BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF017H13

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771774.1|  PREDICTED: U-box domain-containing protein 3...  96.3    3e-24   Nicotiana sylvestris
ref|XP_009588521.1|  PREDICTED: U-box domain-containing protein 3...  94.4    9e-24   Nicotiana tomentosiformis
ref|XP_010062525.1|  PREDICTED: U-box domain-containing protein 3...  88.6    1e-21   Eucalyptus grandis [rose gum]
ref|XP_010318173.1|  PREDICTED: U-box domain-containing protein 3...  92.8    1e-21   Solanum lycopersicum
gb|KDP22458.1|  hypothetical protein JCGZ_26289                       87.0    1e-21   Jatropha curcas
ref|XP_006358228.1|  PREDICTED: U-box domain-containing protein 3...  93.2    2e-21   Solanum tuberosum [potatoes]
ref|XP_006385122.1|  hypothetical protein POPTR_0004s24130g           87.8    4e-21   Populus trichocarpa [western balsam poplar]
gb|EYU20192.1|  hypothetical protein MIMGU_mgv1a026292mg              88.2    7e-21   Erythranthe guttata [common monkey flower]
ref|XP_011028464.1|  PREDICTED: U-box domain-containing protein 3...  86.7    1e-20   Populus euphratica
ref|XP_011028465.1|  PREDICTED: U-box domain-containing protein 3...  86.7    1e-20   Populus euphratica
ref|XP_002534671.1|  hypothetical protein RCOM_2090500                85.1    2e-20   Ricinus communis
ref|XP_010934652.1|  PREDICTED: U-box domain-containing protein 5...  88.2    2e-20   Elaeis guineensis
gb|AID16053.1|  putative universal stress protein                     81.6    2e-20   Catharanthus roseus [chatas]
ref|XP_011076423.1|  PREDICTED: U-box domain-containing protein 35    84.3    2e-20   Sesamum indicum [beniseed]
emb|CDP05368.1|  unnamed protein product                              86.3    3e-20   Coffea canephora [robusta coffee]
gb|KHG01292.1|  U-box domain-containing 35 -like protein              86.3    3e-20   Gossypium arboreum [tree cotton]
ref|XP_009768170.1|  PREDICTED: U-box domain-containing protein 3...  87.0    4e-20   Nicotiana sylvestris
ref|XP_006655773.1|  PREDICTED: U-box domain-containing protein 3...  87.8    6e-20   Oryza brachyantha
gb|KJB07882.1|  hypothetical protein B456_001G050300                  85.1    7e-20   Gossypium raimondii
gb|KJB07880.1|  hypothetical protein B456_001G050300                  85.1    7e-20   Gossypium raimondii
ref|XP_008809455.1|  PREDICTED: U-box domain-containing protein 5...  84.3    1e-19   Phoenix dactylifera
ref|XP_010275384.1|  PREDICTED: U-box domain-containing protein 3...  78.6    1e-19   Nelumbo nucifera [Indian lotus]
ref|NP_001056754.1|  Os06g0140800                                     85.1    1e-19   
ref|XP_008234434.1|  PREDICTED: U-box domain-containing protein 3...  85.1    2e-19   Prunus mume [ume]
ref|XP_008234435.1|  PREDICTED: U-box domain-containing protein 3...  85.1    2e-19   Prunus mume [ume]
ref|XP_007218920.1|  hypothetical protein PRUPE_ppa001518mg           85.1    2e-19   Prunus persica
gb|KDO45272.1|  hypothetical protein CISIN_1g003576mg                 86.7    2e-19   Citrus sinensis [apfelsine]
ref|XP_006490171.1|  PREDICTED: U-box domain-containing protein 3...  86.7    2e-19   Citrus sinensis [apfelsine]
emb|CBI38656.3|  unnamed protein product                              80.9    2e-19   Vitis vinifera
ref|XP_002266973.2|  PREDICTED: U-box domain-containing protein 3...  80.9    2e-19   Vitis vinifera
emb|CAN78862.1|  hypothetical protein VITISV_021538                   81.3    2e-19   Vitis vinifera
ref|XP_010109120.1|  U-box domain-containing protein 35               79.7    2e-18   
ref|XP_004964500.1|  PREDICTED: U-box domain-containing protein 3...  80.9    2e-18   Setaria italica
ref|XP_009607007.1|  PREDICTED: U-box domain-containing protein 3...  79.3    5e-18   
ref|XP_009607006.1|  PREDICTED: U-box domain-containing protein 3...  79.3    5e-18   Nicotiana tomentosiformis
ref|XP_010258804.1|  PREDICTED: U-box domain-containing protein 3...  76.6    6e-18   
ref|XP_008376381.1|  PREDICTED: U-box domain-containing protein 3...  80.9    8e-18   Malus domestica [apple tree]
ref|XP_008376383.1|  PREDICTED: U-box domain-containing protein 3...  80.9    8e-18   Malus domestica [apple tree]
ref|XP_008660730.1|  PREDICTED: U-box domain-containing protein 3...  80.1    1e-17   
ref|XP_009370502.1|  PREDICTED: U-box domain-containing protein 3...  80.1    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_009372840.1|  PREDICTED: U-box domain-containing protein 3...  80.1    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_003598188.1|  U-box domain-containing protein                  73.6    2e-17   Medicago truncatula
gb|KDO45278.1|  hypothetical protein CISIN_1g003576mg                 79.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_010321477.1|  PREDICTED: U-box domain-containing protein 3...  77.0    3e-17   
gb|KDO45277.1|  hypothetical protein CISIN_1g003576mg                 79.3    3e-17   Citrus sinensis [apfelsine]
ref|XP_002437797.1|  hypothetical protein SORBIDRAFT_10g002760        77.0    4e-17   
ref|XP_003557213.1|  PREDICTED: U-box domain-containing protein 3...  76.3    4e-17   Brachypodium distachyon [annual false brome]
ref|XP_006355617.1|  PREDICTED: U-box domain-containing protein 3...  76.3    5e-17   Solanum tuberosum [potatoes]
ref|XP_010321478.1|  PREDICTED: U-box domain-containing protein 3...  75.9    5e-17   
gb|KDO45273.1|  hypothetical protein CISIN_1g003576mg                 79.0    5e-17   Citrus sinensis [apfelsine]
gb|KDO45279.1|  hypothetical protein CISIN_1g003576mg                 79.0    6e-17   Citrus sinensis [apfelsine]
ref|XP_006490170.1|  PREDICTED: U-box domain-containing protein 3...  79.0    6e-17   Citrus sinensis [apfelsine]
gb|ABL85042.1|  serine threonine kinase                               76.6    6e-17   Brachypodium sylvaticum
ref|XP_010448470.1|  PREDICTED: U-box domain-containing protein 3...  78.2    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010438919.1|  PREDICTED: U-box domain-containing protein 3...  78.2    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006578363.1|  PREDICTED: U-box domain-containing protein 3...  74.7    8e-17   Glycine max [soybeans]
gb|KHN32504.1|  U-box domain-containing protein 35                    74.7    8e-17   Glycine soja [wild soybean]
ref|XP_007038299.1|  U-box domain-containing protein kinase famil...  73.2    9e-17   
ref|XP_006421586.1|  hypothetical protein CICLE_v10004338mg           78.2    9e-17   Citrus clementina [clementine]
ref|XP_004307786.2|  PREDICTED: U-box domain-containing protein 3...  78.2    1e-16   Fragaria vesca subsp. vesca
ref|XP_010038414.1|  PREDICTED: U-box domain-containing protein 3...  82.8    1e-16   Eucalyptus grandis [rose gum]
gb|EMT31075.1|  U-box domain-containing protein 35                    73.6    2e-16   
ref|XP_002867622.1|  kinase family protein                            75.1    2e-16   
ref|XP_010693732.1|  PREDICTED: U-box domain-containing protein 3...  73.6    3e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006283114.1|  hypothetical protein CARUB_v10004133mg           75.5    3e-16   Capsella rubella
ref|XP_008437017.1|  PREDICTED: U-box domain-containing protein 3...  73.6    4e-16   Cucumis melo [Oriental melon]
gb|EMS55617.1|  U-box domain-containing protein 35                    74.7    6e-16   Triticum urartu
ref|XP_009362703.1|  PREDICTED: U-box domain-containing protein 35    75.1    1e-15   Pyrus x bretschneideri [bai li]
gb|KGN50313.1|  hypothetical protein Csa_5G167050                     69.7    1e-15   
ref|XP_010546147.1|  PREDICTED: U-box domain-containing protein 52    70.1    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_003598187.1|  U-box domain-containing protein                  74.3    2e-15   Medicago truncatula
ref|XP_008391798.1|  PREDICTED: U-box domain-containing protein 3...  74.7    2e-15   
ref|XP_010548832.1|  PREDICTED: U-box domain-containing protein 5...  71.6    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_004499633.1|  PREDICTED: U-box domain-containing protein 3...  72.4    4e-15   Cicer arietinum [garbanzo]
ref|XP_010919905.1|  PREDICTED: U-box domain-containing protein 35    72.4    5e-15   Elaeis guineensis
ref|XP_004499628.1|  PREDICTED: U-box domain-containing protein 3...  72.4    6e-15   
ref|XP_006837329.1|  hypothetical protein AMTR_s00111p00076670        83.2    6e-15   
gb|KHN42779.1|  U-box domain-containing protein 35                    67.0    1e-14   Glycine soja [wild soybean]
ref|NP_194246.2|  U-box domain-containing protein kinase family p...  70.5    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803845.1|  PREDICTED: U-box domain-containing protein 52    72.0    2e-14   
ref|XP_010433679.1|  PREDICTED: U-box domain-containing protein 3...  68.9    3e-14   
emb|CDY16812.1|  BnaA09g05700D                                        73.6    4e-14   Brassica napus [oilseed rape]
ref|XP_008437015.1|  PREDICTED: U-box domain-containing protein 3...  68.9    6e-14   
ref|XP_009385227.1|  PREDICTED: U-box domain-containing protein 3...  73.9    8e-14   
ref|XP_006394493.1|  hypothetical protein EUTSA_v10005349mg           72.8    8e-14   
gb|KFK29004.1|  hypothetical protein AALP_AA7G076800                  67.4    9e-14   Arabis alpina [alpine rockcress]
emb|CDX92680.1|  BnaC07g39380D                                        68.2    1e-13   
ref|XP_002862537.1|  kinase family protein                            71.2    1e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_009137501.1|  PREDICTED: U-box domain-containing protein 3...  67.8    1e-13   
ref|XP_006413335.1|  hypothetical protein EUTSA_v10024396mg           66.6    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_002864738.1|  kinase family protein                            70.9    2e-13   
gb|KEH32844.1|  U-box kinase family protein                           63.2    2e-13   Medicago truncatula
emb|CDY11059.1|  BnaA03g47180D                                        67.4    2e-13   Brassica napus [oilseed rape]
ref|XP_006281721.1|  hypothetical protein CARUB_v10027877mg           70.9    2e-13   Capsella rubella
emb|CDX87220.1|  BnaC09g05350D                                        73.2    3e-13   
gb|KFK27907.1|  kinase family protein                                 71.6    4e-13   Arabis alpina [alpine rockcress]
emb|CDY16813.1|  BnaA09g05690D                                        72.8    4e-13   Brassica napus [oilseed rape]
gb|KEH21675.1|  U-box kinase family protein                           63.5    5e-13   Medicago truncatula
emb|CDY23059.1|  BnaC07g31280D                                        71.2    9e-13   Brassica napus [oilseed rape]
emb|CDY02135.1|  BnaA03g40320D                                        71.2    9e-13   
ref|XP_004143742.1|  PREDICTED: U-box domain-containing protein 3...  62.4    1e-12   
emb|CDY42871.1|  BnaAnng06960D                                        76.6    1e-12   Brassica napus [oilseed rape]
ref|XP_009130169.1|  PREDICTED: U-box domain-containing protein 52    76.6    1e-12   Brassica rapa
ref|XP_010555606.1|  PREDICTED: U-box domain-containing protein 3...  60.8    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_010555605.1|  PREDICTED: U-box domain-containing protein 3...  59.7    2e-12   Tarenaya hassleriana [spider flower]
ref|NP_001190588.1|  U-box domain-containing protein 52               73.2    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200963.1|  U-box domain-containing protein 52                  72.8    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137072.1|  PREDICTED: U-box domain-containing protein 52    68.9    4e-12   Brassica rapa
emb|CDY03375.1|  BnaC01g17070D                                        60.5    4e-12   
emb|CDX87221.1|  BnaC09g05360D                                        67.0    5e-12   
ref|XP_009138907.1|  PREDICTED: U-box domain-containing protein 35    60.1    6e-12   Brassica rapa
emb|CDY34347.1|  BnaA01g14500D                                        60.1    7e-12   Brassica napus [oilseed rape]
ref|XP_004499634.1|  PREDICTED: U-box domain-containing protein 3...  62.8    2e-11   Cicer arietinum [garbanzo]
ref|XP_011076521.1|  PREDICTED: U-box domain-containing protein 52    64.3    2e-11   
ref|XP_003522847.2|  PREDICTED: U-box domain-containing protein 3...  72.8    2e-11   Glycine max [soybeans]
ref|XP_010457459.1|  PREDICTED: U-box domain-containing protein 5...  63.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010483826.1|  PREDICTED: U-box domain-containing protein 52    63.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010443973.1|  PREDICTED: U-box domain-containing protein 5...  63.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008652693.1|  PREDICTED: U-box domain-containing protein 3...  56.2    3e-11   
ref|XP_008652691.1|  PREDICTED: U-box domain-containing protein 3...  56.2    4e-11   Zea mays [maize]
emb|CDX91574.1|  BnaC02g15860D                                        70.9    7e-11   
ref|XP_006279824.1|  hypothetical protein CARUB_v10028126mg           65.5    8e-11   Capsella rubella
gb|EYU20190.1|  hypothetical protein MIMGU_mgv1a001539mg              50.4    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_009401649.1|  PREDICTED: U-box domain-containing protein 3...  62.8    2e-10   
ref|XP_009401652.1|  PREDICTED: U-box domain-containing protein 3...  62.8    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001065387.1|  Os10g0561500                                     55.1    2e-10   
ref|XP_002460191.1|  hypothetical protein SORBIDRAFT_02g024310        53.9    2e-10   
ref|XP_009127317.1|  PREDICTED: putative U-box domain-containing ...  68.6    4e-10   Brassica rapa
ref|XP_007148720.1|  hypothetical protein PHAVU_005G0089001g          63.2    5e-10   Phaseolus vulgaris [French bean]
emb|CDY16329.1|  BnaA02g11330D                                        68.6    5e-10   Brassica napus [oilseed rape]
ref|XP_009119520.1|  PREDICTED: putative U-box domain-containing ...  64.3    5e-10   
emb|CDY00463.1|  BnaA10g08100D                                        64.3    6e-10   
gb|EAY79520.1|  hypothetical protein OsI_34648                        55.1    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_007038300.1|  U-box domain-containing protein kinase famil...  67.4    1e-09   
ref|XP_002865850.1|  kinase family protein                            64.3    2e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_010442610.1|  PREDICTED: putative U-box domain-containing ...  66.2    3e-09   Camelina sativa [gold-of-pleasure]
emb|CDX99935.1|  BnaC09g27700D                                        65.9    3e-09   
ref|XP_010546140.1|  PREDICTED: U-box domain-containing protein 5...  54.7    5e-09   Tarenaya hassleriana [spider flower]
emb|CDY00464.1|  BnaA10g08090D                                        65.1    5e-09   
emb|CAB36758.1|  putative Ser/Thr protein kinase                      65.1    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004986806.1|  PREDICTED: U-box domain-containing protein 3...  51.6    1e-08   
ref|XP_010690148.1|  PREDICTED: U-box domain-containing protein 3...  62.8    3e-08   
ref|XP_009119427.1|  PREDICTED: putative U-box domain-containing ...  62.4    4e-08   Brassica rapa
emb|CDY00461.1|  BnaA10g08120D                                        62.4    4e-08   
ref|XP_010482459.1|  PREDICTED: putative U-box domain-containing ...  62.4    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010482460.1|  PREDICTED: LOW QUALITY PROTEIN: putative U-b...  62.0    5e-08   
emb|CDY61455.1|  BnaC09g53040D                                        62.0    5e-08   Brassica napus [oilseed rape]
ref|XP_006401994.1|  hypothetical protein EUTSA_v10012716mg           58.9    5e-07   Eutrema salsugineum [saltwater cress]
emb|CDY42872.1|  BnaAnng06970D                                        58.2    5e-07   Brassica napus [oilseed rape]
ref|XP_010546139.1|  PREDICTED: U-box domain-containing protein 5...  50.1    6e-07   Tarenaya hassleriana [spider flower]
ref|XP_010546141.1|  PREDICTED: U-box domain-containing protein 5...  50.1    7e-07   Tarenaya hassleriana [spider flower]
ref|XP_010546142.1|  PREDICTED: U-box domain-containing protein 5...  49.7    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_010229350.1|  PREDICTED: U-box domain-containing protein 3...  45.1    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_010229348.1|  PREDICTED: U-box domain-containing protein 3...  45.1    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_010229351.1|  PREDICTED: U-box domain-containing protein 3...  44.7    4e-06   
ref|XP_010229353.1|  PREDICTED: U-box domain-containing protein 3...  44.7    4e-06   
ref|XP_010229349.1|  PREDICTED: U-box domain-containing protein 3...  44.7    4e-06   Brachypodium distachyon [annual false brome]
ref|XP_010229352.1|  PREDICTED: U-box domain-containing protein 3...  44.3    4e-06   
ref|XP_002865849.1|  predicted protein                                55.1    1e-05   
ref|NP_199940.1|  U-box domain-containing protein 53                  55.1    1e-05   
gb|ABF93477.1|  U-box domain containing protein, expressed            41.6    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048651.1|  Os03g0101200                                     41.2    3e-05   
ref|XP_006353585.1|  PREDICTED: U-box domain-containing protein 3...  52.8    5e-05   
ref|XP_006580498.1|  PREDICTED: U-box domain-containing protein 3...  51.2    2e-04   Glycine max [soybeans]
ref|XP_010696543.1|  PREDICTED: U-box domain-containing protein 3...  44.7    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696544.1|  PREDICTED: U-box domain-containing protein 3...  44.7    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006843200.1|  hypothetical protein AMTR_s00146p00100330        42.0    4e-04   
ref|XP_007160217.1|  hypothetical protein PHAVU_002G302700g           50.1    4e-04   Phaseolus vulgaris [French bean]
emb|CBI24063.3|  unnamed protein product                              43.5    5e-04   Vitis vinifera
ref|XP_010656705.1|  PREDICTED: U-box domain-containing protein 5...  42.7    8e-04   
ref|XP_010656706.1|  PREDICTED: U-box domain-containing protein 5...  42.7    8e-04   
ref|XP_010656707.1|  PREDICTED: U-box domain-containing protein 5...  42.7    8e-04   
ref|XP_004252067.1|  PREDICTED: U-box domain-containing protein 34    49.3    8e-04   Solanum lycopersicum



