTGIDRAFT_196341           60.5    8e-08   
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...  60.5    8e-08   
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
ref|XP_003385405.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
gb|ETN69974.1|  endomembrane protein 70                               60.5    8e-08   
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    8e-08   
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    8e-08   
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    8e-08   
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
ref|XP_010333315.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    8e-08   
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    8e-08   
ref|XP_010105529.1|  Putative phagocytic receptor 1b                  60.5    8e-08   
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b       60.5    8e-08   
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    9e-08   
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|NP_001267415.1|  transmembrane 9 superfamily member 1 precursor   60.5    9e-08   
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|XP_004463433.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b       60.5    9e-08   
ref|XP_004575210.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|XP_006809561.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b       60.5    9e-08   
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...  60.5    9e-08   
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...  60.5    9e-08   
ref|XP_001490063.1|  PREDICTED: transmembrane 9 superfamily member 1  60.5    9e-08   
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...  60.5    9e-08   
ref|XP_002125091.1|  PREDICTED: transmembrane 9 superfamily member 1  60.1    9e-08   
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1  60.1    9e-08   
ref|XP_006854108.1|  hypothetical protein AMTR_s00048p00146310        60.1    9e-08   
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1  60.1    9e-08   
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1  60.1    1e-07   
ref|XP_005754693.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_005770609.1|  hypothetical protein EMIHUDRAFT_196296           57.4    1e-07   
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_005780441.1|  hypothetical protein EMIHUDRAFT_60194            58.2    1e-07   
ref|XP_002178644.1|  predicted protein                                60.1    1e-07   
ref|XP_006835459.1|  PREDICTED: charged multivesicular body prote...  60.1    1e-07   
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_006102307.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1  60.1    1e-07   
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor   60.1    1e-07   
ref|XP_006572161.1|  PREDICTED: transmembrane 9 superfamily member 3  60.1    1e-07   
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_006610901.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1  60.1    1e-07   
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b       60.1    1e-07   
dbj|BAJ89640.1|  predicted protein                                    60.1    1e-07   
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650        60.1    1e-07   
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...  60.1    1e-07   
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg           60.1    1e-07   
ref|XP_005859645.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like  60.1    1e-07   
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like  60.1    1e-07   
ref|XP_008156681.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...  59.7    1e-07   
ref|XP_010322438.1|  PREDICTED: putative phagocytic receptor 1b i...  59.7    1e-07   
ref|XP_005005680.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    1e-07   
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1  59.7    1e-07   
gb|AGT15903.1|  transmembrane 9 superfamily protein                   59.7    1e-07   
ref|XP_004463434.1|  PREDICTED: transmembrane 9 superfamily membe...  59.7    1e-07   
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like  59.7    1e-07   
ref|XP_003698368.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  59.7    1e-07   
ref|XP_006779604.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  59.7    1e-07   
ref|XP_001957525.1|  GF10453                                          59.7    1e-07   
ref|XP_001783681.1|  predicted protein                                59.7    1e-07   
emb|CBI28324.3|  unnamed protein product                              59.7    1e-07   
gb|EMS60954.1|  Putative phagocytic receptor 1b                       59.7    1e-07   
ref|XP_006519680.1|  PREDICTED: transmembrane 9 superfamily membe...  59.3    1e-07   
ref|NP_001014842.1|  transmembrane 9 superfamily member 1 isoform...  59.3    1e-07   
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5  59.7    2e-07   
ref|XP_003474483.1|  PREDICTED: transmembrane 9 superfamily membe...  59.7    2e-07   
ref|XP_008305730.1|  PREDICTED: transmembrane 9 superfamily member 1  59.7    2e-07   
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...  59.7    2e-07   
ref|XP_008895867.1|  hypothetical protein PPTG_03848                  59.7    2e-07   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3  59.3    2e-07   
gb|ETK76715.1|  hypothetical protein L915_16929                       59.7    2e-07   
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b       59.7    2e-07   
gb|AEE63341.1|  unknown                                               59.3    2e-07   
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...  59.3    2e-07   
ref|XP_006372422.1|  endomembrane protein 70                          59.3    2e-07   
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b       59.3    2e-07   
ref|XP_006739631.1|  PREDICTED: transmembrane 9 superfamily membe...  59.3    2e-07   
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...  59.7    2e-07   
ref|XP_003441118.1|  PREDICTED: transmembrane 9 superfamily member 3  59.3    2e-07   
emb|CAN67239.1|  hypothetical protein VITISV_004804                   59.7    2e-07   
gb|ENN73181.1|  hypothetical protein YQE_10235                        59.3    2e-07   
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b       59.3    2e-07   
ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3  59.3    2e-07   
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...  59.3    2e-07   
emb|CDP01680.1|  unnamed protein product                              59.3    2e-07   
emb|CDY56297.1|  BnaC09g52300D                                        59.3    2e-07   
ref|XP_011163701.1|  PREDICTED: transmembrane 9 superfamily member 3  59.3    2e-07   
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like  59.3    2e-07   
ref|XP_011056752.1|  PREDICTED: transmembrane 9 superfamily member 3  59.3    2e-07   
ref|XP_002870515.1|  transporter                                      59.3    2e-07   
ref|XP_008461519.1|  PREDICTED: putative phagocytic receptor 1b i...  58.9    2e-07   
emb|CDY03085.1|  BnaC07g21420D                                        58.9    2e-07   
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...  59.3    2e-07   
gb|ETI36484.1|  hypothetical protein F443_17408                       59.3    2e-07   
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    2e-07   
ref|XP_003755285.1|  PREDICTED: transmembrane 9 superfamily member 3  58.9    2e-07   
ref|XP_002521899.1|  transporter, putative                            58.9    2e-07   
emb|CDP05446.1|  unnamed protein product                              58.9    2e-07   
ref|XP_005650990.1|  EMP/nonaspanin domain family protein             58.9    2e-07   
ref|XP_003967994.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    2e-07   
ref|XP_008487150.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    2e-07   
ref|XP_004010358.1|  PREDICTED: transmembrane 9 superfamily member 1  58.9    2e-07   
ref|XP_006799085.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    2e-07   
ref|XP_007478768.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    2e-07   
ref|XP_003379084.1|  transmembrane 9 superfamily member 3             59.3    2e-07   
ref|XP_007478767.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    2e-07   
ref|XP_008895869.1|  hypothetical protein, variant 3                  58.9    2e-07   
ref|NP_198547.3|  putative endomembrane protein 70                    58.9    2e-07   
gb|ETE67718.1|  Transmembrane 9 superfamily member 3                  58.9    2e-07   
gb|KDP33127.1|  hypothetical protein JCGZ_13574                       58.9    2e-07   
gb|ETK76718.1|  hypothetical protein, variant 3                       58.9    3e-07   
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like  58.9    3e-07   
ref|NP_500130.1|  Protein Y41D4A.4                                    58.9    3e-07   
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b       58.9    3e-07   
ref|XP_001775546.1|  predicted protein                                58.9    3e-07   
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b       58.9    3e-07   
gb|EMT19161.1|  Putative phagocytic receptor 1b                       58.9    3e-07   
ref|XP_005735123.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    3e-07   
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...  58.9    3e-07   
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg           58.9    3e-07   
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b       58.9    3e-07   
ref|XP_005997314.1|  PREDICTED: transmembrane 9 superfamily member 3  58.9    3e-07   
ref|XP_008320400.1|  PREDICTED: transmembrane 9 superfamily member 3  58.9    3e-07   
gb|EEE68090.1|  hypothetical protein OsJ_26137                        58.9    3e-07   
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b       58.9    3e-07   
ref|XP_004559661.1|  PREDICTED: transmembrane 9 superfamily membe...  58.9    3e-07   
ref|XP_011011376.1|  PREDICTED: transmembrane 9 superfamily membe...  58.5    3e-07   
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b       58.5    3e-07   
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b       58.5    3e-07   
emb|CDP05457.1|  unnamed protein product                              58.5    3e-07   
ref|NP_178306.1|  putative endomembrane protein 70                    58.5    3e-07   
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b       58.5    3e-07   
emb|CDH93343.1|  Y41D4A.4, isoform e                                  58.5    3e-07   
emb|CDY62621.1|  BnaC08g46810D                                        58.5    3e-07   
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...  58.5    3e-07   
gb|ETI36486.1|  hypothetical protein, variant 2                       58.5    3e-07   
ref|XP_008282853.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  58.5    3e-07   
ref|XP_002634585.1|  Hypothetical protein CBG08396                    58.5    3e-07   
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...  58.5    3e-07   
gb|EGT53827.1|  hypothetical protein CAEBREN_03110                    58.5    3e-07   
emb|CAF90073.1|  unnamed protein product                              53.9    3e-07   
gb|KJB08470.1|  hypothetical protein B456_001G083100                  58.5    3e-07   
gb|KHG09925.1|  Putative phagocytic receptor 1b                       58.5    3e-07   
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b       58.5    3e-07   
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg           58.5    3e-07   
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...  58.5    3e-07   
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...  58.5    3e-07   
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b       58.5    3e-07   
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...  58.5    3e-07   
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b       58.5    4e-07   
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g           58.5    4e-07   
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like  58.5    4e-07   
gb|AAK52585.1|AC079685_16  Putative endosomal protein                 58.5    4e-07   
emb|CDY15803.1|  BnaC02g34220D                                        58.5    4e-07   
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b       58.5    4e-07   
gb|EEC66468.1|  hypothetical protein OsI_32547                        58.5    4e-07   
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415           58.5    4e-07   
gb|KHN28892.1|  Putative phagocytic receptor 1b                       58.5    4e-07   
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg           58.5    4e-07   
gb|KHN43674.1|  Putative phagocytic receptor 1b                       58.5    4e-07   
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b       58.5    4e-07   
ref|XP_003704134.1|  PREDICTED: transmembrane 9 superfamily member 3  58.5    4e-07   
gb|KDO27371.1|  hypothetical protein SPRG_06957                       58.5    4e-07   
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b       58.5    4e-07   
ref|NP_001064040.1|  Os10g0112600                                     58.2    4e-07   
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...  58.2    4e-07   
emb|CDY47549.1|  BnaA08g07380D                                        58.2    4e-07   
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg           58.2    4e-07   
ref|XP_011352435.1|  PREDICTED: transmembrane 9 superfamily member 3  58.2    4e-07   
ref|XP_011182989.1|  PREDICTED: transmembrane 9 superfamily member 3  58.2    4e-07   
ref|XP_010523531.1|  PREDICTED: putative phagocytic receptor 1b       58.2    4e-07   
gb|KJB60874.1|  hypothetical protein B456_009G329300                  58.2    4e-07   
ref|XP_002890068.1|  predicted protein                                58.2    4e-07   
ref|XP_011203691.1|  PREDICTED: transmembrane 9 superfamily member 3  58.2    4e-07   
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b       58.2    4e-07   