>ref|XP_009771774.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
 ref|XP_009771775.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
 ref|XP_009771776.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
 ref|XP_009771777.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
Length=815

 Score = 96.3 bits (238),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            EK  + ++++GL+A+ P  S  +AVAINGK KSKY V+WALDKFVPEGK+ FKLLHVRP 
Sbjct  3    EKDGVVTKVEGLSALNPLNSSTIAVAINGKKKSKYVVSWALDKFVPEGKVCFKLLHVRPC  62

Query  495  ISAVPTPMG  521
            I+ VPTPMG
Sbjct  63   ITGVPTPMG  71


 Score = 42.4 bits (98),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GNSIPISQVRDDV AAF K++E
Sbjct  69   PMGNSIPISQVRDDVVAAFRKDVE  92



>ref|XP_009588521.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
tomentosiformis]
 ref|XP_009588522.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
tomentosiformis]
Length=813

 Score = 94.4 bits (233),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            EK  + ++++GL+A+ P  S  +AVAINGK KSKY V+WAL+KFVPEGK+ FKLLHVRP 
Sbjct  3    EKGGVVTKVEGLSALNPLNSSTIAVAINGKRKSKYVVSWALNKFVPEGKVCFKLLHVRPC  62

Query  495  ISAVPTPMG  521
            I+ VPTPMG
Sbjct  63   ITGVPTPMG  71


 Score = 42.7 bits (99),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GNSIPISQVRDDV AAF K++E
Sbjct  69   PMGNSIPISQVRDDVVAAFRKDVE  92



>ref|XP_010062525.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 ref|XP_010062534.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 ref|XP_010062542.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 gb|KCW90868.1| hypothetical protein EUGRSUZ_A02915 [Eucalyptus grandis]
Length=806

 Score = 88.6 bits (218),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +3

Query  312  AEKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRP  491
            AE +   S+  G   +P  P L+VA+AI+GK  SKY V WALDKFVP+G++LFKLLHVRP
Sbjct  2    AENEITHSQ--GQLVLPSPPRLIVAIAIDGKRSSKYVVRWALDKFVPQGEVLFKLLHVRP  59

Query  492  VISAVPTPMG  521
             I+ VPTPMG
Sbjct  60   RITTVPTPMG  69


 Score = 40.8 bits (94),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GNSIP+SQVR+DVAAA+ KE+E
Sbjct  67   PMGNSIPLSQVREDVAAAYKKEME  90



>ref|XP_010318173.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum]
 ref|XP_010318174.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum]
Length=809

 Score = 92.8 bits (229),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            +++GL A+P   S  +AVAINGK KSKY V WALDKFV EGK+ FKLLHVRP I+ VPTP
Sbjct  11   KVEGLTALPLLNSSTIAVAINGKKKSKYVVKWALDKFVTEGKVCFKLLHVRPRITCVPTP  70

Query  516  MGEF  527
            MG F
Sbjct  71   MGSF  74


 Score = 36.6 bits (83),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ IPISQVR+DV AAF K++E
Sbjct  70   PMGSFIPISQVREDVVAAFRKDVE  93



>gb|KDP22458.1| hypothetical protein JCGZ_26289 [Jatropha curcas]
Length=812

 Score = 87.0 bits (214),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E + +  +PP+  L V +AING+SKSKY VNWAL+ F+ E K++FKLLHVRP I+AVPTP
Sbjct  8    ESEKILGLPPALPLTVGIAINGRSKSKYVVNWALENFIREEKVVFKLLHVRPKITAVPTP  67

Query  516  MG  521
            MG
Sbjct  68   MG  69


 Score = 42.4 bits (98),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GNSIPISQVRDDVAAA+ +E+E
Sbjct  67   PMGNSIPISQVRDDVAAAYKQEME  90



>ref|XP_006358228.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Solanum tuberosum]
 ref|XP_006358229.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Solanum tuberosum]
Length=809

 Score = 93.2 bits (230),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            EK  +  +++GL+A+P   S  +AVAINGK  SKY V WALDKFVPEGK+ FKLLHVRP 
Sbjct  4    EKDGVVIKVEGLSALPLLNSSTIAVAINGKKMSKYVVKWALDKFVPEGKVCFKLLHVRPR  63

Query  495  ISAVPTPMGEF  527
            I  VPTPMG F
Sbjct  64   IVGVPTPMGSF  74


 Score = 35.4 bits (80),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ IPI+QVR+DV AAF K++E
Sbjct  70   PMGSFIPIAQVREDVVAAFRKDVE  93



>ref|XP_006385122.1| hypothetical protein POPTR_0004s24130g [Populus trichocarpa]
 gb|ERP62919.1| hypothetical protein POPTR_0004s24130g [Populus trichocarpa]
Length=824

 Score = 87.8 bits (216),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
             +PPSP L V +AI+GK  SKY V WAL+KF+P+GK+ FKLLHV P I+AVPTPMG F
Sbjct  19   GLPPSPPLTVGIAIDGKGSSKYLVQWALEKFMPQGKVAFKLLHVCPKITAVPTPMGNF  76


 Score = 40.0 bits (92),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVRDDVAAA+ KE E
Sbjct  72   PMGNFIPISQVRDDVAAAYKKEKE  95



>gb|EYU20192.1| hypothetical protein MIMGU_mgv1a026292mg [Erythranthe guttata]
Length=795

 Score = 88.2 bits (217),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  327  LQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAV  506
              S+++GL  +PP P  VV +A++G  KSK  + WAL+KFVPEG + FKLLHVRPV+S +
Sbjct  5    FNSKVEGLYELPPPPYTVVGLAVSGSEKSKTIIKWALEKFVPEGVVHFKLLHVRPVVSRI  64

Query  507  PTPMGEF  527
            PTPMG +
Sbjct  65   PTPMGNY  71


 Score = 39.3 bits (90),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN I ISQVRDDVAAAF KEI+
Sbjct  67   PMGNYIQISQVRDDVAAAFRKEIQ  90



>ref|XP_011028464.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Populus euphratica]
Length=824

 Score = 86.7 bits (213),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
             +PPSP L V +AI+GK  SKY V WAL+KF+P+GK+ FKLLHV P I+AVPTPMG F
Sbjct  19   GLPPSPPLTVGIAIDGKRSSKYLVLWALEKFMPQGKVAFKLLHVCPKITAVPTPMGNF  76


 Score = 40.0 bits (92),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVRDDVAAA+ KE E
Sbjct  72   PMGNFIPISQVRDDVAAAYKKEKE  95



>ref|XP_011028465.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Populus euphratica]
Length=822

 Score = 86.7 bits (213),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
             +PPSP L V +AI+GK  SKY V WAL+KF+P+GK+ FKLLHV P I+AVPTPMG F
Sbjct  17   GLPPSPPLTVGIAIDGKRSSKYLVLWALEKFMPQGKVAFKLLHVCPKITAVPTPMGNF  74


 Score = 40.0 bits (92),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVRDDVAAA+ KE E
Sbjct  70   PMGNFIPISQVRDDVAAAYKKEKE  93



>ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus communis]
 gb|EEF27713.1| hypothetical protein RCOM_2090500 [Ricinus communis]
Length=364

 Score = 85.1 bits (209),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 9/72 (13%)
 Frame = +3

Query  312  AEKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRP  491
            AE KF          +PP P L V +AI+GK KSKY V WAL+KF+P+  ++FKLLHVRP
Sbjct  9    AENKF---------GLPPIPPLTVGIAIDGKRKSKYVVYWALEKFIPKENVVFKLLHVRP  59

Query  492  VISAVPTPMGEF  527
             I+AVPTPMG F
Sbjct  60   KITAVPTPMGNF  71


 Score = 40.8 bits (94),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQ+RDDVAAA+ KE+E
Sbjct  67   PMGNFIPVSQIRDDVAAAYRKEME  90



>ref|XP_010934652.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis]
 ref|XP_010934653.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis]
Length=804

 Score = 88.2 bits (217),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  327  LQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAV  506
            +Q   +  +++PPS  LVVAVA+NG   SKYAV WAL+KFVPEG+I F+LLHVRP I  V
Sbjct  3    IQEGEESQSSLPPS-FLVVAVAVNGSKNSKYAVRWALEKFVPEGRIFFRLLHVRPPIKMV  61

Query  507  PTPMGEF  527
            PTPMG +
Sbjct  62   PTPMGNY  68


 Score = 37.7 bits (86),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPIS VR+DVA+A+ KEIE
Sbjct  64   PMGNYIPISNVREDVASAYKKEIE  87



>gb|AID16053.1| putative universal stress protein, partial [Catharanthus roseus]
Length=148

 Score = 81.6 bits (200),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +3

Query  333  SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT  512
            + ++GL A+ P  S  VA+A+NG  KSKY V WAL+KF+PEG +LFKLL+VRP I AVPT
Sbjct  7    THVEGLEALAPLKS-SVAIAVNGSRKSKYIVQWALEKFIPEGVLLFKLLYVRPKIIAVPT  65

Query  513  PMG  521
            PMG
Sbjct  66   PMG  68


 Score = 43.9 bits (102),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GNSIPISQVRDDVA AF KE+E
Sbjct  66   PMGNSIPISQVRDDVATAFRKEME  89



>ref|XP_011076423.1| PREDICTED: U-box domain-containing protein 35 [Sesamum indicum]
Length=803

 Score = 84.3 bits (207),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  333  SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT  512
            ++++GL+ +PP    V  VA++G  KSKY V WAL+KFVPEG + F+LLHVRPVI+ +PT
Sbjct  7    NKVEGLDKLPPPAYSVAVVAVSGSRKSKYVVKWALEKFVPEGLVYFRLLHVRPVINRIPT  66

Query  513  PMGEF  527
            PMG  
Sbjct  67   PMGNL  71


 Score = 40.8 bits (94),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVRDDVA AF KE+E
Sbjct  67   PMGNLIPISQVRDDVATAFRKEVE  90



>emb|CDP05368.1| unnamed protein product [Coffea canephora]
Length=807

 Score = 86.3 bits (212),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  MPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            +PP+ +LV AVAING  KSKY V WALDKFVPEG++ FKLLHVRP I AVPTPMG  
Sbjct  15   LPPTSALV-AVAINGGKKSKYVVRWALDKFVPEGEVSFKLLHVRPKIIAVPTPMGNL  70


 Score = 38.9 bits (89),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI QVRDDV AAF KE+E
Sbjct  66   PMGNLIPIHQVRDDVVAAFRKEME  89



>gb|KHG01292.1| U-box domain-containing 35 -like protein [Gossypium arboreum]
Length=826

 Score = 86.3 bits (212),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  357  MPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            +PPSP+L + +AING  +SKY V WAL+KFVPEG ++FKLLHVR  I  VPTPMG  
Sbjct  15   LPPSPTLTIGIAINGNRESKYVVKWALEKFVPEGNVMFKLLHVRAKIKLVPTPMGNL  71


 Score = 38.9 bits (89),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +PISQVR+DVAAA+ KE+E
Sbjct  67   PMGNLLPISQVREDVAAAYKKELE  90



>ref|XP_009768170.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
Length=875

 Score = 87.0 bits (214),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  333  SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT  512
            S+M+G   M   PS VVA+AI+G   SKY V WALDKFVPEG+  F LLHVRP I+AVPT
Sbjct  38   SKMEGQGTMQSPPSSVVAIAISGNKNSKYVVKWALDKFVPEGETRFMLLHVRPEITAVPT  97

Query  513  PMGEF  527
            PMG  
Sbjct  98   PMGNL  102


 Score = 37.7 bits (86),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA AF KE+E
Sbjct  98   PMGNLIPIAQVREDVADAFRKEVE  121



>ref|XP_006655773.1| PREDICTED: U-box domain-containing protein 35-like [Oryza brachyantha]
Length=804

 Score = 87.8 bits (216),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            DGL    PS S  VA+A+NG   S++A+ WALDKFVPEG++LF++LHVRP+I  VPTPMG
Sbjct  12   DGLEMEAPSVS-TVAIAVNGSKSSRHALKWALDKFVPEGRVLFRILHVRPIIKMVPTPMG  70

Query  522  EF  527
             F
Sbjct  71   NF  72


 Score = 36.2 bits (82),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA A+ K++E
Sbjct  68   PMGNFIPITQVREDVATAYRKDVE  91



>gb|KJB07882.1| hypothetical protein B456_001G050300 [Gossypium raimondii]
Length=821

 Score = 85.1 bits (209),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  357  MPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            +PPSP+L + +AING  +SKY V WAL+KFVPEG ++FKLLHVR  I  +PTPMG  
Sbjct  14   LPPSPTLTIGIAINGNRESKYVVKWALEKFVPEGNVMFKLLHVRAKIKLIPTPMGNL  70


 Score = 38.9 bits (89),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +PISQVR+DVAAA+ KE+E
Sbjct  66   PMGNLLPISQVREDVAAAYKKELE  89



>gb|KJB07880.1| hypothetical protein B456_001G050300 [Gossypium raimondii]
 gb|KJB07881.1| hypothetical protein B456_001G050300 [Gossypium raimondii]
Length=819

 Score = 85.1 bits (209),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  357  MPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            +PPSP+L + +AING  +SKY V WAL+KFVPEG ++FKLLHVR  I  +PTPMG  
Sbjct  14   LPPSPTLTIGIAINGNRESKYVVKWALEKFVPEGNVMFKLLHVRAKIKLIPTPMGNL  70


 Score = 38.9 bits (89),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +PISQVR+DVAAA+ KE+E
Sbjct  66   PMGNLLPISQVREDVAAAYKKELE  89



>ref|XP_008809455.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008809457.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008809458.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008809459.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Phoenix dactylifera]
Length=804

 Score = 84.3 bits (207),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            ++PPS  LVVAVA+NG   SKYAV WAL+KFVPEG+  F+LLHVRP I  VPTPMG +
Sbjct  12   SLPPS-FLVVAVAVNGSKSSKYAVRWALEKFVPEGRNFFRLLHVRPPIKMVPTPMGNY  68


 Score = 38.9 bits (89),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPIS VR+DVAAA+ KEIE
Sbjct  64   PMGNYIPISDVREDVAAAYKKEIE  87



>ref|XP_010275384.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
 ref|XP_010275385.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=802

 Score = 78.6 bits (192),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            A+PP  SL VAVA++G  KS+  + WALDKF+ EG  LFKLLHVR VI+ VPTPMG
Sbjct  11   ALPPPSSLTVAVAVSGSKKSRLVLRWALDKFISEGATLFKLLHVRSVITKVPTPMG  66


 Score = 44.3 bits (103),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GNSIPISQVRDDVAAA+ KE+E
Sbjct  64   PMGNSIPISQVRDDVAAAYRKEVE  87



>ref|NP_001056754.1| Os06g0140800 [Oryza sativa Japonica Group]
 dbj|BAF18668.1| Os06g0140800 [Oryza sativa Japonica Group]
 dbj|BAG89620.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79961.1| hypothetical protein OsI_21572 [Oryza sativa Indica Group]
 gb|EEE65060.1| hypothetical protein OsJ_20070 [Oryza sativa Japonica Group]
Length=806

 Score = 85.1 bits (209),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            D L    PS S  VA+A+NG   SK+A+ WALDKFVPEGK+LF++LHVRP I  VPTPMG
Sbjct  12   DELEMEAPSVS-TVAIAVNGSRNSKHALKWALDKFVPEGKVLFQILHVRPTIKMVPTPMG  70

Query  522  EF  527
             F
Sbjct  71   NF  72


 Score = 37.7 bits (86),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA A+ KE+E
Sbjct  68   PMGNFIPITQVREDVATAYKKEVE  91



>ref|XP_008234434.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Prunus mume]
Length=810

 Score = 85.1 bits (209),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            PSP  +VA+AING  KSKY V WAL+KFVPEG + FKL+HVRP I+ VPTPMG  
Sbjct  19   PSPLSIVAIAINGNRKSKYIVRWALEKFVPEGNVFFKLIHVRPRITGVPTPMGNL  73


 Score = 37.7 bits (86),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQVR+DV AA+ KEIE
Sbjct  69   PMGNLIPLSQVREDVVAAYRKEIE  92



>ref|XP_008234435.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Prunus mume]
Length=808

 Score = 85.1 bits (209),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            PSP  +VA+AING  KSKY V WAL+KFVPEG + FKL+HVRP I+ VPTPMG  
Sbjct  19   PSPLSIVAIAINGNRKSKYIVRWALEKFVPEGNVFFKLIHVRPRITGVPTPMGNL  73


 Score = 37.7 bits (86),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQVR+DV AA+ KEIE
Sbjct  69   PMGNLIPLSQVREDVVAAYRKEIE  92



>ref|XP_007218920.1| hypothetical protein PRUPE_ppa001518mg [Prunus persica]
 gb|EMJ20119.1| hypothetical protein PRUPE_ppa001518mg [Prunus persica]
Length=810

 Score = 85.1 bits (209),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            PSP  +VA+AING  KSKY V WAL+KFVPEG + FKL+HVRP I+ VPTPMG  
Sbjct  19   PSPLSIVAIAINGNRKSKYIVRWALEKFVPEGNVFFKLIHVRPRITGVPTPMGNL  73


 Score = 37.7 bits (86),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQVR+DV AA+ KEIE
Sbjct  69   PMGNLIPLSQVREDVVAAYRKEIE  92



>gb|KDO45272.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=802

 Score = 86.7 bits (213),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPTP
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNRKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTP  61

Query  516  MGEF  527
            MG F
Sbjct  62   MGNF  65


 Score = 35.8 bits (81),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  61   PMGNFIPIEQVRDDVAAAYKQE  82



>ref|XP_006490171.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Citrus sinensis]
Length=802

 Score = 86.7 bits (213),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPTP
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNRKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTP  61

Query  516  MGEF  527
            MG F
Sbjct  62   MGNF  65


 Score = 35.8 bits (81),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  61   PMGNFIPIEQVRDDVAAAYKQE  82



>emb|CBI38656.3| unnamed protein product [Vitis vinifera]
Length=784

 Score = 80.9 bits (198),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            E K +  E   L    P PS  +AVAINGK KSKY V WAL+KFVPEG  +FK+LHVRP 
Sbjct  2    EAKEIIEEKQELALALPLPS-TIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPK  60

Query  495  ISAVPTPMG  521
            I++VPTPMG
Sbjct  61   ITSVPTPMG  69


 Score = 41.2 bits (95),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GNSIP+SQVRDDVAAA+++E+
Sbjct  67   PMGNSIPLSQVRDDVAAAYLEEM  89



>ref|XP_002266973.2| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Vitis vinifera]
 ref|XP_010662270.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Vitis vinifera]
Length=804

 Score = 80.9 bits (198),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            E K +  E   L    P PS  +AVAINGK KSKY V WAL+KFVPEG  +FK+LHVRP 
Sbjct  2    EAKEIIEEKQELALALPLPS-TIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPK  60

Query  495  ISAVPTPMG  521
            I++VPTPMG
Sbjct  61   ITSVPTPMG  69


 Score = 41.2 bits (95),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GNSIP+SQVRDDVAAA+++E+
Sbjct  67   PMGNSIPLSQVRDDVAAAYLEEM  89



>emb|CAN78862.1| hypothetical protein VITISV_021538 [Vitis vinifera]
Length=804

 Score = 81.3 bits (199),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            E K +  E   L    P PS  +AVAINGK KSKY V WAL+KFVPEG  +FK+LHVRP 
Sbjct  2    EAKEIIEEKQELALALPLPS-TIAVAINGKKKSKYVVRWALEKFVPEGLHMFKMLHVRPK  60

Query  495  ISAVPTPMG  521
            I++VPTPMG
Sbjct  61   ITSVPTPMG  69


 Score = 40.8 bits (94),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 17/23 (74%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GNSIP+SQVRDDVAAA+++E+
Sbjct  67   PMGNSIPLSQVRDDVAAAYLEEM  89



>ref|XP_010109120.1| U-box domain-containing protein 35 [Morus notabilis]
 gb|EXC20961.1| U-box domain-containing protein 35 [Morus notabilis]
Length=804