>ref|XP_010930775.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
 ref|XP_010930776.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
Length=586

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI I
Sbjct  88   QIEI  91



>ref|XP_010912523.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Elaeis 
guineensis]
Length=581

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI +
Sbjct  89   QIEM  92



>ref|XP_010912522.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Elaeis 
guineensis]
Length=587

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI +
Sbjct  89   QIEM  92



>ref|XP_010912524.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X3 [Elaeis 
guineensis]
Length=512

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI +
Sbjct  89   QIEM  92



>ref|XP_011092338.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Sesamum 
indicum]
Length=588

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PD+PVTLWVNKVGPY+NPQETYNYYSLPFC  S NA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQPDEPVTLWVNKVGPYHNPQETYNYYSLPFCHPSGNAAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
             I+I
Sbjct  88   LIDI  91



>ref|XP_003592976.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES63227.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=583

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFCR   N  H+WGGLGEVLGGNELIDS
Sbjct  22   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCRPPGNTAHKWGGLGEVLGGNELIDS  81

Query  424  QINI  435
            QI I
Sbjct  82   QIEI  85



>ref|XP_007221993.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
 gb|EMJ23192.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
Length=589

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTEEPVTLWVNKVGPYNNPQETYNYYSLPFCHPSENAAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>gb|KHG21692.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=587

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHLGTNPAHKWGGLGEVLGGNELIDS  91

Query  424  QINI  435
            QI+I
Sbjct  92   QIDI  95



>gb|KJB79238.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=593

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPAHKWGGLGEVLGGNELIDS  91

Query  424  QINI  435
            QI+I
Sbjct  92   QIDI  95



>gb|KJB12212.1| hypothetical protein B456_002G006200 [Gossypium raimondii]
Length=592

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDP+TLWVNKVGPY NPQETYNYYSLPFC+   N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQPDDPITLWVNKVGPYNNPQETYNYYSLPFCQPGTNPAHKWGGLGEVLGGNELIDS  90

Query  424  QINI  435
            QI++
Sbjct  91   QIDM  94



>ref|XP_008783371.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=586

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC+ S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSGNPAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_008218557.1| PREDICTED: transmembrane 9 superfamily member 3 [Prunus mume]
Length=589

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTEEPVTLWVNKVGPYNNPQETYNYYSLPFCHPSENAAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_004952828.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=585

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC A+EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHATENHVHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>ref|XP_008807671.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=591

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK DDPVTLW NKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYKVDDPVTLWANKVGPYNNPQETYNYHSLPFCQPSENPAHKWGGLGEVLGGNELIDS  92

Query  424  QINI  435
            QI I
Sbjct  93   QIEI  96



>emb|CDY44835.1| BnaCnng11910D [Brassica napus]
Length=155

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQANEQVTLWVNKVGPYNNPQETYNYYSLPFCRKNENSIHKWGGLGEVLGGNELIDS  89

Query  424  QINI  435
            QI+I
Sbjct  90   QIDI  93



>ref|XP_002452255.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
 gb|EES05231.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
Length=585

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAEEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK  DPV LWVNKVGPY NPQETYNY+SLPFC+ SEN PH+WGGLGEVLGGNELIDS
Sbjct  36   DHKYKTGDPVKLWVNKVGPYNNPQETYNYHSLPFCQLSENPPHKWGGLGEVLGGNELIDS  95

Query  424  QINI  435
            Q++I
Sbjct  96   QLDI  99



>ref|XP_002449107.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
 gb|EES08095.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
Length=590

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPSHKWGGLGEVLGGNELIDS  91

Query  424  QINI  435
            QI+I
Sbjct  92   QIDI  95



>ref|XP_004485475.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Cicer arietinum]
Length=583

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR   NA H+WGGLGEVLGGNELIDS
Sbjct  22   DHKYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRLPGNAAHKWGGLGEVLGGNELIDS  81

Query  424  QINI  435
            QI I
Sbjct  82   QIEI  85



>ref|XP_004485474.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Cicer arietinum]
Length=583

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR   NA H+WGGLGEVLGGNELIDS
Sbjct  22   DHKYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRLPGNAAHKWGGLGEVLGGNELIDS  81

Query  424  QINI  435
            QI I
Sbjct  82   QIEI  85



>ref|XP_010101151.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
 gb|EXB87369.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
Length=609

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S NA H+WGGLGEVLGGNELI+S
Sbjct  27   DHKYQKDEAVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNAAHKWGGLGEVLGGNELIES  86

Query  424  QINI  435
            QINI
Sbjct  87   QINI  90



>gb|KDP38816.1| hypothetical protein JCGZ_04973 [Jatropha curcas]
Length=596

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PD+PVTLWVNKVGPY NPQETYNYYSLPFC  S +A H+WGGLGEVLGGNELIDS
Sbjct  35   DHKYQPDEPVTLWVNKVGPYNNPQETYNYYSLPFCHPSGSAAHKWGGLGEVLGGNELIDS  94

Query  424  QINI  435
            +I+I
Sbjct  95   KIDI  98



>ref|XP_010030126.1| PREDICTED: transmembrane 9 superfamily member 3 [Eucalyptus grandis]
 gb|KCW57092.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=585

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PD+ VTLWVNKVGPY NPQETYNYYSLPFCRA  N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQPDEAVTLWVNKVGPYNNPQETYNYYSLPFCRAPGNPAHKWGGLGEVLGGNELIDS  84

Query  424  QINI  435
            QI I
Sbjct  85   QIEI  88



>ref|XP_004978867.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=586

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKAEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_008681381.1| PREDICTED: uncharacterized protein LOC100272502 isoform X1 [Zea 
mays]
Length=588

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+  +PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAAEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>ref|XP_010910845.1| PREDICTED: transmembrane 9 superfamily member 1-like [Elaeis 
guineensis]
Length=586

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC+ S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQVDDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSGNPAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI I
Sbjct  88   QIEI  91



>gb|AGE46034.1| putative transmembrane 9 superfamily member 3 protein [Elaeis 
guineensis]
Length=586

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC+ S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQVDDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSGNPAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI I
Sbjct  88   QIEI  91



>ref|XP_008681382.1| PREDICTED: uncharacterized protein LOC100272502 isoform X2 [Zea 
mays]
Length=585

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+  +PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAAEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>ref|XP_006431823.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
 gb|ESR45063.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
Length=587

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQQDEPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNPAHKWGGLGEVLGGNELIDS  85

Query  424  QINI  435
            QI+I
Sbjct  86   QIDI  89



>ref|XP_006471014.1| PREDICTED: transmembrane 9 superfamily member 3-like [Citrus 
sinensis]
Length=587

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQQDEPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNPAHKWGGLGEVLGGNELIDS  85

Query  424  QINI  435
            QI+I
Sbjct  86   QIDI  89



>ref|XP_009379854.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ +DPVTLWVNKVGPY NPQETYNYYSLPFC  S+N  H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQAEDPVTLWVNKVGPYNNPQETYNYYSLPFCHPSKNLAHKWGGLGEVLGGNELIDS  92

Query  424  QINI  435
            QI I
Sbjct  93   QIQI  96



>ref|XP_009600607.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 1/64 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC AS  + H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS-GSTHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>gb|AFW71773.1| hypothetical protein ZEAMMB73_948581, partial [Zea mays]
Length=469

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+  +PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAAEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>ref|XP_009796637.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 1/64 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC AS  + H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS-GSTHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_011464826.1| PREDICTED: transmembrane 9 superfamily member 1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR S+NA H+WGGLGEVLGGNELIDS
Sbjct  37   DHKYQAEEAVTLWVNKVGPYNNPQETYNYYSLPFCRPSDNAAHKWGGLGEVLGGNELIDS  96

Query  424  QINI  435
            QI+I
Sbjct  97   QIDI  100



>gb|KFK40744.1| hypothetical protein AALP_AA2G035500 [Arabis alpina]
Length=595

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+P++ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  34   DHKYQPEEHVTLWVNKVGPYNNPQETYNYYSLPFCRKNENSVHKWGGLGEVLGGNELIDS  93

Query  424  QINI  435
            QI+I
Sbjct  94   QIDI  97



>gb|KCW57093.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=483

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PD+ VTLWVNKVGPY NPQETYNYYSLPFCRA  N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQPDEAVTLWVNKVGPYNNPQETYNYYSLPFCRAPGNPAHKWGGLGEVLGGNELIDS  84

Query  424  QINI  435
            QI I
Sbjct  85   QIEI  88



>gb|KDO50082.1| hypothetical protein CISIN_1g012251mg [Citrus sinensis]
 gb|KDO50083.1| hypothetical protein CISIN_1g012251mg [Citrus sinensis]
Length=467

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQQDEPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNPAHKWGGLGEVLGGNELIDS  85