 Score = 79.7 bits (195),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  354  AMPPSPSLV-VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            A+P  P  V V +AING++KSK  V WALDKFVPEG ++FKL+HVRP I AVPT MG F
Sbjct  14   ALPTPPCYVNVGIAINGRNKSKDIVRWALDKFVPEGNVIFKLIHVRPRIVAVPTAMGNF  72


 Score = 39.3 bits (90),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEIE  585
            GN +P+SQVRDDVAAA++KE E
Sbjct  70   GNFVPLSQVRDDVAAAYVKETE  91



>ref|XP_004964500.1| PREDICTED: U-box domain-containing protein 35-like [Setaria italica]
Length=802

 Score = 80.9 bits (198),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VAVAI+G   S++A+ WALDKFVPEG++LF++LHVRP I+ VPTPMG F
Sbjct  21   VAVAISGSRSSRHALKWALDKFVPEGRVLFRILHVRPAITMVPTPMGNF  69


 Score = 37.7 bits (86),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVR+DVA+A+ KE E
Sbjct  65   PMGNFIPISQVREDVASAYRKEAE  88



>ref|XP_009607007.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Nicotiana tomentosiformis]
Length=844

 Score = 79.3 bits (194),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  333  SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT  512
            S+ +G   +    S VVA+AI+G   SKY V WALDKFVPEG+  F LLHVRP I+AVPT
Sbjct  7    SKTEGQGTVQSPTSSVVAIAISGNKNSKYVVKWALDKFVPEGETRFMLLHVRPEITAVPT  66

Query  513  PMGEF  527
            PMG  
Sbjct  67   PMGNL  71


 Score = 38.1 bits (87),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA AF KE+E
Sbjct  67   PMGNLIPIAQVREDVADAFRKEVE  90



>ref|XP_009607006.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Nicotiana tomentosiformis]
Length=875

 Score = 79.3 bits (194),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  333  SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT  512
            S+ +G   +    S VVA+AI+G   SKY V WALDKFVPEG+  F LLHVRP I+AVPT
Sbjct  38   SKTEGQGTVQSPTSSVVAIAISGNKNSKYVVKWALDKFVPEGETRFMLLHVRPEITAVPT  97

Query  513  PMGEF  527
            PMG  
Sbjct  98   PMGNL  102


 Score = 38.1 bits (87),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA AF KE+E
Sbjct  98   PMGNLIPIAQVREDVADAFRKEVE  121



>ref|XP_010258804.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=803

 Score = 76.6 bits (187),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E D   A+PPS SL VAVA++G  KS+  V WALDKF+PEG+ILFKLLHVR  I++VP  
Sbjct  5    ETDETLALPPS-SLTVAVAVSGSKKSRLVVRWALDKFIPEGRILFKLLHVRSRITSVPKL  63

Query  516  MG  521
            +G
Sbjct  64   VG  65


 Score = 40.8 bits (94),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEIE  585
            GNSIPISQVRDDVAAA+ KE++
Sbjct  65   GNSIPISQVRDDVAAAYKKEVK  86



>ref|XP_008376381.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Malus 
domestica]
 ref|XP_008376382.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Malus 
domestica]
Length=781

 Score = 80.9 bits (198),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +G+N  PP PS VV +AI+G   SKY V WALDKFVPEG + FKL+HVRP I+ VPTPMG
Sbjct  9    EGVNFSPP-PS-VVGIAISGDKNSKYIVRWALDKFVPEGNVFFKLIHVRPKITGVPTPMG  66


 Score = 36.2 bits (82),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ IPISQVR+DV AA+ KE+E
Sbjct  64   PMGSRIPISQVREDVVAAYRKEME  87



>ref|XP_008376383.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Malus 
domestica]
Length=778

 Score = 80.9 bits (198),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +G+N  PP PS VV +AI+G   SKY V WALDKFVPEG + FKL+HVRP I+ VPTPMG
Sbjct  9    EGVNFSPP-PS-VVGIAISGDKNSKYIVRWALDKFVPEGNVFFKLIHVRPKITGVPTPMG  66


 Score = 36.2 bits (82),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ IPISQVR+DV AA+ KE+E
Sbjct  64   PMGSRIPISQVREDVVAAYRKEME  87



>ref|XP_008660730.1| PREDICTED: U-box domain-containing protein 35-like [Zea mays]
Length=701

 Score = 80.1 bits (196),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +3

Query  360  PPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            PP+ S  VAVA++G   S++A+ WALDKFVPEG++LF++LHVRP I+ VPTPMG F
Sbjct  22   PPAVS-TVAVAVSGGRSSRHALKWALDKFVPEGRVLFRILHVRPAITMVPTPMGNF  76


 Score = 36.6 bits (83),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVR+DVA+A+ KE E
Sbjct  72   PMGNFIPISQVREDVASAYRKEEE  95



>ref|XP_009370502.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=778

 Score = 80.1 bits (196),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +G+N  PP PS VV +AI+G   SKY V WALDKFVPEG + FKL+HVRP I+ VPTPMG
Sbjct  9    EGVNFSPP-PS-VVGIAISGDKNSKYIVRWALDKFVPEGNVSFKLIHVRPRITGVPTPMG  66


 Score = 35.8 bits (81),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ IPISQVR+DV AA+ KE+E
Sbjct  64   PMGSRIPISQVREDVVAAYRKEME  87



>ref|XP_009372840.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
 ref|XP_009372841.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=778

 Score = 80.1 bits (196),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +G+N  PP PS VV +AI+G   SKY V WALDKFVPEG + FKL+HVRP I+ VPTPMG
Sbjct  9    EGVNFSPP-PS-VVGIAISGDKNSKYIVRWALDKFVPEGNVSFKLIHVRPRITGVPTPMG  66


 Score = 35.8 bits (81),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ IPISQVR+DV AA+ KE+E
Sbjct  64   PMGSRIPISQVREDVVAAYRKEME  87



>ref|XP_003598188.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES68439.1| U-box kinase family protein [Medicago truncatula]
Length=809

 Score = 73.6 bits (179),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  366  SPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S S VVA+AI G  KSKY V WAL+KFVPEG I+FKL+HV   I  VPTPMG
Sbjct  19   SSSSVVALAIKGNKKSKYVVQWALNKFVPEGMIIFKLIHVHAGIVGVPTPMG  70


 Score = 42.0 bits (97),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +PISQVRDDVAAA+ KEIE
Sbjct  68   PMGNMLPISQVRDDVAAAYKKEIE  91



>gb|KDO45278.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=458

 Score = 79.7 bits (195),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPTP
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNRKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTP  61

Query  516  MG  521
              
Sbjct  62   TS  63


 Score = 35.8 bits (81),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  69   PVGNFIPIEQVRDDVAAAYKQE  90



>ref|XP_010321477.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Solanum 
lycopersicum]
Length=879

 Score = 77.0 bits (188),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  333  SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT  512
            S+M+G   +    S VVA+AI G   S+Y V WAL+KF+PEG+  F LLHVRP I+AVPT
Sbjct  39   SKMEGQGTVQSPISSVVAMAITGNKNSRYVVKWALEKFIPEGETRFMLLHVRPEITAVPT  98

Query  513  PMGEF  527
            PMG  
Sbjct  99   PMGNL  103


 Score = 38.1 bits (87),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA AF KE+E
Sbjct  99   PMGNLIPIAQVREDVADAFRKEVE  122



>gb|KDO45277.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=572

 Score = 79.3 bits (194),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPTP
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNRKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTP  61


 Score = 35.8 bits (81),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  69   PVGNFIPIEQVRDDVAAAYKQE  90



>ref|XP_002437797.1| hypothetical protein SORBIDRAFT_10g002760 [Sorghum bicolor]
 gb|EER89164.1| hypothetical protein SORBIDRAFT_10g002760 [Sorghum bicolor]
Length=770

 Score = 77.0 bits (188),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VAVA++G   SK+A+ WALDKFVPEG++LF++LHV P I+ VPTPMG F
Sbjct  23   VAVAVSGGRSSKHALKWALDKFVPEGRVLFRILHVHPAITMVPTPMGNF  71


 Score = 37.4 bits (85),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVR+DVA+A+ KE E
Sbjct  67   PMGNFIPISQVREDVASAYRKEAE  90



>ref|XP_003557213.1| PREDICTED: U-box domain-containing protein 35-like [Brachypodium 
distachyon]
Length=836

 Score = 76.3 bits (186),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VA+A++G   S++A+ WALDKFVP G++LF++LHVRP I+ VPTPMG F
Sbjct  20   VAIAVSGSKSSRHALKWALDKFVPGGRVLFRILHVRPPITMVPTPMGNF  68


 Score = 38.1 bits (87),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVR+DVA+A+ +E+E
Sbjct  64   PMGNFIPISQVREDVASAYCEELE  87



>ref|XP_006355617.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum]
Length=847

 Score = 76.3 bits (186),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  333  SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT  512
            S+++G   +    S VVA+AI G   S+Y V WAL+KF+PEG+  F LLHVRP I+AVPT
Sbjct  7    SKIEGQGTIQSPISSVVAIAITGNKNSRYVVKWALEKFIPEGETRFMLLHVRPEITAVPT  66

Query  513  PMGEF  527
            PMG  
Sbjct  67   PMGNL  71


 Score = 38.1 bits (87),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA AF KE+E
Sbjct  67   PMGNLIPIAQVREDVADAFRKEVE  90



>ref|XP_010321478.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Solanum 
lycopersicum]
 ref|XP_004240245.2| PREDICTED: U-box domain-containing protein 35 isoform X2 [Solanum 
lycopersicum]
Length=839

 Score = 75.9 bits (185),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  339  MDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPM  518
            M+G   +    S VVA+AI G   S+Y V WAL+KF+PEG+  F LLHVRP I+AVPTPM
Sbjct  1    MEGQGTVQSPISSVVAMAITGNKNSRYVVKWALEKFIPEGETRFMLLHVRPEITAVPTPM  60

Query  519  GEF  527
            G  
Sbjct  61   GNL  63


 Score = 38.1 bits (87),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVR+DVA AF KE+E
Sbjct  59   PMGNLIPIAQVREDVADAFRKEVE  82



>gb|KDO45273.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
 gb|KDO45274.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=810

 Score = 79.0 bits (193),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPTP
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNRKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTP  61


 Score = 35.0 bits (79),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  69   PVGNFIPIEQVRDDVAAAYKQE  90



>gb|KDO45279.1| hypothetical protein CISIN_1g003576mg [Citrus sinensis]
Length=405

 Score = 79.0 bits (193),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPTP
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNRKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTP  61

Query  516  MG  521
              
Sbjct  62   TS  63


 Score = 35.4 bits (80),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  69   PVGNFIPIEQVRDDVAAAYKQE  90



>ref|XP_006490170.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Citrus sinensis]
Length=810

 Score = 79.0 bits (193),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPTP
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNRKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTP  61


 Score = 35.0 bits (79),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  69   PVGNFIPIEQVRDDVAAAYKQE  90



>gb|ABL85042.1| serine threonine kinase [Brachypodium sylvaticum]
Length=829

 Score = 76.6 bits (187),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VA+A++G   S++A+ WALDKFVP GK+LF++LHVRP I+ VPTPMG F
Sbjct  20   VAIAVSGSKSSRHALKWALDKFVPGGKVLFRILHVRPPITMVPTPMGNF  68


 Score = 37.4 bits (85),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVR+DVA+A+ +E+E
Sbjct  64   PMGNFIPISQVREDVASAYREELE  87



>ref|XP_010448470.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=832

 Score = 78.2 bits (191),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +3

Query  354  AMPPSPSL-VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            A+PP PSL  V VA++G SK+K  V WAL+KF PEG + FKLLH+ P+I++VPTPMG
Sbjct  10   ALPPPPSLYTVVVALSGSSKNKNVVTWALEKFAPEGNVGFKLLHIHPMITSVPTPMG  66


 Score = 35.4 bits (80),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  A+ +EI
Sbjct  64   PMGNAIPISEVRDDVVTAYRQEI  86



>ref|XP_010438919.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
 ref|XP_010438921.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=831

 Score = 78.2 bits (191),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +3

Query  354  AMPPSPSL-VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            A+PP PSL  V VA++G SK+K  V WAL+KF PEG + FKLLH+ P+I++VPTPMG
Sbjct  9    ALPPPPSLHTVVVALSGSSKNKNVVTWALEKFAPEGNVGFKLLHIHPMITSVPTPMG  65


 Score = 35.4 bits (80),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  A+ +EI
Sbjct  63   PMGNAIPISEVRDDVVTAYRQEI  85



>ref|XP_006578363.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Glycine max]
 ref|XP_006578364.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Glycine max]
Length=810

 Score = 74.7 bits (182),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E D  N    S S VVA+AI G  KSKY V WAL+KFVPEG I+FKL+HV   I  VPTP
Sbjct  6    EADANNMSQHSSSSVVALAIKGNKKSKYVVQWALNKFVPEGMIIFKLIHVHGGIKGVPTP  65

Query  516  MG  521
            +G
Sbjct  66   LG  67


 Score = 38.9 bits (89),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQVR+DVA AF KE+E
Sbjct  65   PLGNVIPLSQVRNDVATAFKKEVE  88



>gb|KHN32504.1| U-box domain-containing protein 35 [Glycine soja]
Length=810

 Score = 74.7 bits (182),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E D  N    S S VVA+AI G  KSKY V WAL+KFVPEG I+FKL+HV   I  VPTP
Sbjct  6    EADANNMSQHSSSSVVALAIKGNKKSKYVVQWALNKFVPEGMIIFKLIHVHGGIKGVPTP  65

Query  516  MG  521
            +G
Sbjct  66   LG  67


 Score = 38.9 bits (89),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQVR+DVA AF KE+E
Sbjct  65   PLGNVIPLSQVRNDVATAFKKEVE  88



>ref|XP_007038299.1| U-box domain-containing protein kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOY22800.1| U-box domain-containing protein kinase family protein isoform 
1 [Theobroma cacao]
Length=831

 Score = 73.2 bits (178),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            +K+ +++E + +  +PP P+L + +AING  KSKY V WAL+KF+ E  ++FKLLHVR  
Sbjct  3    KKEIVEAEGEPVPVLPPPPTLNIGIAINGNRKSKYVVKWALEKFITEENVMFKLLHVRAK  62

Query  495  ISAVPTPMGEF  527
            I+ VPTPMG F
Sbjct  63   ITTVPTPMGNF  73


 Score = 40.0 bits (92),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPISQVR+DVAAA+ KE+E
Sbjct  69   PMGNFIPISQVRNDVAAAYKKEVE  92



>ref|XP_006421586.1| hypothetical protein CICLE_v10004338mg [Citrus clementina]
 gb|ESR34826.1| hypothetical protein CICLE_v10004338mg [Citrus clementina]
Length=810

 Score = 78.2 bits (191),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 8/72 (11%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT-  512
            E+  +  +P SP+L VAVA+ G  KS+YAV WAL+KF+PEG  LFKLLHVRP I++VPT 
Sbjct  2    EVKDIVELPNSPALSVAVAVKGNKKSRYAVLWALEKFIPEGINLFKLLHVRPRITSVPTA  61

Query  513  -------PMGEF  527
                   P+G F
Sbjct  62   TSLAIGHPVGNF  73


 Score = 35.0 bits (79),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN IPI QVRDDVAAA+ +E
Sbjct  69   PVGNFIPIEQVRDDVAAAYKQE  90



>ref|XP_004307786.2| PREDICTED: U-box domain-containing protein 35-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011470050.1| PREDICTED: U-box domain-containing protein 35-like [Fragaria 
vesca subsp. vesca]
Length=815

 Score = 78.2 bits (191),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            PSP  +VA+AING  KSKY V WAL+KF+PEG   FKL+HVR  I+ +PTPMG  
Sbjct  22   PSPLSIVAIAINGNRKSKYIVKWALEKFIPEGNNFFKLIHVRARITGIPTPMGNL  76


 Score = 35.0 bits (79),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPIS+VR+DV AA+ K++E
Sbjct  72   PMGNLIPISEVREDVVAAYRKDME  95



>ref|XP_010038414.1| PREDICTED: U-box domain-containing protein 35-like [Eucalyptus 
grandis]
 gb|KCW46250.1| hypothetical protein EUGRSUZ_K00132 [Eucalyptus grandis]
Length=781

 Score = 82.8 bits (203),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S VVAVAINGK KSKY V WAL+ F+PEGK++FKL+HVR V+S+VPTPMG
Sbjct  18   SAVVAVAINGKRKSKYVVRWALENFIPEGKVVFKLIHVRAVLSSVPTPMG  67


 Score = 30.0 bits (66),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P G  IPI++VR+DV AA+ KE+
Sbjct  65   PMGIMIPITEVREDVIAAYRKEV  87



>gb|EMT31075.1| U-box domain-containing protein 35 [Aegilops tauschii]
Length=824

 Score = 73.6 bits (179),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  327  LQSEMDGLNA--MPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVIS  500
            +Q E  G  A  M  +    VA+A++G   S++A+ WALDKFVP G++LF++LHVRP I+
Sbjct  5    IQEEDSGETAPEMEAAGVSTVAIAVSGSRSSRHALKWALDKFVPGGRVLFRILHVRPPIT  64

Query  501  AVPTPMGEF  527
             VPTPMG +
Sbjct  65   MVPTPMGNY  73


 Score = 38.5 bits (88),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQVRDDVA+A+ +E+E
Sbjct  69   PMGNYIPVSQVRDDVASAYREELE  92



>ref|XP_002867622.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43881.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=832

 Score = 75.1 bits (183),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  V VA++G SKSKY V WAL+KF PEG + FKLLH+ P+I++VPTPMG
Sbjct  19   SRTVVVALSGSSKSKYVVTWALEKFAPEGNVGFKLLHIHPMITSVPTPMG  68


 Score = 37.0 bits (84),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  AF +EI
Sbjct  66   PMGNAIPISEVRDDVVTAFRQEI  88



>ref|XP_010693732.1| PREDICTED: U-box domain-containing protein 35-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score = 73.6 bits (179),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  351  NAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            N    S   V+A+A+NG +KSKY V W ++KF+PEGK+ FKLLHV P I+ VPTPMG  
Sbjct  9    NGKGSSDPRVIAIALNGGAKSKYIVRWIVEKFIPEGKVAFKLLHVFPKITGVPTPMGNL  67


 Score = 38.1 bits (87),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+ QVRDDVA A+ KEIE
Sbjct  63   PMGNLIPLPQVRDDVAVAYKKEIE  86



>ref|XP_006283114.1| hypothetical protein CARUB_v10004133mg [Capsella rubella]
 gb|EOA16012.1| hypothetical protein CARUB_v10004133mg [Capsella rubella]
Length=830

 Score = 75.5 bits (184),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            A+PP     V VA++G SKSK  V WAL+KF PEG + FKLLH+ P+I++VPTPMG
Sbjct  9    ALPPPSLYTVIVALSGSSKSKNVVTWALEKFAPEGNVGFKLLHIHPMITSVPTPMG  64


 Score = 35.8 bits (81),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  A+ +EI
Sbjct  62   PMGNAIPISEVRDDVVTAYRQEI  84



>ref|XP_008437017.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cucumis melo]
Length=808

 Score = 73.6 bits (179),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            PS S VVAVAI+GK  SKY + W+L+KF+PEG I FKLLH  P I++VPTPMG
Sbjct  16   PSSSPVVAVAISGKKNSKYIIRWSLEKFLPEGIIDFKLLHFFPRITSVPTPMG  68


 Score = 37.4 bits (85),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IP+SQVR+DVA A+ KEI
Sbjct  66   PMGNAIPVSQVREDVAVAYRKEI  88



>gb|EMS55617.1| U-box domain-containing protein 35 [Triticum urartu]
Length=826

 Score = 74.7 bits (182),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VA+A++G   S++A+ WALDKFVP G++LF++LHVRP I+ VPTPMG +
Sbjct  25   VAIAVSGSRSSRHALKWALDKFVPGGRVLFRILHVRPPITMVPTPMGNY  73


 Score = 35.8 bits (81),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +P+SQVRDDV +A+ +E+E
Sbjct  69   PMGNYLPVSQVRDDVTSAYREELE  92



>ref|XP_009362703.1| PREDICTED: U-box domain-containing protein 35 [Pyrus x bretschneideri]
Length=794

 Score = 75.1 bits (183),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +G   + PS   +V +A++G   SKY V WALDKFVPEG + FKL+HVR  I+ VPTPMG
Sbjct  8    EGGENIQPSSLSIVGIAVSGDRNSKYIVRWALDKFVPEGNVFFKLIHVRERITGVPTPMG  67

Query  522  EF  527
              
Sbjct  68   SL  69


 Score = 34.7 bits (78),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ +PISQVR+DV AA+ KE+E
Sbjct  65   PMGSLLPISQVREDVVAAYRKEME  88



>gb|KGN50313.1| hypothetical protein Csa_5G167050 [Cucumis sativus]
Length=857

 Score = 69.7 bits (169),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  351  NAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            N M    S VVAVAI+GK  SKY + W+L+KF+PEG I F+LLH  P I++VPTPMG
Sbjct  60   NHMLLPSSSVVAVAISGKKNSKYIIRWSLEKFLPEGIIDFRLLHFIPRITSVPTPMG  116


 Score = 40.0 bits (92),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPISQVR+DVAAA+ KEI
Sbjct  114  PMGNAIPISQVREDVAAAYRKEI  136



>ref|XP_010546147.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
 ref|XP_010546148.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
 ref|XP_010546149.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
 ref|XP_010546150.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
Length=826

 Score = 70.1 bits (170),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  V  AINGK +SKY V WAL+KF+PEG   FKL++VRP I++VPTPMG
Sbjct  23   SSAVIAAINGKKRSKYVVFWALEKFIPEGFTDFKLVYVRPPITSVPTPMG  72


 Score = 39.3 bits (90),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+IPIS+VRDDVA+A+ +E+E
Sbjct  70   PMGNTIPISEVRDDVASAYRQEVE  93



>ref|XP_003598187.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES68438.1| U-box kinase family protein [Medicago truncatula]
Length=797

 Score = 74.3 bits (181),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGE  524
            S VV +AI G  KSKY V WALDKFV EG  +FKL+HVR VI+ VPTPMGE
Sbjct  13   SSVVGLAIKGNKKSKYVVQWALDKFVHEGISIFKLIHVRAVITGVPTPMGE  63


 Score = 34.7 bits (78),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G  +P+SQVR+DVA AF +E+E
Sbjct  60   PMGEVLPLSQVRNDVATAFKREVE  83



>ref|XP_008391798.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=793

 Score = 74.7 bits (182),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +G   + PS   +V +A++G   SKY V WALDKFVPEG + FKL+HVR  I+ VPTPMG
Sbjct  8    EGGENIQPSSLSIVGIAVSGDRNSKYIVRWALDKFVPEGNVFFKLIHVRERITGVPTPMG  67

Query  522  EF  527
              
Sbjct  68   SL  69


 Score = 33.9 bits (76),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ IPIS+VR+DV AA+ KE+E
Sbjct  65   PMGSLIPISRVREDVVAAYRKEME  88



>ref|XP_010548832.1| PREDICTED: U-box domain-containing protein 52-like [Tarenaya 
hassleriana]
Length=812

 Score = 71.6 bits (174),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  369  PSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            PS  VA+AI+GK KSKY V WAL+KF+P+G   FKLL+VRP I  VPTPMG
Sbjct  18   PSKAVAIAISGKKKSKYIVFWALEKFIPDGVSSFKLLYVRPPILTVPTPMG  68


 Score = 37.0 bits (84),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+IPIS VRDDVA A+ +E+E
Sbjct  66   PMGNAIPISDVRDDVALAYKQEVE  89



>ref|XP_004499633.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cicer arietinum]
Length=806

 Score = 72.4 bits (176),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E D  N    S S  VA+AI G  KSKY V WAL+KFVPEG I+FKL+HV   I  VPTP
Sbjct  6    ETDQSNKTRYSSSSAVALAIKGSKKSKYVVQWALNKFVPEGMIIFKLIHVHAGIIGVPTP  65

Query  516  MG  521
            +G
Sbjct  66   LG  67


 Score = 35.4 bits (80),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G  +P+SQVR+DVAAA+ KE+E
Sbjct  65   PLGVVLPVSQVRNDVAAAYKKEVE  88



>ref|XP_010919905.1| PREDICTED: U-box domain-containing protein 35 [Elaeis guineensis]
Length=815

 Score = 72.4 bits (176),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +3

Query  339  MDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPM  518
            MD ++ + PS  L +AVA+NG   SKYA+ WAL+KFVP+ ++ F+LL+VR  I++VPTP 
Sbjct  1    MDEVDELSPS-VLTIAVAVNGSKNSKYALAWALEKFVPKRRVSFRLLYVRQKITSVPTPF  59

Query  519  GEF  527
            G +
Sbjct  60   GNY  62


 Score = 35.0 bits (79),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P+GN +PI  VRDDVA A+ KEI+
Sbjct  58   PFGNYLPIDDVRDDVALAYKKEIK  81



>ref|XP_004499628.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cicer arietinum]
 ref|XP_004499629.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cicer arietinum]
 ref|XP_004499630.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Cicer arietinum]
Length=797

 Score = 72.4 bits (176),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGE  524
            VV +AI G  KSKY V WALDKFV EG I FKL+HVR VI  VPTPMG+
Sbjct  15   VVGLAIKGNKKSKYVVQWALDKFVNEGVISFKLIHVRAVIKGVPTPMGD  63


 Score = 35.0 bits (79),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G+ +P+SQVR+DVA +F +EIE
Sbjct  60   PMGDVLPLSQVRNDVATSFKREIE  83



>ref|XP_006837329.1| hypothetical protein AMTR_s00111p00076670 [Amborella trichopoda]
 gb|ERN00183.1| hypothetical protein AMTR_s00111p00076670 [Amborella trichopoda]
Length=803

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +3

Query  327  LQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAV  506
            +Q E +     P SP L VA+ +NG   SKYAV WAL+KF+PEG+I FKLLHVRP I+ +
Sbjct  3    IQEEEETHIPQPLSP-LTVAIVVNGNRDSKYAVKWALEKFIPEGRISFKLLHVRPRITRI  61