Query  424  QINI  435
            QI+I
Sbjct  86   QIDI  89



>ref|XP_009390071.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ +DPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+W GLGEVLGGNELIDS
Sbjct  30   DHKYQAEDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWSGLGEVLGGNELIDS  89

Query  424  QINI  435
             I I
Sbjct  90   HIPI  93



>ref|XP_009776073.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 2/64 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_008339497.1| PREDICTED: transmembrane 9 superfamily member 3-like [Malus domestica]
Length=589

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++ VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKTEESVTLWVNKVGPYNNPQETYNYYSLPFCHQSENAAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI I
Sbjct  88   QIEI  91



>ref|XP_006392092.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29378.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=591

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSVHKWGGLGEVLGGNELIDS  89

Query  424  QINI  435
            QI+I
Sbjct  90   QIDI  93



>ref|XP_009348753.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++ VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKAEESVTLWVNKVGPYNNPQETYNYYSLPFCHRSENAAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI I
Sbjct  88   QIEI  91



>ref|XP_002442907.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
 gb|EES16745.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
Length=594

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  36   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  95

Query  424  QINI  435
            Q+ I
Sbjct  96   QLEI  99



>ref|XP_008667101.1| PREDICTED: uncharacterized protein LOC100192672 isoform X1 [Zea 
mays]
 tpg|DAA38952.1| TPA: transmembrane 9 family protein member 3 [Zea mays]
Length=586

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            +HKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   EHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>gb|ACG29787.1| transmembrane 9 superfamily protein member 3 precursor [Zea mays]
Length=586

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            +HKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   EHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_009104187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=594

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSIHKWGGLGEVLGGNELIDS  92

Query  424  QINI  435
            QI+I
Sbjct  93   QIDI  96



>tpg|DAA55531.1| TPA: hypothetical protein ZEAMMB73_446969 [Zea mays]
Length=592

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  34   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  93

Query  424  QINI  435
            Q+ I
Sbjct  94   QLEI  97



>gb|KHN45466.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=584

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH+Y+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR+  N  H+WGGLGEVLGGNELIDS
Sbjct  23   DHRYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRSPGNTAHKWGGLGEVLGGNELIDS  82

Query  424  QINI  435
            Q+ I
Sbjct  83   QLEI  86



>emb|CDY03772.1| BnaC01g28890D [Brassica napus]
Length=594

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN  H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENTIHKWGGLGEVLGGNELIDS  92

Query  424  QINI  435
            QI+I
Sbjct  93   QIDI  96



>ref|XP_004977232.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=597

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  39   DHKYKAEEPVKLWVNKVGPYNNPQETYNYYSLPFCQLSENPIHKWGGLGEVLGGNELIDS  98

Query  424  QINI  435
            Q++I
Sbjct  99   QLDI  102



>gb|KJB47458.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=590

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI+I
Sbjct  89   QIDI  92



>gb|KJB47460.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=571

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI+I
Sbjct  89   QIDI  92



>ref|XP_007042269.1| Transmembrane nine 1 [Theobroma cacao]
 gb|EOX98100.1| Transmembrane nine 1 [Theobroma cacao]
Length=640

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+P++P+TLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQPEEPITLWVNKVGPYNNPQETYNYYSLPFCHPGANPAHKWGGLGEVLGGNELIDS  90

Query  424  QINI  435
            QI+I
Sbjct  91   QIDI  94



>gb|KJB77692.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=592

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPSHKWGGLGEVLGGNELIDS  90

Query  424  QINI  435
            QI+I
Sbjct  91   QIDI  94



>gb|KHG20578.1| Tm9sf3 [Gossypium arboreum]
Length=639

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQ  426
            HKY+PDDP+TLWVNKVGPY NPQETYNYYSLPFC+   N  H+WGGLGEVLGGNELIDSQ
Sbjct  32   HKYQPDDPITLWVNKVGPYNNPQETYNYYSLPFCQPGTNPAHKWGGLGEVLGGNELIDSQ  91

Query  427  INI  435
            I++
Sbjct  92   IDM  94



>ref|XP_008662281.1| PREDICTED: uncharacterized protein LOC100501115 isoform X1 [Zea 
mays]
 gb|AFW56219.1| hypothetical protein ZEAMMB73_922033 [Zea mays]
Length=596

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  38   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  97

Query  424  QINI  435
            Q+ I
Sbjct  98   QLEI  101



>gb|KHG27380.1| Tm9sf3 [Gossypium arboreum]
Length=614

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI+I
Sbjct  89   QIDI  92



>ref|XP_008378878.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Malus domestica]
Length=589

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTEESVTLWVNKVGPYNNPQETYNYYSLPFCHQSENAAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI I
Sbjct  88   QIEI  91



>gb|KHG20579.1| Tm9sf3 [Gossypium arboreum]
Length=626

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQ  426
            HKY+PDDP+TLWVNKVGPY NPQETYNYYSLPFC+   N  H+WGGLGEVLGGNELIDSQ
Sbjct  32   HKYQPDDPITLWVNKVGPYNNPQETYNYYSLPFCQPGTNPAHKWGGLGEVLGGNELIDSQ  91

Query  427  INI  435
            I++
Sbjct  92   IDM  94



>ref|XP_010682931.1| PREDICTED: transmembrane 9 superfamily member 1 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY   + VTLWVNKVGPY NPQETYNYYSLPFCR+S N+ HRWGGLGEVLGGNELIDS
Sbjct  29   DHKYTASEHVTLWVNKVGPYNNPQETYNYYSLPFCRSSANSGHRWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI+I
Sbjct  89   QIDI  92



>gb|KJB77693.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=569

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPSHKWGGLGEVLGGNELIDS  90

Query  424  QINI  435
            QI+I
Sbjct  91   QIDI  94



>ref|XP_008781557.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Phoenix 
dactylifera]
Length=616

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            +YK DDPV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDSQI
Sbjct  2    QYKADDPVALWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDSQI  61

Query  430  NI  435
            +I
Sbjct  62   DI  63



>gb|KHG16990.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=328

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPAHKWGGLGEVLGGNELIDS  90

Query  424  QINI  435
            QI+I
Sbjct  91   QIDI  94



>gb|KJB47461.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=576

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI+I
Sbjct  89   QIDI  92



>gb|EMT15069.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=574

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK  +PV LWVNKVGPY NPQETYNYYSLPFC+ +EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKISEPVKLWVNKVGPYNNPQETYNYYSLPFCQPAENPAHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>ref|XP_010235535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=588

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ +DPVTLWVNKVGPY NPQETYNYYSLPFC  S+N  H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQEEDPVTLWVNKVGPYNNPQETYNYYSLPFCHKSDNPVHKWGGLGEVLGGNELIDS  89

Query  424  QINI  435
            QI+I
Sbjct  90   QIDI  93



>ref|NP_001066292.1| Os12g0175700 [Oryza sativa Japonica Group]
 gb|ABA96600.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29311.1| Os12g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68944.1| hypothetical protein OsI_37659 [Oryza sativa Indica Group]
 gb|EEE52854.1| hypothetical protein OsJ_35401 [Oryza sativa Japonica Group]
Length=598

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++PV LWVNKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  40   DHKYKVEEPVKLWVNKVGPYNNPQETYNYHSLPFCQPSENPAHKWGGLGEVLGGNELIDS  99

Query  424  QINI  435
            QI+I
Sbjct  100  QIDI  103



>ref|XP_008781558.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Phoenix 
dactylifera]
Length=558

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            +YK DDPV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDSQI
Sbjct  2    QYKADDPVALWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDSQI  61

Query  430  NI  435
            +I
Sbjct  62   DI  63



>ref|XP_003540158.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=584

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH+Y+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR   N  H+WGGLGEVLGGNELIDS
Sbjct  23   DHRYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRPPGNTAHKWGGLGEVLGGNELIDS  82

Query  424  QINI  435
            Q+ I
Sbjct  83   QLEI  86



>ref|XP_009355251.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ +D VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQAEDSVTLWVNKVGPYNNPQETYNYYSLPFCHQSENAAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
             I I
Sbjct  88   LIEI  91



>dbj|BAJ96423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK  +PV LWVNKVGPY NPQETYNYYSLPFC+ +EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKISEPVKLWVNKVGPYNNPQETYNYYSLPFCQPAENPAHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>dbj|BAJ86318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK  +PV LWVNKVGPY NPQETYNYYSLPFC+ +EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKISEPVKLWVNKVGPYNNPQETYNYYSLPFCQPAENPAHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>emb|CDY46193.1| BnaA01g23150D [Brassica napus]
Length=575

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +E + H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTETSIHKWGGLGEVLGGNELIDS  92

Query  424  QINI  435
            QI+I
Sbjct  93   QIDI  96



>ref|XP_004248848.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 1/64 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADDPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNT-HKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI++
Sbjct  88   QIDL  91



>ref|XP_006339920.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 1/64 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADDPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNT-HKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI++
Sbjct  88   QIDL  91



>ref|XP_003577775.1| PREDICTED: transmembrane 9 superfamily member 3 [Brachypodium 
distachyon]
Length=585

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK D+ V LWVNKVGPY NPQETYNYYSLPFC  SEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKVDESVKLWVNKVGPYNNPQETYNYYSLPFCLPSENPAHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            QI+I
Sbjct  87   QIDI  90



>ref|XP_009390763.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++PVTLWVNKVGPY NPQETYNY+SLPFC+ SEN  H+W GLGEVLGGNELIDS
Sbjct  29   DHKYQAEEPVTLWVNKVGPYNNPQETYNYHSLPFCQPSENPAHKWSGLGEVLGGNELIDS  88

Query  424  QINI  435
            Q  I
Sbjct  89   QFQI  92



>gb|AAX96186.1| Endomembrane protein 70 [Oryza sativa Japonica Group]
Length=570

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++ V LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  35   DHKYKAEETVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  94

Query  424  QINI  435
            Q++I
Sbjct  95   QVDI  98



>ref|XP_010272575.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nelumbo 
nucifera]
Length=466

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DD VTLWVNKVGPY NPQETYNYYSLPFC+   NA H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQQDDLVTLWVNKVGPYNNPQETYNYYSLPFCQPPGNAAHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            QI+I
Sbjct  89   QIDI  92



>ref|NP_001065897.1| Os11g0181100 [Oryza sativa Japonica Group]
 gb|ABA91795.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91796.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27742.1| Os11g0181100 [Oryza sativa Japonica Group]
 dbj|BAG94676.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67792.1| hypothetical protein OsI_35351 [Oryza sativa Indica Group]
 gb|EEE51756.1| hypothetical protein OsJ_33190 [Oryza sativa Japonica Group]
Length=593

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++ V LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  35   DHKYKAEETVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  94

Query  424  QINI  435
            Q++I
Sbjct  95   QVDI  98



>ref|XP_009602812.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 2/64 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_006662781.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Oryza brachyantha]
Length=583

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK ++ V LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYKAEEAVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPVHKWGGLGEVLGGNELIDS  84

Query  424  QINI  435
            QI+I
Sbjct  85   QIDI  88



>ref|XP_010553598.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=592

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR+S N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQKDEKVTLWVNKVGPYNNPQETYNYYSLPFCRSSGNDVHKWGGLGEVLGGNELIDS  90

Query  424  QINI  435
            +I+I
Sbjct  91   EIDI  94



>ref|XP_006859169.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
 gb|ERN20636.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
Length=590

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+PV LWVNKVGPY NPQETYNYYSLPFC+ + N  H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQEDEPVMLWVNKVGPYNNPQETYNYYSLPFCQPAGNPAHKWGGLGEVLGGNELIDS  89

Query  424  QINI  435
            QI I
Sbjct  90   QIEI  93



>ref|XP_004230474.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 2/64 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>ref|XP_003532994.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=585

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH+Y+ DDPV LWVNKVGPY NPQETYNYYSLPFCR+  N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHRYQQDDPVILWVNKVGPYNNPQETYNYYSLPFCRSPGNPAHKWGGLGEVLGGNELIDS  83

Query  424  QINI  435
            Q+ I
Sbjct  84   QLEI  87



>ref|NP_001131352.1| uncharacterized protein LOC100192672 precursor [Zea mays]
 gb|ACF79727.1| unknown [Zea mays]
Length=414

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            +HKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   EHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>gb|KHN11244.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=583

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH+Y+ DDPV LWVNKVGPY NPQETYNYYSLPFCR+  N  H+WGGLGEVLGGNELIDS
Sbjct  22   DHRYQQDDPVILWVNKVGPYNNPQETYNYYSLPFCRSPGNPAHKWGGLGEVLGGNELIDS  81

Query  424  QINI  435
            Q+ I
Sbjct  82   QLEI  85



>ref|XP_006349354.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 2/64 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI+I
Sbjct  88   QIDI  91



>emb|CDY20592.1| BnaC08g14660D [Brassica napus]
Length=585

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEKVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  424  QINI  435
            +I I
Sbjct  84   EIPI  87



>ref|XP_010246919.1| PREDICTED: transmembrane 9 superfamily member 3 [Nelumbo nucifera]
Length=591

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ DD VTLWVNKVGPY NPQETYNYYSLPFC+   N+ H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQQDDLVTLWVNKVGPYNNPQETYNYYSLPFCQPPGNSAHKWGGLGEVLGGNELIDS  89

Query  424  QINI  435
            QI+I
Sbjct  90   QIDI  93



>emb|CDY19333.1| BnaC05g08420D [Brassica napus]
Length=587

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  85

Query  424  QINI  435
            +I I
Sbjct  86   EIPI  89



>emb|CDY20974.1| BnaA08g25510D [Brassica napus]
Length=585

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  424  QINI  435
            +I I
Sbjct  84   EIPI  87



>emb|CDX94774.1| BnaC07g17830D [Brassica napus]
Length=585

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  424  QINI  435
            +I I
Sbjct  84   EIPI  87



>emb|CAN77106.1| hypothetical protein VITISV_037096 [Vitis vinifera]
Length=600

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNY+SLPFC    NA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTDEQVTLWVNKVGPYNNPQETYNYFSLPFCHPPGNAGHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            QI++
Sbjct  88   QIDM  91



>gb|KJB79240.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=591

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            +Y+PDDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDSQI
Sbjct  32   QYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPAHKWGGLGEVLGGNELIDSQI  91

Query  430  NI  435
            +I
Sbjct  92   DI  93



>ref|XP_010547447.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=591

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S++  H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQVDEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQDGVHKWGGLGEVLGGNELIDS  89

Query  424  QINI  435
            +I+I
Sbjct  90   KIDI  93



>ref|XP_006417401.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
 gb|ESQ35754.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
Length=586

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSKNDVHKWGGLGEVLGGNELIDS  84

Query  424  QINI  435
            +I I
Sbjct  85   EIAI  88



>emb|CDY14555.1| BnaC03g49040D [Brassica napus]
Length=586

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  424  QINI  435
            +I I
Sbjct  84   EIPI  87



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKYK  D V LWVNKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  37   DHKYKSGDSVKLWVNKVGPYNNPQETYNYHSLPFCQPSENPGHKWGGLGEVLGGNELIDS  96

Query  424  QINI  435
            Q++I
Sbjct  97   QLDI  100



>ref|XP_009144405.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=585

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  424  QINI  435
            +I I
Sbjct  84   EIPI  87



>gb|KFK43390.1| hypothetical protein AALP_AA1G119800 [Arabis alpina]
Length=587

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  85

Query  424  QINI  435
            +I I
Sbjct  86   EIAI  89



>emb|CDY34667.1| BnaC08g42260D [Brassica napus]
Length=665

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  104  DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSHNDVHKWGGLGEVLGGNELIDS  163

Query  424  QINI  435
            +I I
Sbjct  164  EIPI  167



>ref|XP_010492170.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Camelina sativa]
Length=512

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            +I I
Sbjct  88   EIAI  91



>ref|XP_010458475.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=589

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            +I I
Sbjct  88   EIAI  91



>ref|XP_010492178.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Camelina sativa]
Length=589

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            +I I
Sbjct  88   EIAI  91



>gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Erythranthe guttata]
Length=583

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    NAPH+WGGLGEVLGGNELIDSQI
Sbjct  25   KYQDDEAVTLWVNKVGPYNNPQETYNYYSLPFCHLPGNAPHKWGGLGEVLGGNELIDSQI  84

Query  430  NI  435
            +I
Sbjct  85   DI  86



>ref|XP_009148436.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=590

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSLNDVHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            +I I
Sbjct  89   EIPI  92



>emb|CDX97924.1| BnaA06g06750D [Brassica napus]
Length=590

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSLNDVHKWGGLGEVLGGNELIDS  88

Query  424  QINI  435
            +I I
Sbjct  89   EIPI  92



>ref|XP_002269498.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI29766.3| unnamed protein product [Vitis vinifera]
Length=592

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFCR    A H+W GLGE+LGGNELI+S
Sbjct  32   DHKYQQNEPVTLWVNKVGPYNNPQETYNYYSLPFCRPPGKAVHKWIGLGELLGGNELIES  91

Query  424  QINI  435
            QI+I
Sbjct  92   QIDI  95



>ref|XP_006304923.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
 gb|EOA37821.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
Length=589

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSVNNVHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            +I I
Sbjct  88   EIAI  91



>ref|XP_002889842.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66101.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
            +I I
Sbjct  87   EIAI  90



>ref|XP_010665394.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI39323.3| unnamed protein product [Vitis vinifera]
Length=749

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNY+SLPFC    NA H+WGGLGEVLGGNELIDS
Sbjct  188  DHKYQTDEQVTLWVNKVGPYNNPQETYNYFSLPFCHPPGNAGHKWGGLGEVLGGNELIDS  247

Query  424  QINI  435
            QI++
Sbjct  248  QIDM  251



>emb|CDY34861.1| BnaA09g47870D [Brassica napus]
Length=586

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNY+SLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQADEQVTLWVNKVGPYNNPQETYNYFSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  84

Query  424  QINI  435
            +I I
Sbjct  85   EIPI  88



>ref|XP_002530674.1| endomembrane protein emp70, putative [Ricinus communis]
 gb|EEF31705.1| endomembrane protein emp70, putative [Ricinus communis]
Length=602

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNK+GPY NPQETYNYYSLPFC  S +A H+WGGLGEVLGGNELIDS
Sbjct  41   DHKYQQDESVTLWVNKIGPYNNPQETYNYYSLPFCHPSGSAGHKWGGLGEVLGGNELIDS  100

Query  424  QINI  435
            +I+I
Sbjct  101  KIDI  104



>ref|XP_006664390.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=580

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  432
            YK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDSQI+
Sbjct  25   YKVEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDSQID  84

Query  433  I  435
            I
Sbjct  85   I  85



>emb|CDY54580.1| BnaCnng27350D [Brassica napus]
Length=589

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  432
            Y+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDSQI+
Sbjct  31   YQGDEKVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSIHKWGGLGEVLGGNELIDSQID  90

Query  433  I  435
            I
Sbjct  91   I  91



>gb|AAB65482.1| endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis 
thaliana]
Length=589

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQAEEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            +I I
Sbjct  88   EIAI  91



>ref|XP_009404975.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=635

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH Y+ DD VTLWVNKVGPY NPQETYNYY LPFC+   NA H+WGGLGEVLGGN+L+DS
Sbjct  30   DHTYQNDDHVTLWVNKVGPYNNPQETYNYYILPFCQLPGNAAHKWGGLGEVLGGNQLVDS  89

Query  424  QINI  435
            QI I
Sbjct  90   QIEI  93



>ref|XP_008456054.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis melo]
Length=632