Query  507  PTPMGEF  527
            PTPMG F
Sbjct  62   PTPMGNF  68



>gb|KHN42779.1| U-box domain-containing protein 35 [Glycine soja]
Length=799

 Score = 67.0 bits (162),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  366  SPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S S VVA+AI G  KSKY V  AL+KFVPEG I+FKL+HV   I  VPTP+G
Sbjct  5    SSSSVVALAIKGDKKSKYVVQCALNKFVPEGMIIFKLIHVHAGIKGVPTPLG  56


 Score = 39.3 bits (90),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IP+SQVR+DVA AF KE+E
Sbjct  54   PLGNVIPLSQVRNDVATAFKKEVE  77



>ref|NP_194246.2| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9SW11.2|PUB35_ARATH RecName: Full=U-box domain-containing protein 35; AltName: Full=Plant 
U-box protein 35; Includes: RecName: Full=E3 ubiquitin 
ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 gb|AEE85018.1| U-box domain-containing protein kinase family protein [Arabidopsis 
thaliana]
Length=835

 Score = 70.5 bits (171),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  V VA++G SKSKY V WA++KF  EG + FKLLH+ P+I++VPTPMG
Sbjct  19   SRTVVVALSGSSKSKYVVTWAIEKFATEGNVGFKLLHIHPMITSVPTPMG  68


 Score = 35.8 bits (81),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  A+ +EI
Sbjct  66   PMGNAIPISEVRDDVVTAYRQEI  88



>ref|XP_008803845.1| PREDICTED: U-box domain-containing protein 52 [Phoenix dactylifera]
Length=811

 Score = 72.0 bits (175),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +3

Query  339  MDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPM  518
            M+ ++ + PS  L +AVA+NG   SKYA+ WAL+KFVP+ ++ F LL+VRP I+ VPTP 
Sbjct  1    MEEVDELSPS-VLTIAVAVNGSKNSKYALAWALEKFVPKRRVSFSLLYVRPKITLVPTPF  59

Query  519  GEF  527
            G +
Sbjct  60   GNY  62


 Score = 33.5 bits (75),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P+GN +PI+ VRDD+A A+ +EI+
Sbjct  58   PFGNYLPINDVRDDIALAYKEEIK  81



>ref|XP_010433679.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Camelina 
sativa]
Length=831

 Score = 68.9 bits (167),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V VA++G SK+K  V WAL+KF PEG + FKLLH+ P+I++VPTPMG
Sbjct  19   VVVALSGSSKNKNVVTWALEKFAPEGNVGFKLLHIHPMITSVPTPMG  65


 Score = 35.4 bits (80),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  A+ +EI
Sbjct  63   PMGNAIPISEVRDDVVTAYRQEI  85



>emb|CDY16812.1| BnaA09g05700D [Brassica napus]
Length=797

 Score = 73.6 bits (179),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VVA+AINGK KSKY V WALDKF+PEG   FKLL+VRP ++ +PTPMG
Sbjct  25   VVALAINGKKKSKYVVFWALDKFIPEGFSDFKLLYVRPPVTYIPTPMG  72


 Score = 30.8 bits (68),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I I+++RDDV +A+ +E++
Sbjct  70   PMGNAISITELRDDVVSAYKQEVD  93



>ref|XP_008437015.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cucumis melo]
 ref|XP_008437016.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Cucumis melo]
Length=820

 Score = 68.9 bits (167),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEFDSY  536
            PS S VVAVAI+GK  SKY + W+L+KF+PEG I FKLLH  P I++VPTP   F  Y
Sbjct  16   PSSSPVVAVAISGKKNSKYIIRWSLEKFLPEGIIDFKLLHFFPRITSVPTPNCIFKLY  73


 Score = 35.0 bits (79),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEI  582
            GN+IP+SQVR+DVA A+ KEI
Sbjct  80   GNAIPVSQVREDVAVAYRKEI  100



>ref|XP_009385227.1| PREDICTED: U-box domain-containing protein 35-like [Musa acuminata 
subsp. malaccensis]
Length=786

 Score = 73.9 bits (180),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  318  KKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVI  497
            K F   EM+  N +       VA+AI+G  KSKY + WAL+KF  EG+++FKLLHVRP I
Sbjct  13   KDFSIGEMEEGNRLVHDSLSTVALAIDGTKKSKYVIQWALNKFRDEGRVMFKLLHVRPRI  72

Query  498  SAVPTPMGEF  527
              +PTPMG  
Sbjct  73   KMIPTPMGNL  82


 Score = 29.6 bits (65),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 1/22 (5%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKE  579
            P GN +P++QVR+DVA+A+ KE
Sbjct  78   PMGN-LPVNQVREDVASAYRKE  98



>ref|XP_006394493.1| hypothetical protein EUTSA_v10005349mg [Eutrema salsugineum]
 gb|ESQ31779.1| hypothetical protein EUTSA_v10005349mg [Eutrema salsugineum]
Length=846

 Score = 72.8 bits (177),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  PPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            PPSP+  VAVAINGK KSKY   WAL+KF+PEG   FKLL+VRP ++ +PTPMG
Sbjct  19   PPSPA--VAVAINGKKKSKYVAFWALEKFIPEGFSDFKLLYVRPPVTYIPTPMG  70


 Score = 30.4 bits (67),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I I+++RDDV +A+ +E++
Sbjct  68   PMGNAISITELRDDVVSAYKQEVD  91



>gb|KFK29004.1| hypothetical protein AALP_AA7G076800 [Arabis alpina]
Length=831

 Score = 67.4 bits (163),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  + VA++G  KSK  V WAL+KF PEG + FKL+H+ P I++VPTPMG
Sbjct  17   SHTIIVALSGSRKSKNVVTWALEKFAPEGNVYFKLIHIHPRITSVPTPMG  66


 Score = 35.8 bits (81),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  A+ +EI
Sbjct  64   PMGNAIPISEVRDDVVTAYKQEI  86



>emb|CDX92680.1| BnaC07g39380D [Brassica napus]
Length=808

 Score = 68.2 bits (165),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V VA++G  KSKY V WAL+KF PEG + FKLLH+ P I+ VPTPMG
Sbjct  19   VFVALSGSRKSKYVVTWALEKFGPEGNVGFKLLHIHPRITCVPTPMG  65


 Score = 34.7 bits (78),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VR+DV  A+ +EI
Sbjct  63   PMGNTIPISEVREDVVTAYRQEI  85



>ref|XP_002862537.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38795.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=846

 Score = 71.2 bits (173),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAINGK KSKY   WAL+KF+PEG   FKLL+VRP +S +PTPMG
Sbjct  24   VAVAINGKKKSKYVAFWALEKFIPEGFTDFKLLYVRPPVSYIPTPMG  70


 Score = 31.2 bits (69),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I +S++RDDV +A+ +E++
Sbjct  68   PMGNTISVSELRDDVVSAYKQEVD  91



>ref|XP_009137501.1| PREDICTED: U-box domain-containing protein 35-like [Brassica 
rapa]
Length=808

 Score = 67.8 bits (164),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V VA++G  KSKY V WAL+KF PEG + FKLLH+ P I+ VPTPMG
Sbjct  19   VFVALSGSRKSKYVVTWALEKFGPEGNVGFKLLHIHPRITCVPTPMG  65


 Score = 34.7 bits (78),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VR+DV  A+ +EI
Sbjct  63   PMGNTIPISEVREDVVTAYRQEI  85



>ref|XP_006413335.1| hypothetical protein EUTSA_v10024396mg [Eutrema salsugineum]
 gb|ESQ54788.1| hypothetical protein EUTSA_v10024396mg [Eutrema salsugineum]
Length=841

 Score = 66.6 bits (161),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  V VA++G  K+K  V WAL+KF PEG + FKLLH+ P I++VPTPMG
Sbjct  25   SHTVVVALSGSRKNKNVVTWALEKFAPEGNVGFKLLHIHPRITSVPTPMG  74


 Score = 35.8 bits (81),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV  A+ +EI
Sbjct  72   PMGNAIPISEVRDDVVTAYRQEI  94



>ref|XP_002864738.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40997.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score = 70.9 bits (172),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAINGK KSKY   WAL+KF+PEG   FKLL+VRP +S +PTPMG
Sbjct  24   VAVAINGKKKSKYVAFWALEKFIPEGFTDFKLLYVRPPVSYIPTPMG  70


 Score = 31.2 bits (69),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I +S++RDDV +A+ +E++
Sbjct  68   PMGNTISVSELRDDVVSAYKQEVD  91



>gb|KEH32844.1| U-box kinase family protein [Medicago truncatula]
Length=801

 Score = 63.2 bits (152),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  366  SPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVP  509
            S S VVA+AI G  KSKY V WAL+KFVPEG I+FKL+HV  V + +P
Sbjct  19   SSSSVVALAIKGNKKSKYVVQWALNKFVPEGMIIFKLIHVHAVGNMLP  66


 Score = 38.9 bits (89),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEIE  585
            GN +PISQVRDDVAAA+ KEIE
Sbjct  62   GNMLPISQVRDDVAAAYKKEIE  83



>emb|CDY11059.1| BnaA03g47180D [Brassica napus]
Length=812

 Score = 67.4 bits (163),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V VA++G  KSKY V WAL+KF PEG + FKLLH+ P I+ VPTPMG
Sbjct  23   VFVALSGSRKSKYVVTWALEKFGPEGNVGFKLLHIHPRITCVPTPMG  69


 Score = 34.3 bits (77),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VR+DV  A+ +EI
Sbjct  67   PMGNTIPISEVREDVVIAYRQEI  89



>ref|XP_006281721.1| hypothetical protein CARUB_v10027877mg [Capsella rubella]
 gb|EOA14619.1| hypothetical protein CARUB_v10027877mg [Capsella rubella]
Length=849

 Score = 70.9 bits (172),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V+AVAINGK KSKY   WAL+KF+PEG   FKLL+VRP ++ +PTPMG
Sbjct  23   VIAVAINGKKKSKYVAFWALEKFIPEGFSDFKLLYVRPPVTYIPTPMG  70


 Score = 30.8 bits (68),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I +S++RDDV +A+ +E++
Sbjct  68   PMGNAISVSELRDDVVSAYRQEVD  91



>emb|CDX87220.1| BnaC09g05350D [Brassica napus]
Length=827

 Score = 73.2 bits (178),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V+AVAINGK KSKY + WAL+KF+PEG   FKLL+VRP I+ +PTPMG
Sbjct  19   VIAVAINGKKKSKYPIFWALEKFIPEGFSDFKLLYVRPPITHIPTPMG  66


 Score = 28.5 bits (62),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I I+++R +V +A++KE++
Sbjct  64   PMGNAIMITELRHNVVSAYLKEVD  87



>gb|KFK27907.1| kinase family protein [Arabis alpina]
Length=855

 Score = 71.6 bits (174),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V+AVAINGK KSKY   WAL+KF+PEG   FKLL+VRP I+ +PTPMG
Sbjct  23   VIAVAINGKKKSKYVAFWALEKFIPEGFSDFKLLYVRPPITYIPTPMG  70


 Score = 29.3 bits (64),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I ++++RDDV +A+ +E++
Sbjct  68   PMGNAISVTELRDDVVSAYRQEMD  91



>emb|CDY16813.1| BnaA09g05690D [Brassica napus]
Length=830

 Score = 72.8 bits (177),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            V+AVAINGK KSKY + WAL+KF+PEG   FKLL+VRP I+ +PTPMG
Sbjct  19   VIAVAINGKKKSKYPIFWALEKFIPEGFSDFKLLYVRPPITHIPTPMG  66


 Score = 28.1 bits (61),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 9/24 (38%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I I+++R ++ +A++KE++
Sbjct  64   PMGNAIMITELRHNIVSAYLKEVD  87



>gb|KEH21675.1| U-box kinase family protein [Medicago truncatula]
Length=145

 Score = 63.5 bits (153),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  399  GKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            G  KSKY + WALDKFVP+G I+FKL+HV   I  VPTPMG F
Sbjct  24   GNKKSKYVLQWALDKFVPKGMIIFKLIHVHAGIVVVPTPMGNF  66


 Score = 37.4 bits (85),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +PISQV DDVAA + KEIE
Sbjct  62   PMGNFLPISQVCDDVAATYKKEIE  85



>emb|CDY23059.1| BnaC07g31280D [Brassica napus]
Length=848

 Score = 71.2 bits (173),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAINGK KSKY   WAL+KF+PEG   FKLL+VRP ++ +PTPMG
Sbjct  24   VAVAINGKKKSKYVAFWALEKFIPEGFSDFKLLYVRPPVTYIPTPMG  70


 Score = 28.9 bits (63),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 9/24 (38%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I ++++RDD+ +A+ +E++
Sbjct  68   PMGNAISVTELRDDLVSAYKQELD  91



>emb|CDY02135.1| BnaA03g40320D [Brassica napus]
Length=844

 Score = 71.2 bits (173),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAINGK KSKY   WAL+KF+PEG   FKLL+VRP ++ +PTPMG
Sbjct  24   VAVAINGKKKSKYVAFWALEKFIPEGFSDFKLLYVRPPVTYIPTPMG  70