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC  S ++ H+WGGLGEVLGGNELIDS
Sbjct  71   DHKYQQDELVTLWVNKVGPYNNPQETYNYYSLPFCHPSGHSAHKWGGLGEVLGGNELIDS  130

Query  424  QINI  435
            QI I
Sbjct  131  QIEI  134



>ref|XP_004146261.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
 ref|XP_004159874.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
Length=593

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY  D+ VTLWVNKVGPY NPQETYNYYSLPFC  S ++ H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYLQDESVTLWVNKVGPYNNPQETYNYYSLPFCHPSGHSAHKWGGLGEVLGGNELIDS  91

Query  424  QINI  435
            QI I
Sbjct  92   QIEI  95



>ref|NP_563881.1| transmembrane nine 1 [Arabidopsis thaliana]
 sp|Q940G0.1|TMN1_ARATH RecName: Full=Transmembrane 9 superfamily member 1; AltName: 
Full=Endomembrane protein 12; AltName: Full=Transmembrane nine 
protein 1; Short=AtTMN1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL48237.1|AF446365_1 At1g10950/T19D16_13 [Arabidopsis thaliana]
 gb|AAK96857.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAL36263.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
 gb|AAM10098.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAP40425.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 gb|AEE28668.1| transmembrane nine 1 [Arabidopsis thaliana]
Length=589

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQAEEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  87

Query  424  QINI  435
            +I I
Sbjct  88   EIAI  91



>ref|XP_003629959.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AET04435.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=589

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 55/66 (83%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN--APHRWgglgevlggnelI  417
            DHKY+ DDPV LWVNKVGPY NPQETYNYYSLPFC  S    A H+WGGLGEVLGGNELI
Sbjct  26   DHKYQRDDPVNLWVNKVGPYNNPQETYNYYSLPFCHPSSTSAAAHKWGGLGEVLGGNELI  85

Query  418  DSQINI  435
            DSQI I
Sbjct  86   DSQIEI  91



>ref|XP_009404976.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=588

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH Y+ DD VTLWVNKVGPY NPQETYNYY LPFC+   NA H+WGGLGEVLGGN+L+DS
Sbjct  30   DHTYQNDDHVTLWVNKVGPYNNPQETYNYYILPFCQLPGNAAHKWGGLGEVLGGNQLVDS  89

Query  424  QINI  435
            QI I
Sbjct  90   QIEI  93



>ref|NP_001047104.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAD15485.1| putative transmembrane protein TM9SF3 (66.6 kD) [Oryza sativa 
Japonica Group]
 dbj|BAF09018.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAG90570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93963.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73381.1| hypothetical protein OsI_07622 [Oryza sativa Indica Group]
Length=590

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++ V LWVNKVGPY NPQETYNYYSLPFC  S N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQSEEKVMLWVNKVGPYNNPQETYNYYSLPFCHPSNNPVHKWGGLGEVLGGNELIDS  91

Query  424  QINI  435
            QI+I
Sbjct  92   QIDI  95



>gb|KGN57596.1| hypothetical protein Csa_3G222780 [Cucumis sativus]
Length=664

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY  D+ VTLWVNKVGPY NPQETYNYYSLPFC  S ++ H+WGGLGEVLGGNELIDS
Sbjct  103  DHKYLQDESVTLWVNKVGPYNNPQETYNYYSLPFCHPSGHSAHKWGGLGEVLGGNELIDS  162

Query  424  QINI  435
            QI I
Sbjct  163  QIEI  166



>ref|XP_007159578.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
 gb|ESW31572.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
Length=589

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAP--HRWgglgevlggnelI  417
            DHKY  D+PVTLWVNK+GPY NPQETYNYYSLPFC    NA   H+WGGLGEVLGGNELI
Sbjct  27   DHKYHRDEPVTLWVNKLGPYNNPQETYNYYSLPFCHPLSNASAGHKWGGLGEVLGGNELI  86

Query  418  DSQINI  435
            DSQI+I
Sbjct  87   DSQIDI  92



>ref|XP_009124655.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=627

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  432
            Y+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDSQI+
Sbjct  69   YQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSIHKWGGLGEVLGGNELIDSQID  128

Query  433  I  435
            I
Sbjct  129  I  129



>gb|EEE57172.1| hypothetical protein OsJ_07106 [Oryza sativa Japonica Group]
Length=568

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+ ++ V LWVNKVGPY NPQETYNYYSLPFC  S N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQSEEKVMLWVNKVGPYNNPQETYNYYSLPFCHPSNNPVHKWGGLGEVLGGNELIDS  91

Query  424  QINI  435
            QI+I
Sbjct  92   QIDI  95



>ref|XP_010533958.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Tarenaya hassleriana]
Length=598

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+  + V LWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQASERVALWVNKVGPYNNPQETYNYYSLPFCHASGNGVHKWGGLGEVLGGNELIDS  90

Query  424  QINI  435
            +I+I
Sbjct  91   EIDI  94



>ref|XP_007148532.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
 gb|ESW20526.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
Length=630

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH+Y+P++ V LWVNKVGPY NPQETYNYYSLPFCR   +  H+WGGLGEVLGGNELIDS
Sbjct  69   DHRYQPEEKVMLWVNKVGPYNNPQETYNYYSLPFCRPPGHPAHKWGGLGEVLGGNELIDS  128

Query  424  QINI  435
            Q+ I
Sbjct  129  QLEI  132



>ref|XP_003531298.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN48095.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  417
            DHKY+ D+PV LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEPVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  418  DSQINI  435
            DSQI I
Sbjct  87   DSQIEI  92



>gb|EYU22789.1| hypothetical protein MIMGU_mgv1a003460mg [Erythranthe guttata]
Length=583

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    NA H+WGGLGEV+GGNELIDSQI
Sbjct  25   KYQDDEAVTLWVNKVGPYNNPQETYNYYSLPFCHPPGNAAHKWGGLGEVIGGNELIDSQI  84

Query  430  NI  435
             I
Sbjct  85   EI  86



>ref|XP_006585219.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  417
            DHKY+ D+PV LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEPVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  418  DSQINI  435
            DSQI I
Sbjct  87   DSQIEI  92



>ref|XP_010475983.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=587

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DHKY+  + VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQDGEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  85

Query  424  QINI  435
            +I I
Sbjct  86   EIAI  89



>gb|EPS65883.1| hypothetical protein M569_08888, partial [Genlisea aurea]
Length=558

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  432
            Y+ D+ VTLWVNKVGPY NPQETYNYY+LPFC  S NA HRW GLGEVLGGNELIDSQI+
Sbjct  1    YQDDEAVTLWVNKVGPYNNPQETYNYYTLPFCHPSGNAAHRWAGLGEVLGGNELIDSQID  60

Query  433  I  435
            I
Sbjct  61   I  61



>gb|EMS58779.1| Transmembrane 9 superfamily member 3 [Triticum urartu]
Length=571

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            + +P +PV LWVNKVGPY NPQETYNYYSLPFC  +EN  H+WGGLGEVLGGNELIDSQI
Sbjct  21   RVRPQEPVKLWVNKVGPYNNPQETYNYYSLPFCLPAENPAHKWGGLGEVLGGNELIDSQI  80

Query  430  NI  435
            +I
Sbjct  81   DI  82



>ref|XP_011074960.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=578

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    NA H+WGGLGEVLGGNELIDSQI
Sbjct  25   KYQADETVTLWVNKVGPYNNPQETYNYYSLPFCHPPGNAAHKWGGLGEVLGGNELIDSQI  84

Query  430  NI  435
             I
Sbjct  85   EI  86



>ref|XP_001785045.1| predicted protein [Physcomitrella patens]
 gb|EDQ50160.1| predicted protein [Physcomitrella patens]
Length=590

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 54/66 (82%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  417
            DH+Y   DPV LWVNKVGPY NPQETYNYYSLPFC   A+ NA H+WGGLGEVL GNELI
Sbjct  28   DHRYGKGDPVMLWVNKVGPYNNPQETYNYYSLPFCSPGAAGNARHKWGGLGEVLEGNELI  87

Query  418  DSQINI  435
            DS++ I
Sbjct  88   DSEVEI  93



>ref|XP_004504187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cicer arietinum]
Length=591

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 55/66 (83%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  417
            DHKY+ DD V LWVNKVGPY NPQETYNYYSLPFC   +S  A H+WGGLGEVLGGNELI
Sbjct  28   DHKYQRDDQVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSATAAHKWGGLGEVLGGNELI  87

Query  418  DSQINI  435
            DSQI I
Sbjct  88   DSQIEI  93



>ref|XP_010682854.1| PREDICTED: transmembrane 9 superfamily member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRW  378
            DHKY+PD+ V LWVNKVGPY NPQETYNY+SLPFC       HRW
Sbjct  34   DHKYEPDEQVVLWVNKVGPYNNPQETYNYFSLPFCHPQGKVAHRW  78



>ref|XP_011009384.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
 ref|XP_011009385.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
Length=593

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  420
            DH+Y  ++PV LWVNKVGPY NPQETYNYYSLPFC  S + A H+WGGLGEVLGGNELID
Sbjct  30   DHRYGQEEPVKLWVNKVGPYNNPQETYNYYSLPFCHPSGDVATHKWGGLGEVLGGNELID  89

Query  421  SQINI  435
            SQI+I
Sbjct  90   SQIDI  94



>ref|XP_002304054.2| hypothetical protein POPTR_0003s011001g, partial [Populus trichocarpa]
 gb|EEE79033.2| hypothetical protein POPTR_0003s011001g, partial [Populus trichocarpa]
Length=485

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  420
            DH+Y  ++PV LWVNKVGPY NPQETYNYYSLPFC  S + A H+WGGLGEVLGGNELID
Sbjct  30   DHRYGQEEPVKLWVNKVGPYNNPQETYNYYSLPFCHPSGDVATHKWGGLGEVLGGNELID  89

Query  421  SQINI  435
            SQI+I
Sbjct  90   SQIDI  94



>gb|EMT08384.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=552

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            +YK  D V LWVNKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDSQ+
Sbjct  2    QYKAGDSVKLWVNKVGPYNNPQETYNYHSLPFCQPSENPGHKWGGLGEVLGGNELIDSQL  61

Query  430  NI  435
            +I
Sbjct  62   DI  63



>ref|XP_002984084.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
 gb|EFJ15096.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
Length=587

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR-ASENAPHRWgglgevlggnelID  420
            DHKY   D V LWVNKVGPY NPQETYNYYSLPFC+  + N  H+WGGLG VL GNELID
Sbjct  25   DHKYDIGDAVVLWVNKVGPYNNPQETYNYYSLPFCQPGNANPAHKWGGLGAVLEGNELID  84

Query  421  SQINI  435
            SQI+I
Sbjct  85   SQIDI  89



>emb|CDO97576.1| unnamed protein product [Coffea canephora]
Length=587

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  423
            DH+Y+ +D VTLWVNKVGPY NPQETYNY+SLPFC       H+WGGLGEVLGGNELIDS
Sbjct  27   DHRYQDEDKVTLWVNKVGPYNNPQETYNYFSLPFCHPDGTVSHKWGGLGEVLGGNELIDS  86

Query  424  QINI  435
             I+I
Sbjct  87   LIDI  90



>ref|XP_003524235.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN06492.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  417
            DHKY+ D+ V LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEQVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  418  DSQINI  435
            DSQ+ I
Sbjct  87   DSQLEI  92



>ref|XP_006384984.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP62781.1| endomembrane protein 70 [Populus trichocarpa]
Length=586

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  420
            DH+Y  ++ V LWVNKVGPY NPQETYNYYSLPFC  S N   H+WGGLGEVLGGNELID
Sbjct  28   DHRYGQEEAVKLWVNKVGPYNNPQETYNYYSLPFCHPSSNDGTHKWGGLGEVLGGNELID  87

Query  421  SQINI  435
            SQI++
Sbjct  88   SQIDL  92



>ref|XP_006580221.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  417
            DHKY+ D+ V LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEQVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  418  DSQINI  435
            DSQ+ I
Sbjct  87   DSQLEI  92



>ref|XP_002960054.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
 gb|EFJ37593.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
Length=586

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR-ASENAPHRWgglgevlggnelID  420
            DHKY   D V LWVNKVGPY NPQETYNYYSLPFC+  + N  H+WGGLG VL GNELID
Sbjct  25   DHKYDIGDAVVLWVNKVGPYNNPQETYNYYSLPFCQPGNANPAHKWGGLGAVLEGNELID  84

Query  421  SQINI  435
            SQI+I
Sbjct  85   SQIDI  89



>gb|EPS62158.1| hypothetical protein M569_12635, partial [Genlisea aurea]
Length=537

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  432
            Y+  + VTLWVNKVGPY NPQETYNYY+LPFC  S NA H+W GLGEVLGGNELIDSQI 
Sbjct  1    YQDGEAVTLWVNKVGPYNNPQETYNYYTLPFCHPSGNAAHKWAGLGEVLGGNELIDSQIK  60

Query  433  I  435
            I
Sbjct  61   I  61



>ref|XP_006367366.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=582

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  430  NI  435
            +I
Sbjct  84   DI  85



>ref|XP_004250432.1| PREDICTED: transmembrane 9 superfamily member 3 [Solanum lycopersicum]
Length=582

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  430  NI  435
            +I
Sbjct  84   DI  85



>ref|XP_009763454.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=582

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  430  NI  435
            +I
Sbjct  84   DI  85



>ref|XP_011028284.1| PREDICTED: transmembrane 9 superfamily member 1 [Populus euphratica]
Length=590

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  420
            DH++  D+ V LWVNKVGPY NPQETYNYYSLPFC  S N   H+WGGLGEVLGGNELID
Sbjct  27   DHRFGQDEAVKLWVNKVGPYNNPQETYNYYSLPFCHPSGNDGTHKWGGLGEVLGGNELID  86

Query  421  SQINI  435
            SQI++
Sbjct  87   SQIDL  91



>ref|XP_009113237.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Brassica rapa]
Length=570

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  432
            Y+ ++ VTL VNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDSQI+
Sbjct  12   YQANEQVTLLVNKVGPYNNPQETYNYYSLPFCRKNENSIHKWGGLGEVLGGNELIDSQID  71

Query  433  I  435
            I
Sbjct  72   I  72



>ref|XP_009593535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=320

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  430  NI  435
            +I
Sbjct  84   DI  85



>ref|XP_011096274.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=583

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    +  H+WGGLGEVLGGNELIDSQ+
Sbjct  25   KYQDDESVTLWVNKVGPYNNPQETYNYYSLPFCHPPGSPAHKWGGLGEVLGGNELIDSQL  84

Query  430  NI  435
             I
Sbjct  85   EI  86



>ref|XP_011395771.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
 gb|KFM22905.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
Length=591

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRAS--ENAPHRWgglgevlggnelID  420
            H+Y+  DP+TLWVNKVGPY NPQETYNYY LPFC+    E   H+WGGLGEVL GNELID
Sbjct  28   HRYEVGDPITLWVNKVGPYNNPQETYNYYLLPFCKPKPGETPRHKWGGLGEVLQGNELID  87

Query  421  SQINI  435
            SQ+++
Sbjct  88   SQVDM  92



>ref|XP_006648727.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=568

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  432
            Y+ ++ V LWVNKVGPY NPQETYNYYSLPFC  S+N  H+WGGLGEVLGGNELIDSQI+
Sbjct  13   YQVEEKVMLWVNKVGPYNNPQETYNYYSLPFCHPSDNPVHKWGGLGEVLGGNELIDSQID  72

Query  433  I  435
            I
Sbjct  73   I  73



>ref|XP_009631162.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=583

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ DDPVTLWVNK  PY NPQETY+YYSLPFCR ++   H+WGGLGEVLGGN+LIDS+I
Sbjct  25   KYQEDDPVTLWVNKAAPYNNPQETYSYYSLPFCRPAD-GDHKWGGLGEVLGGNDLIDSRI  83

Query  430  NI  435
            +I
Sbjct  84   HI  85



>ref|XP_007509634.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19437.1| predicted protein [Bathycoccus prasinos]
Length=629

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 6/51 (12%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR------ASENAPHRW  378
            DHKY   DP+ LWVNKVGPY NPQETYNYY LPFC+      AS+   H+W
Sbjct  31   DHKYASGDPIKLWVNKVGPYNNPQETYNYYELPFCKVEPKDGASKKPVHKW  81



>ref|XP_004241844.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=584

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ +D VTLWVNK  PY NPQETY+YYSLP+CR + +  H+WGGLG VLGGN+LIDS+I
Sbjct  25   KYQENDSVTLWVNKAAPYVNPQETYSYYSLPYCRPAADGDHKWGGLGGVLGGNDLIDSRI  84

Query  430  NI  435
            +I
Sbjct  85   DI  86



>gb|KIZ05019.1| Transmembrane 9 superfamily member 3, partial [Monoraphidium 
neglectum]
Length=198

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA--SENAPHRWgglgevlggnelI  417
            +H+Y   +PV LWVNKVGP+ NPQETYNYY+LP+C+A   E A H WGGLGEVL GNELI
Sbjct  28   NHRYADKEPVVLWVNKVGPFNNPQETYNYYALPYCKARPDEPAEHSWGGLGEVLQGNELI  87

Query  418  DSQINI  435
             SQ++I
Sbjct  88   HSQLDI  93



>ref|XP_005845268.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
 gb|EFN53166.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
Length=589

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC--RASENAPHRWgglgevlggnelI  417
            +H+Y+  D VTLWVNKVGPY NPQETYNYY LPFC  + ++   H+WGGLGEVL GNELI
Sbjct  26   NHRYQVGDVVTLWVNKVGPYNNPQETYNYYLLPFCKPKPADKTRHKWGGLGEVLQGNELI  85

Query  418  DSQINI  435
            DSQ+ +
Sbjct  86   DSQLEL  91



>ref|XP_001698971.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO99025.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=598

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRAS--ENAPHRWgglgevlggnelI  417
            +HKY   + V+LWVNKVGPY NPQETYNYY LPFC+ +  + A H WGGLGEVL GNELI
Sbjct  29   NHKYADKEQVSLWVNKVGPYNNPQETYNYYYLPFCKLNPKQRAEHSWGGLGEVLQGNELI  88

Query  418  DSQINI  435
            +SQ++I
Sbjct  89   NSQLDI  94



>ref|XP_005645983.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21439.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
Length=610

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC--RASENAPHRWgglgevlggnelID  420
            HKY   + V LWVNKVGPY NPQETYNYY LPFC  + ++ A H+WGGLGEVL GNELID
Sbjct  48   HKYNVGEQVRLWVNKVGPYNNPQETYNYYYLPFCKPKQADKAVHKWGGLGEVLQGNELID  107

Query  421  SQINI  435
            SQ+++
Sbjct  108  SQLDM  112



>gb|EWM22128.1| transmembrane 9 superfamily member 3 [Nannochloropsis gaditana]
Length=601

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            +HKY   D VTLWVNKVGPY+NP ETY YY LPFC+  E    R
Sbjct  30   NHKYAEGDEVTLWVNKVGPYHNPHETYEYYDLPFCKPVEGVETR  73



>ref|XP_002945998.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
 gb|EFJ52993.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
Length=596

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  417
            +HKY+  + V LWVNKVGPY NPQETYNYY LPFC+   +  A H WGGLGEVL GNELI
Sbjct  31   NHKYEDREKVNLWVNKVGPYNNPQETYNYYYLPFCKRHPALKAQHSWGGLGEVLQGNELI  90