 Score = 28.9 bits (63),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 9/24 (38%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I ++++RDD+ +A+ +E++
Sbjct  68   PMGNAISVTELRDDLVSAYKQELD  91



>ref|XP_004143742.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis sativus]
Length=836

 Score = 62.4 bits (150),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  351  NAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            N M    S VVAVAI+GK  SKY + W+L+KF+PEG I F+LLH  P I++VP  +G
Sbjct  11   NHMLLPSSSVVAVAISGKKNSKYIIRWSLEKFLPEGIIDFRLLHFIPRITSVPNAVG  67


 Score = 37.4 bits (85),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEI  582
            GN+IPISQVR+DVAAA+ KEI
Sbjct  67   GNAIPISQVREDVAAAYRKEI  87



>emb|CDY42871.1| BnaAnng06960D [Brassica napus]
Length=822

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            ++PP+PS  VAVAINGK KSKY   WAL+KF+PEG   FKL++VRP ++ +PTPMG
Sbjct  15   SLPPTPSPAVAVAINGKKKSKYVAFWALEKFIPEGFSDFKLIYVRPPVTYIPTPMG  70



>ref|XP_009130169.1| PREDICTED: U-box domain-containing protein 52 [Brassica rapa]
Length=855

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  354  AMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            ++PP+PS  VAVAINGK KSKY   WAL+KF+PEG   FKL++VRP ++ +PTPMG
Sbjct  15   SLPPTPSPAVAVAINGKKKSKYVAFWALEKFIPEGFSDFKLIYVRPPVTYIPTPMG  70



>ref|XP_010555606.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555607.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555608.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Tarenaya 
hassleriana]
Length=839

 Score = 60.8 bits (146),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +3

Query  354  AMPPSP-SLVVAVAINGKSKSKYAVNWALDKFVP-EGKILFKLLHVRPVISAVPTPMG  521
            A+P  P SL +A+A++G  KSK  V WA++KF   +G + F+L+HV P I++VPTPMG
Sbjct  9    ALPAPPTSLTIALALSGSKKSKNVVLWAIEKFASQQGNVDFRLIHVHPKITSVPTPMG  66


 Score = 38.5 bits (88),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+IPIS+VRDDVAAA+ +E++
Sbjct  64   PMGNAIPISEVRDDVAAAYRQEVK  87



>ref|XP_010555605.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Tarenaya 
hassleriana]
Length=876

 Score = 59.7 bits (143),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +3

Query  354  AMPPSP-SLVVAVAINGKSKSKYAVNWALDKFVP-EGKILFKLLHVRPVISAVPTPMG  521
            A+P  P SL +A+A++G  KSK  V WA++KF   +G + F+L+HV P I++VPTPMG
Sbjct  46   ALPAPPTSLTIALALSGSKKSKNVVLWAIEKFASQQGNVDFRLIHVHPKITSVPTPMG  103


 Score = 38.5 bits (88),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+IPIS+VRDDVAAA+ +E++
Sbjct  101  PMGNAIPISEVRDDVAAAYRQEVK  124



>ref|NP_001190588.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
 gb|AED97487.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
Length=860

 Score = 73.2 bits (178),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAINGK KSKY V WAL+KF+PEG   FKLL+VRP +S +PTPMG
Sbjct  24   VAVAINGKKKSKYVVFWALEKFIPEGFTDFKLLYVRPPVSYIPTPMG  70


 Score = 25.0 bits (53),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 8/24 (33%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G ++ +S++R+DV +A+ +E++
Sbjct  68   PMGIAVAVSELREDVVSAYKQELD  91



>ref|NP_200963.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
 sp|Q9FKG6.1|PUB52_ARATH RecName: Full=U-box domain-containing protein 52; AltName: Full=Plant 
U-box protein 52; Includes: RecName: Full=E3 ubiquitin 
ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 dbj|BAB08999.1| receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED97486.1| U-box domain-containing protein 52 [Arabidopsis thaliana]
Length=845

 Score = 72.8 bits (177),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAINGK KSKY V WAL+KF+PEG   FKLL+VRP +S +PTPMG
Sbjct  24   VAVAINGKKKSKYVVFWALEKFIPEGFTDFKLLYVRPPVSYIPTPMG  70


 Score = 25.0 bits (53),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 8/24 (33%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G ++ +S++R+DV +A+ +E++
Sbjct  68   PMGIAVAVSELREDVVSAYKQELD  91



>ref|XP_009137072.1| PREDICTED: U-box domain-containing protein 52 [Brassica rapa]
Length=844

 Score = 68.9 bits (167),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAINGK KSKY   WAL+KF+PEG   F LL+VRP ++ +PTPMG
Sbjct  24   VAVAINGKKKSKYVAFWALEKFIPEGFSDFTLLYVRPPVTYIPTPMG  70


 Score = 28.9 bits (63),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 9/24 (38%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I ++++RDD+ +A+ +E++
Sbjct  68   PMGNAISVTELRDDLVSAYKQELD  91



>emb|CDY03375.1| BnaC01g17070D [Brassica napus]
Length=1297

 Score = 60.5 bits (145),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  + VA++   K+K  V WAL+KF PE  + FKLLH+ P I++VPTPMG
Sbjct  21   SHTIFVALSESRKNKNVVTWALEKFAPEANVGFKLLHIHPRITSVPTPMG  70


 Score = 37.0 bits (84),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV AA+ +E+
Sbjct  68   PMGNTIPISEVRDDVVAAYRQEV  90



>emb|CDX87221.1| BnaC09g05360D [Brassica napus]
Length=736

 Score = 67.0 bits (162),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  387  VAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +AINGK KSKY V WAL+KFVP+G   FKLL+VRP I+ +PTPMG
Sbjct  28   LAINGKKKSKYVVFWALEKFVPDGFSDFKLLYVRPPITYIPTPMG  72


 Score = 30.8 bits (68),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I I +VRDDV +A+ ++++
Sbjct  70   PMGNAISIKEVRDDVVSAYRQDVD  93



>ref|XP_009138907.1| PREDICTED: U-box domain-containing protein 35 [Brassica rapa]
Length=840

 Score = 60.1 bits (144),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  V VA++   K+K  V WAL+KF PE  + FKLLH+ P I++VPTPMG
Sbjct  21   SHTVFVALSESRKNKNVVTWALEKFAPEANVGFKLLHIHPRITSVPTPMG  70


 Score = 37.0 bits (84),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV AA+ +E+
Sbjct  68   PMGNTIPISEVRDDVVAAYRQEV  90



>emb|CDY34347.1| BnaA01g14500D [Brassica napus]
Length=840

 Score = 60.1 bits (144),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            S  V VA++   K+K  V WAL+KF PE  + FKLLH+ P I++VPTPMG
Sbjct  21   SHTVFVALSESRKNKNVVTWALEKFAPEANVGFKLLHIHPRITSVPTPMG  70


 Score = 36.6 bits (83),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN+IPIS+VRDDV AA+ +E+
Sbjct  68   PMGNTIPISEVRDDVVAAYRQEV  90



>ref|XP_004499634.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Cicer arietinum]
Length=798

 Score = 62.8 bits (151),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVP  509
            E D  N    S S  VA+AI G  KSKY V WAL+KFVPEG I+FKL+HV  V   +P
Sbjct  6    ETDQSNKTRYSSSSAVALAIKGSKKSKYVVQWALNKFVPEGMIIFKLIHVHAVGVVLP  63


 Score = 32.7 bits (73),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEIE  585
            G  +P+SQVR+DVAAA+ KE+E
Sbjct  59   GVVLPVSQVRNDVAAAYKKEVE  80



>ref|XP_011076521.1| PREDICTED: U-box domain-containing protein 52 [Sesamum indicum]
Length=812

 Score = 64.3 bits (155),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 4/66 (6%)
 Frame = +3

Query  330  QSEMDGLNAMPPSP-SLVVAVAINGKSKSKYAVNWALDKFVPEG---KILFKLLHVRPVI  497
            ++ +DGLN + PS  S VV +AIN   +SKY + WAL+  +P+G   ++ FKL+HV P I
Sbjct  6    RANVDGLNGLRPSMVSSVVGIAINCGKRSKYVIRWALENLIPDGGPEQVCFKLIHVFPEI  65

Query  498  SAVPTP  515
            + VPTP
Sbjct  66   TTVPTP  71


 Score = 31.2 bits (69),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +1

Query  532  PISQVRDDVAAAFIKEIE  585
            P+SQVR+DVA AF KE+E
Sbjct  77   PVSQVRNDVATAFRKEVE  94



>ref|XP_003522847.2| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Glycine max]
Length=796

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +3

Query  336  EMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            E D  N    S S VVA+AI G  KSKY V WAL+KFVPEG I+FKL+HV   I  VPTP
Sbjct  6    EADANNMSQHSSSSVVALAIKGNKKSKYVVQWALNKFVPEGMIIFKLIHVHGGIKGVPTP  65

Query  516  MGEF  527
               F
Sbjct  66   STAF  69



>ref|XP_010457459.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
 ref|XP_010457466.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=849

 Score = 63.9 bits (154),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  393  INGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            INGK KSKY   WAL+KFVPEG   FKLL+VRP ++ +PTPMG
Sbjct  28   INGKKKSKYVAFWALEKFVPEGFSDFKLLYVRPPVTYIPTPMG  70


 Score = 31.2 bits (69),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I +S++RDDV +A+ +E++
Sbjct  68   PMGNAISVSELRDDVVSAYKQEVD  91



>ref|XP_010483826.1| PREDICTED: U-box domain-containing protein 52 [Camelina sativa]
 ref|XP_010483827.1| PREDICTED: U-box domain-containing protein 52 [Camelina sativa]
Length=849

 Score = 63.9 bits (154),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  393  INGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            INGK KSKY   WAL+KFVPEG   FKLL+VRP ++ +PTPMG
Sbjct  28   INGKKKSKYVAFWALEKFVPEGFSDFKLLYVRPPVTYIPTPMG  70


 Score = 31.2 bits (69),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I +S++RDDV +A+ +E++
Sbjct  68   PMGNAISVSELRDDVVSAYRQEVD  91



>ref|XP_010443973.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=849

 Score = 63.9 bits (154),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  393  INGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            INGK KSKY   WAL+KFVPEG   FKLL+VRP ++ +PTPMG
Sbjct  28   INGKKKSKYVAFWALEKFVPEGFSDFKLLYVRPPVTYIPTPMG  70


 Score = 31.2 bits (69),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN+I +S++RDDV +A+ +E++
Sbjct  68   PMGNAISVSELRDDVVSAYRQEVD  91



>ref|XP_008652693.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Zea mays]
Length=781

 Score = 56.2 bits (134),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  375  LVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            + + +A++    SKYAVNWAL  F    +I F L+HVR  ++ VPTPMG +
Sbjct  20   ITIGLAVSSSKSSKYAVNWALKNFGTRQRIRFMLIHVRQKVTLVPTPMGNY  70


 Score = 38.5 bits (88),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +P+ QVRDD+A+A+ KE+E
Sbjct  66   PMGNYVPVDQVRDDIASAYEKEVE  89



>ref|XP_008652691.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Zea mays]
Length=863

 Score = 56.2 bits (134),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  375  LVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            + + +A++    SKYAVNWAL  F    +I F L+HVR  ++ VPTPMG +
Sbjct  20   ITIGLAVSSSKSSKYAVNWALKNFGTRQRIRFMLIHVRQKVTLVPTPMGNY  70


 Score = 38.5 bits (88),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +P+ QVRDD+A+A+ KE+E
Sbjct  66   PMGNYVPVDQVRDDIASAYEKEVE  89



>emb|CDX91574.1| BnaC02g15860D [Brassica napus]
Length=798

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +3

Query  306  SFAEKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHV  485
            S+ E K       G N  PPS SL +AVAI+G +KSK  + WAL KF  E  I+FKL+H+
Sbjct  8    SYLEPKPALPVSTGSNHAPPSQSLTIAVAISGSTKSKNVLKWALKKFASEKNIVFKLIHI  67

Query  486  RPVISAVPTPMGEFDS  533
             P ++++PTP G   S
Sbjct  68   HPKLTSIPTPSGNIVS  83



>ref|XP_006279824.1| hypothetical protein CARUB_v10028126mg [Capsella rubella]
 gb|AFJ66208.1| hypothetical protein 34G24.6 [Capsella rubella]
 gb|EOA12722.1| hypothetical protein CARUB_v10028126mg [Capsella rubella]
Length=810

 Score = 65.5 bits (158),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 8/80 (10%)
 Frame = +3

Query  306  SFAEKKFLQ--------SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK  461
            SF +K FL         S+ D  +   PS  L +A+AI+G SKSK  V WAL+KF  +  
Sbjct  3    SFFKKSFLDTKPVVGQLSKKDSSDHASPSQPLTIAIAISGSSKSKNVVKWALNKFGSDKN  62

Query  462  ILFKLLHVRPVISAVPTPMG  521
            ++FKL+HV P ++++PTP G
Sbjct  63   VVFKLIHVHPKLTSLPTPSG  82


 Score = 27.7 bits (60),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN++PIS+  +DVAA + + +
Sbjct  80   PSGNTVPISEAPEDVAATYRQNV  102