Query  418  DSQINI  435
            +SQ++I
Sbjct  91   NSQLDI  96



>ref|XP_006643045.1| PREDICTED: solute carrier family 22 member 17-like [Lepisosteus 
oculatus]
Length=627

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            YK  DPVTL+VNKVGPY+NPQETY+YY+LP CR  E
Sbjct  32   YKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKE  67



>gb|KCW64445.1| hypothetical protein EUGRSUZ_G02063 [Eucalyptus grandis]
Length=581

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR  351
            +H+YK DD V L+VNKVGPYYNP ETY YYSLPFCR
Sbjct  23   EHRYKVDDAVPLYVNKVGPYYNPSETYGYYSLPFCR  58



>ref|XP_010066531.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Eucalyptus 
grandis]
 ref|XP_010066532.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Eucalyptus 
grandis]
 ref|XP_010066533.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Eucalyptus 
grandis]
 ref|XP_010066534.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Eucalyptus 
grandis]
Length=587

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR  351
            +H+YK DD V L+VNKVGPYYNP ETY YYSLPFCR
Sbjct  29   EHRYKVDDAVPLYVNKVGPYYNPSETYGYYSLPFCR  64



>ref|XP_009788011.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=583

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            KY+ DD VTLWVNK  PY NPQETY+YYSLPFCR ++    R
Sbjct  25   KYQEDDSVTLWVNKAAPYNNPQETYSYYSLPFCRPADGDHKR  66



>ref|XP_002509072.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70330.1| predicted protein [Micromonas sp. RCC299]
Length=613

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 4/49 (8%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRAS----ENAPHRW  378
            DHKY   D VTLWVNKVGP+ NPQETYNY+ LPFC+      +   H+W
Sbjct  23   DHKYLVGDAVTLWVNKVGPFNNPQETYNYHELPFCKVEGVDGKRPKHKW  71



>ref|XP_002956625.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
 gb|EFJ42227.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
Length=605

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            DH YK DDPV LW +KVGP+ NP ETY YYSLP+C+  +   H+
Sbjct  38   DHTYKVDDPVPLWASKVGPFTNPSETYEYYSLPYCQPKDGVKHK  81



>ref|XP_002939067.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004910820.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=589

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            D++YKP DPV ++VNKVGPY+NPQETY+YY LP C A E   H+
Sbjct  23   DNRYKPGDPVMMYVNKVGPYHNPQETYHYYQLPVC-APEQIRHK  65



>ref|XP_003061693.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54323.1| predicted protein [Micromonas pusilla CCMP1545]
Length=623

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRW  378
            +Y   D V LW NKVGPY NPQETYNY+ LPFCR + +  H+W
Sbjct  53   QYVLGDEVKLWANKVGPYNNPQETYNYHRLPFCRVNASPKHKW  95



>ref|XP_001689987.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDP09725.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=605

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            DH Y+PDD V LW +KVGP+ NP ETY YYSLP+C+  +   H+
Sbjct  38   DHSYQPDDKVPLWASKVGPFTNPSETYEYYSLPYCQPKDGVKHK  81



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YKPDDPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  29   DHRYKPDDPVPLYANKVGPFHNPSETYRYFDLPFC  63



>ref|XP_010884102.1| PREDICTED: transmembrane 9 superfamily member 1 [Esox lucius]
Length=612

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            YK  DPVTL+VNKVGPY+NPQETY+YY+LP CR  E
Sbjct  37   YKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKE  72



>ref|XP_007255923.1| PREDICTED: transmembrane 9 superfamily member 1 [Astyanax mexicanus]
Length=605

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            YK  DPVTL+VNKVGPY+NPQETY+YY+LP CR  E
Sbjct  30   YKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKE  65



>emb|CDQ70386.1| unnamed protein product [Oncorhynchus mykiss]
Length=595

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            YK  DPVTL+VNKVGPY+NPQETY+YY+LP CR  E
Sbjct  22   YKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKE  57



>ref|XP_006356503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=584

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  429
            KY+ +D VTLWVNKV PY NPQETY+YYSLP+CR  +   H+ GGLGEVLGGN LIDS+I
Sbjct  26   KYQENDSVTLWVNKVAPYVNPQETYSYYSLPYCRPGDGY-HKQGGLGEVLGGNALIDSRI  84

Query  430  NI  435
            +I
Sbjct  85   DI  86



>ref|XP_006849485.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
 gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            +HKYKP DPV L+VNKVGP++NP ETY Y+ LPFC
Sbjct  24   NHKYKPGDPVPLYVNKVGPFHNPSETYRYFDLPFC  58



>ref|NP_001003550.1| transmembrane 9 superfamily member 1 [Danio rerio]
 gb|AAH78291.1| Transmembrane 9 superfamily member 1 [Danio rerio]
Length=609

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            YK  DPV L+VNKVGPY+NPQETY+YY+LP CR  E
Sbjct  36   YKQGDPVVLYVNKVGPYHNPQETYHYYTLPVCRPKE  71



>ref|XP_001630700.1| predicted protein [Nematostella vectensis]
 gb|EDO38637.1| predicted protein [Nematostella vectensis]
Length=583

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            DH YK  + V LW+N VGPY+N QETYNYYSLPFCR  +
Sbjct  26   DHIYKDAEEVVLWMNTVGPYHNRQETYNYYSLPFCRGEK  64



>gb|AAF98161.1|AF269152_1 transmembrane protein TM9SF1 [Mus musculus]
Length=605

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YKP+DPV L+ NKVGP+ NP ETY Y+ LPFC
Sbjct  29   DHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFC  63



>ref|XP_006519679.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Mus 
musculus]
Length=503

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|NP_001012155.1| transmembrane 9 superfamily member 1 precursor [Rattus norvegicus]
 sp|Q66HF2.1|TM9S1_RAT RecName: Full=Transmembrane 9 superfamily member 1; Flags: Precursor 
[Rattus norvegicus]
 gb|AAH81891.1| Transmembrane 9 superfamily member 1 [Rattus norvegicus]
Length=589

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_011243511.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X3 [Mus 
musculus]
Length=474

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YKP+DPV L+ NKVGP+ NP ETY Y+ LPFC
Sbjct  46   DHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFC  80



>gb|ERE89416.1| transmembrane 9 superfamily member 1 isoform 2 [Cricetulus griseus]
Length=589

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_006252052.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Rattus 
norvegicus]
 ref|XP_006252053.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Rattus 
norvegicus]
 ref|XP_008768910.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Rattus 
norvegicus]
 gb|EDM14255.1| rCG23597, isoform CRA_a [Rattus norvegicus]
 gb|EDM14256.1| rCG23597, isoform CRA_a [Rattus norvegicus]
Length=606

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_006988599.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006988600.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Peromyscus 
maniculatus bairdii]
 ref|XP_006988601.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X3 [Peromyscus 
maniculatus bairdii]
 ref|XP_006988602.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X4 [Peromyscus 
maniculatus bairdii]
Length=606

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_003502106.1| PREDICTED: transmembrane 9 superfamily member 1 [Cricetulus griseus]
 ref|XP_003502107.1| PREDICTED: transmembrane 9 superfamily member 1 [Cricetulus griseus]
 ref|XP_007609248.1| PREDICTED: transmembrane 9 superfamily member 1 [Cricetulus griseus]
 gb|EGW11552.1| Transmembrane 9 superfamily member 1 [Cricetulus griseus]
 gb|ERE89415.1| transmembrane 9 superfamily member 1 isoform 2 [Cricetulus griseus]
Length=606

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_005370493.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Microtus 
ochrogaster]
 ref|XP_005370494.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Microtus 
ochrogaster]
Length=606

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|NP_083056.2| transmembrane 9 superfamily member 1 precursor [Mus musculus]
 ref|XP_006519675.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 ref|XP_006519676.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 ref|XP_006519677.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 ref|XP_006519678.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 sp|Q9DBU0.2|TM9S1_MOUSE RecName: Full=Transmembrane 9 superfamily member 1; Flags: Precursor 
[Mus musculus]
 gb|AAH17617.1| Tm9sf1 protein [Mus musculus]
 dbj|BAB23535.2| unnamed protein product [Mus musculus]
 dbj|BAE31250.1| unnamed protein product [Mus musculus]
 dbj|BAE31295.1| unnamed protein product [Mus musculus]
 gb|EDL36266.1| transmembrane 9 superfamily member 1, isoform CRA_a [Mus musculus]
 gb|EDL36267.1| transmembrane 9 superfamily member 1, isoform CRA_a [Mus musculus]
Length=606

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_005085662.1| PREDICTED: transmembrane 9 superfamily member 1 [Mesocricetus 
auratus]
Length=606

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_009827098.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV83668.1| hypothetical protein, variant [Aphanomyces astaci]
Length=608

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA  354
            H+Y+P D V  WVNK+GP+ NPQETY Y SLPFC+A
Sbjct  28   HEYEPKDEVVAWVNKIGPFNNPQETYTYNSLPFCKA  63



>ref|XP_009827097.1| hypothetical protein H257_04344 [Aphanomyces astaci]
 gb|ETV83667.1| hypothetical protein H257_04344 [Aphanomyces astaci]
Length=643

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA  354
            H+Y+P D V  WVNK+GP+ NPQETY Y SLPFC+A
Sbjct  28   HEYEPKDEVVAWVNKIGPFNNPQETYTYNSLPFCKA  63



>ref|XP_006036573.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Alligator 
sinensis]
 ref|XP_006036574.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Alligator 
sinensis]
Length=599

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            +YKP DPV L+VNKVGPY+NPQETY+YY LP C + E   H+
Sbjct  27   QYKPGDPVMLYVNKVGPYHNPQETYHYYQLPVC-SPEKIQHK  67



>emb|CDP05443.1| unnamed protein product [Coffea canephora]
Length=587

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DHKY   DPV L+VNKVGPY+NP ETY YY  PFC
Sbjct  27   DHKYNKGDPVPLYVNKVGPYHNPSETYPYYDFPFC  61



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            D +YKP+DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  29   DRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFC  63



>ref|XP_006424246.1| hypothetical protein CICLE_v10028069mg [Citrus clementina]
 gb|ESR37486.1| hypothetical protein CICLE_v10028069mg [Citrus clementina]
Length=595

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 3/45 (7%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRW  378
            DH+Y   DPV L VNKVGP  NP ETY YY LPFCR+    P +W
Sbjct  33   DHRYNAGDPVPLLVNKVGPLNNPSETYQYYDLPFCRSE---PIKW  74



>ref|XP_006259786.1| PREDICTED: transmembrane 9 superfamily member 1 [Alligator mississippiensis]
Length=599

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            +YKP DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  27   QYKPGDPVMLYVNKVGPYHNPQETYHYYQLPVC  59



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DHKYK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  28   DHKYKVGDPVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_005836386.1| hypothetical protein GUITHDRAFT_67884 [Guillardia theta CCMP2712]
 gb|EKX49406.1| hypothetical protein GUITHDRAFT_67884 [Guillardia theta CCMP2712]
Length=584

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR  351
             +Y  ++ VTLW NK+GPY NPQETY+YY+LPFCR
Sbjct  21   QRYTDNESVTLWANKIGPYENPQETYSYYTLPFCR  55



>ref|XP_003755940.1| PREDICTED: transmembrane 9 superfamily member 1 [Sarcophilus 
harrisii]
Length=605

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            Y+P DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  35   YQPGDPVMLYVNKVGPYHNPQETYHYYQLPVC  66



>ref|XP_008787888.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Phoenix 
dactylifera]
Length=555

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            D +YKP+DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  29   DRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFC  63



>ref|XP_009524748.1| hypothetical protein PHYSODRAFT_299515 [Phytophthora sojae]
 gb|EGZ22031.1| hypothetical protein PHYSODRAFT_299515 [Phytophthora sojae]
Length=606

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA  354
            H+Y P + V +WVNK+GP+ NPQETY Y +LPFCRA
Sbjct  27   HEYTPGEEVVVWVNKIGPFNNPQETYTYNTLPFCRA  62



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  30   DHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  64



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP E+Y YY LPFC
Sbjct  29   DHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFC  63



>ref|XP_001380199.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Monodelphis 
domestica]
 ref|XP_007479929.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Monodelphis 
domestica]
Length=605

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            Y+P DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  35   YQPGDPVMLYVNKVGPYHNPQETYHYYQLPVC  66



>emb|CBY17963.1| unnamed protein product [Oikopleura dioica]
Length=577

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN  363
            HKY+ D+ V LW+N VGPY+N QETY Y+SLPFC+  E+
Sbjct  19   HKYETDEHVQLWMNTVGPYHNRQETYEYFSLPFCKGEEH  57



>ref|XP_007439478.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Python bivittatus]
Length=113

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENA  366
            DH Y+  + V LW+N VGPY+N QETY Y+SLPFC  S+ +
Sbjct  46   DHTYQDKEEVVLWMNTVGPYHNRQETYKYFSLPFCGGSKKS  86



>ref|XP_008838041.1| PREDICTED: transmembrane 9 superfamily member 1 [Nannospalax 
galili]
 ref|XP_008838042.1| PREDICTED: transmembrane 9 superfamily member 1 [Nannospalax 
galili]
 ref|XP_008838043.1| PREDICTED: transmembrane 9 superfamily member 1 [Nannospalax 
galili]
 ref|XP_008838044.1| PREDICTED: transmembrane 9 superfamily member 1 [Nannospalax 
galili]
Length=606

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            +YK  DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  35   RYKAGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  28   DHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFC  62



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP E+Y YY LPFC
Sbjct  30   DHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFC  64



>ref|XP_008868877.1| hypothetical protein H310_05822 [Aphanomyces invadans]
 gb|ETW02272.1| hypothetical protein H310_05822 [Aphanomyces invadans]
Length=664

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA  354
            H+Y+P + V  WVNK+GP+ NPQETY Y SLPFC+A
Sbjct  84   HEYEPKEEVVAWVNKIGPFNNPQETYTYNSLPFCKA  119



>gb|EPY89936.1| importin-4 [Camelus ferus]
Length=1519

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            YK  DPV L+VNKVGPY+NPQETY+YY LP C + E   H+
Sbjct  20   YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC-SPEKIRHK  59



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  28   DHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFC  62



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  30   DHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  64



>gb|ELK32462.1| Importin-4 [Myotis davidii]
Length=1425

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YK  DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  112  YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC  143



>emb|CCA19624.1| endomembrane protein 70like protein putative [Albugo laibachii 
Nc14]
 emb|CCA22874.1| endomembrane protein 70like protein putative [Albugo laibachii 
Nc14]
Length=583

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR  351
            DH Y+  D V +WVNK+GPY NPQETY Y SLPFC+
Sbjct  3    DHSYRIGDNVVIWVNKIGPYNNPQETYTYNSLPFCK  38



>gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  27   DHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  61



>ref|XP_011407645.1| PREDICTED: transmembrane 9 superfamily member 1-like, partial 
[Amphimedon queenslandica]
Length=403

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            KYK D+ + L+VNKVGPYYNPQETY+YYSLP C   E   HR
Sbjct  26   KYKQDEKIVLYVNKVGPYYNPQETYHYYSLPVC-VPEKIEHR  66



>gb|KHN75714.1| Transmembrane 9 superfamily member 3 [Toxocara canis]
Length=581

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN  363
            DH Y+  D V LW+N VGPY N QETY Y+SLPFCR S++
Sbjct  22   DHIYRDGDEVVLWMNTVGPYNNRQETYTYFSLPFCRGSKH  61



>ref|XP_002903970.1| endomembrane protein 70-like protein, putative [Phytophthora 
infestans T30-4]
 gb|EEY55025.1| endomembrane protein 70-like protein, putative [Phytophthora 
infestans T30-4]
Length=605

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA  354
            H+Y P + V +WVNK+GP+ NPQETY Y +LPFCRA
Sbjct  26   HEYAPGEEVVVWVNKIGPFNNPQETYTYNTLPFCRA  61



>gb|ELK11218.1| Importin-4 [Pteropus alecto]
Length=1659

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YK  DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  35   YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC  66



>gb|KFO27482.1| Importin-4 [Fukomys damarensis]
Length=1660

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YK  DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_004139482.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
Length=593

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            +H+Y   DPV L+VNKVGP  NP ETY YY LPFCR     P +
Sbjct  31   NHQYNVGDPVPLFVNKVGPLTNPSETYQYYELPFCRPDPVVPKK  74



>ref|XP_005092501.1| PREDICTED: transmembrane 9 superfamily member 3-like [Aplysia 
californica]
Length=581

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            DH YK  D V LW+N VGPY+N QETY+Y+SLPFC+  +
Sbjct  24   DHLYKEGDEVVLWMNTVGPYHNRQETYSYFSLPFCKGQK  62



>gb|ELW69279.1| Importin-4 [Tupaia chinensis]
Length=1610

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YK  DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  36   YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC  67



>ref|XP_002290902.1| endomembrane protein EMP70 precusor [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92654.1| endomembrane protein EMP70 precusor [Thalassiosira pseudonana 
CCMP1335]
Length=610

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            HKYK  D V LWVNKVGPY NPQE Y YY LP+C
Sbjct  23   HKYKAGDKVDLWVNKVGPYANPQEAYEYYILPYC  56



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  30   DHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  64



>emb|CCI39562.1| unnamed protein product [Albugo candida]
Length=583

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR  351
            DH Y+  D V +WVNK+GPY NPQETY Y SLPFC+
Sbjct  3    DHAYRVGDDVIIWVNKIGPYNNPQETYTYNSLPFCK  38



>gb|EMP30576.1| Transmembrane 9 superfamily member 1 [Chelonia mydas]
Length=594

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +1

Query  250  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            +Y+P DPV L+VNKVGPY+NPQETY+YY LP C + E   H+
Sbjct  25   RYQPGDPVVLYVNKVGPYHNPQETYHYYQLPVC-SPEKIQHK  65



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  30   DHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  64



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHR  375
            DHK+KP   + L+ NKVGP+ NP ETY YY+LPFC+ ++   ++
Sbjct  31   DHKFKPGSDIMLYANKVGPFQNPTETYQYYNLPFCQPTDGKEYK  74



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC   +
Sbjct  23   DHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGD  61



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC   +
Sbjct  24   DHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGD  62



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  27   DHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  61



>gb|ERG85277.1| transmembrane 9 superfamily member 3 [Ascaris suum]
Length=592

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENA  366
            DH YK  + V LW+N VGPY N QETY Y+SLPFCR S+ +
Sbjct  33   DHIYKDGEEVVLWMNTVGPYSNRQETYTYFSLPFCRGSKQS  73



>ref|XP_006835458.1| PREDICTED: charged multivesicular body protein 4a-like isoform 
X1 [Chrysochloris asiatica]
Length=815

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  253  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            YK  DPV L+VNKVGPY+NPQETY+YY LP C
Sbjct  245  YKTGDPVILYVNKVGPYHNPQETYHYYQLPVC  276



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  65   DHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  99



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  27   DHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFC  61



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  244  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFC  348
            DH+YK  DPV L+ NKVGP++NP ETY Y+ LPFC
Sbjct  30   DHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFC  64



>ref|XP_002115408.1| hypothetical protein TRIADDRAFT_29152 [Trichoplax adhaerens]
 gb|EDV22253.1| hypothetical protein TRIADDRAFT_29152 [Trichoplax adhaerens]
Length=582

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  247  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASE  360
            HKYK  + V LW+N VGPY+N QETY Y+SLPFCR  +
Sbjct  26   HKYKDGEEVILWMNTVGPYHNRQETYEYFSLPFCRGKK  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564667271820