>gb|EYU20190.1| hypothetical protein MIMGU_mgv1a001539mg [Erythranthe guttata]
Length=800

 Score = 50.4 bits (119),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPE---GKILFKLLHVRPVISAVPTPMG  521
            VVA+AI    KSK  + WA +  + +   G++ FKLLHV P I+ VPTPMG
Sbjct  13   VVALAITCSKKSKSVIKWASENLIQDEGFGQVSFKLLHVFPEITTVPTPMG  63


 Score = 42.0 bits (97),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI+QVRDDVAAA+ KEIE
Sbjct  61   PMGNGIPIAQVRDDVAAAYRKEIE  84



>ref|XP_009401649.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401650.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401651.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=803

 Score = 62.8 bits (151),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VA+AING S S++ V WAL+KF+  G ++FKLLHVR  I  VP+P+G  
Sbjct  15   VALAINGTSNSRHIVQWALNKFISGGGVMFKLLHVRSRIKMVPSPIGNL  63


 Score = 29.6 bits (65),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +P+ QV+DDVA+A+ KE E
Sbjct  59   PIGN-LPVEQVQDDVASAYKKEEE  81



>ref|XP_009401652.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=800

 Score = 62.8 bits (151),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VA+AING S S++ V WAL+KF+  G ++FKLLHVR  I  VP+P+G  
Sbjct  15   VALAINGTSNSRHIVQWALNKFISGGGVMFKLLHVRSRIKMVPSPIGNL  63


 Score = 29.6 bits (65),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +P+ QV+DDVA+A+ KE E
Sbjct  59   PIGN-LPVEQVQDDVASAYKKEEE  81



>ref|NP_001065387.1| Os10g0561500 [Oryza sativa Japonica Group]
 gb|AAK31267.1|AC079890_3 putative protein kinase [Oryza sativa Japonica Group]
 gb|ABB47985.2| U-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27224.1| Os10g0561500 [Oryza sativa Japonica Group]
 gb|EAZ16979.1| hypothetical protein OsJ_32463 [Oryza sativa Japonica Group]
Length=782

 Score = 55.1 bits (131),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  PSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            P++ V +A++    SKYAV WA+  F   G + F L+HV   I+ VPTPMG +
Sbjct  12   PTVTVGLAVSSSKSSKYAVQWAVKNFCTNGMVRFVLIHVLQRITTVPTPMGNY  64


 Score = 37.0 bits (84),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI +VR D+A+A++KE+E
Sbjct  60   PMGNYIPIDKVRADIASAYVKEVE  83



>ref|XP_002460191.1| hypothetical protein SORBIDRAFT_02g024310 [Sorghum bicolor]
 gb|EER96712.1| hypothetical protein SORBIDRAFT_02g024310 [Sorghum bicolor]
Length=835

 Score = 53.9 bits (128),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +3

Query  330  QSEMDGLNAMPPS-PSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAV  506
            Q E     + P S P + + +A++    SKYAV WAL  F    +  F L+HVR  ++ V
Sbjct  4    QEETVVTESSPSSDPPITIGLAVSSSKSSKYAVRWALKNFGTRKRTRFMLIHVRQKVTLV  63

Query  507  PTPMGEF  527
            PTPMG +
Sbjct  64   PTPMGNY  70


 Score = 37.7 bits (86),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN +P+ QVRDD+A+A+ KE+E
Sbjct  66   PMGNYVPVDQVRDDIASAYEKEVE  89



>ref|XP_009127317.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
Length=791

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +3

Query  306  SFAEKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHV  485
            S+ E K       G N   PS SL VAVAI+G +KSK  + WAL KF  E  I+FKL+H+
Sbjct  8    SYLEPKPAVPVSTGSNHASPSQSLTVAVAISGSTKSKNVLKWALKKFASEKNIIFKLIHI  67

Query  486  RPVISAVPTPMGEFDS  533
             P ++++PTP G   S
Sbjct  68   HPKLTSIPTPSGNIVS  83



>ref|XP_007148720.1| hypothetical protein PHAVU_005G0089001g, partial [Phaseolus vulgaris]
 gb|ESW20714.1| hypothetical protein PHAVU_005G0089001g, partial [Phaseolus vulgaris]
Length=67

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  384  AVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            A+AI G  KSKY V WAL+KFVPEG I+FKL+HV   I  VPTP
Sbjct  24   ALAIKGNKKSKYVVQWALNKFVPEGMIIFKLIHVHANIQGVPTP  67



>emb|CDY16329.1| BnaA02g11330D [Brassica napus]
Length=792

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +3

Query  306  SFAEKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHV  485
            S+ E K       G N   PS SL VAVAI+G +KSK  + WAL KF  E  I+FKL+H+
Sbjct  8    SYLEPKPAVPVSTGSNHASPSQSLTVAVAISGSTKSKNVLKWALKKFASEKNIIFKLIHI  67

Query  486  RPVISAVPTPMGEFDS  533
             P ++++PTP G   S
Sbjct  68   HPKLTSIPTPSGNIVS  83



>ref|XP_009119520.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
Length=125

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 8/80 (10%)
 Frame = +3

Query  309  FAEKKFLQSE--MD------GLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKI  464
            F +K +L+++  +D      G +   PS SL +AVA++G +KSK  + WAL KF  +  +
Sbjct  4    FFKKSYLETKPVLDQVPTKAGSDVASPSQSLTIAVALSGSTKSKNVLKWALRKFSSDKNV  63

Query  465  LFKLLHVRPVISAVPTPMGE  524
            +FKL+HV P I++VPTP G+
Sbjct  64   IFKLIHVHPKITSVPTPSGK  83



>emb|CDY00463.1| BnaA10g08100D [Brassica napus]
Length=139

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 8/80 (10%)
 Frame = +3

Query  309  FAEKKFLQSE--MD------GLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKI  464
            F +K +L+++  +D      G +   PS SL +AVA++G +KSK  + WAL KF  +  +
Sbjct  4    FFKKSYLETKPVLDQVPTKAGSDVASPSQSLTIAVALSGSTKSKNVLKWALRKFSSDKNV  63

Query  465  LFKLLHVRPVISAVPTPMGE  524
            +FKL+HV P I++VPTP G+
Sbjct  64   IFKLIHVHPKITSVPTPSGK  83



>gb|EAY79520.1| hypothetical protein OsI_34648 [Oryza sativa Indica Group]
Length=782

 Score = 55.1 bits (131),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  369  PSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            P++ V +A++    SKYAV WA+  F   G + F L+HV   I+ VPTPMG +
Sbjct  12   PTVTVGLAVSSSKSSKYAVQWAVKNFCTNGMVRFVLIHVLQRITTVPTPMGNY  64


 Score = 34.3 bits (77),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN IPI +VR D+A+A+ KE+E
Sbjct  60   PMGNYIPIDKVRADIASAYEKEVE  83



>ref|XP_007038300.1| U-box domain-containing protein kinase family protein isoform 
2 [Theobroma cacao]
 gb|EOY22801.1| U-box domain-containing protein kinase family protein isoform 
2 [Theobroma cacao]
Length=817

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  315  EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV  494
            +K+ +++E + +  +PP P+L + +AING  KSKY V WAL+KF+ E  ++FKLLHVR  
Sbjct  3    KKEIVEAEGEPVPVLPPPPTLNIGIAINGNRKSKYVVKWALEKFITEENVMFKLLHVRAK  62

Query  495  ISAVPTPMGEF  527
            I+ VPTP   +
Sbjct  63   ITTVPTPTAAY  73



>ref|XP_002865850.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42109.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=812

 Score = 64.3 bits (155),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            PS  L +A+AI+G SKSK  V WAL KF  E  ++FKL+H+ P +++VPTP G
Sbjct  30   PSQPLTIAIAISGSSKSKNVVKWALKKFGSEENVIFKLIHIHPKLTSVPTPSG  82


 Score = 24.3 bits (51),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN++ IS+  +DVAA + + +
Sbjct  80   PSGNTVSISEAPEDVAATYRQNV  102



>ref|XP_010442610.1| PREDICTED: putative U-box domain-containing protein 53 [Camelina 
sativa]
Length=804

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            D  +   PS SL +A+AI+G +KSK  V WAL KF  +  ++FKL+H+ P I+++PTP G
Sbjct  21   DSSDLASPSQSLTIAIAISGSNKSKNVVKWALKKFGSDKNVVFKLIHIHPKITSLPTPTG  80

Query  522  EFDS  533
            E  S
Sbjct  81   EMVS  84



>emb|CDX99935.1| BnaC09g27700D [Brassica napus]
Length=742

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  345  GLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            G +   PS +L VA+AI+G +KSK  V WAL+KF  +  ++FKL+HV P I++VPTP G
Sbjct  24   GSDLASPSQALDVAIAISGSTKSKNVVKWALEKFSSDKNLVFKLIHVHPKITSVPTPSG  82



>ref|XP_010546140.1| PREDICTED: U-box domain-containing protein 51 isoform X2 [Tarenaya 
hassleriana]
Length=785

 Score = 54.7 bits (130),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +3

Query  360  PPSPSLVVAVAINGK--SKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            P   +L VAVAI G   SKSK  V WA+ +F     ++FKLLHV+P I++V TPMG
Sbjct  7    PEDRALTVAVAIKGNNISKSKGLVRWAIQQFASLDHVVFKLLHVQPRITSVLTPMG  62


 Score = 32.3 bits (72),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GNSIPIS VR+D+A  + +++
Sbjct  60   PMGNSIPISSVREDIATVYKEDV  82



>emb|CDY00464.1| BnaA10g08090D [Brassica napus]
Length=776

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  345  GLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            G +   PS +L +A+AI+G +KSK  V WAL+KF  +  ++FKL+HV P I++VPTP G
Sbjct  24   GSDLASPSQALNIAIAISGSTKSKNVVKWALEKFSSDKNLVFKLIHVHPKITSVPTPSG  82



>emb|CAB36758.1| putative Ser/Thr protein kinase [Arabidopsis thaliana]
 emb|CAB79425.1| putative Ser/Thr protein kinase [Arabidopsis thaliana]
Length=814

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  372  SLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            S  V VA++G SKSKY V WA++KF  EG + FKLLH+ P+I++VPTP
Sbjct  19   SRTVVVALSGSSKSKYVVTWAIEKFATEGNVGFKLLHIHPMITSVPTP  66



>ref|XP_004986806.1| PREDICTED: U-box domain-containing protein 35-like [Setaria italica]
Length=791

 Score = 51.6 bits (122),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +3

Query  330  QSEMDGLNAMPPS-PSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAV  506
            Q E +   + P S P + + +A++    SKYAV WAL  F    +  F L+HVR +++ V
Sbjct  4    QEEAEVTESSPSSDPPITIGLAVSSSKSSKYAVKWALKNFGARERTRFMLIHVRQMVTLV  63

Query  507  PTPMGEF  527
            PT +G +
Sbjct  64   PTRLGNY  70


 Score = 34.7 bits (78),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEIE  585
            GN +P+ QVRDD+A+A+ KE+E
Sbjct  68   GNYVPVDQVRDDIASAYEKEVE  89



>ref|XP_010690148.1| PREDICTED: U-box domain-containing protein 35-like [Beta vulgaris 
subsp. vulgaris]
Length=871

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = +3

Query  375  LVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAV---PTPMGEF  527
            LVV VA+ G  KSKY + WAL+ F+PEG + FKLLHV P I+ V   PTPMG +
Sbjct  12   LVVGVALTGSRKSKYILRWALENFLPEGNVSFKLLHVYPKINVVPSGPTPMGTW  65



>ref|XP_009119427.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
 ref|XP_009119428.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
 ref|XP_009119429.1| PREDICTED: putative U-box domain-containing protein 53 [Brassica 
rapa]
Length=794

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  345  GLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGE  524
            G N   P  S+ +A+AI+G SKSK  V WA++KF  +  ++FKL+HV   I++VPTP G+
Sbjct  24   GSNVASPYQSMTIAIAISGSSKSKKIVKWAVEKFSSDKNVVFKLIHVHLKITSVPTPSGK  83

Query  525  FDS  533
              S
Sbjct  84   IVS  86



>emb|CDY00461.1| BnaA10g08120D [Brassica napus]
Length=794

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  345  GLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGE  524
            G N   P  S+ +A+AI+G SKSK  V WA++KF  +  ++FKL+HV   I++VPTP G+
Sbjct  24   GSNVASPYQSMTIAIAISGSSKSKKIVKWAVEKFSSDKNVVFKLIHVHLKITSVPTPSGK  83

Query  525  FDS  533
              S
Sbjct  84   IVS  86



>ref|XP_010482459.1| PREDICTED: putative U-box domain-containing protein 53 [Camelina 
sativa]
Length=800

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            D  +   PS  L +A+AI+G +KSK  V WAL KF  +  ++FKL+H+ P I ++PTP G
Sbjct  17   DSSDFASPSLPLTIAIAISGSNKSKNVVKWALKKFASDKNVVFKLIHIHPKIISLPTPTG  76

Query  522  EF  527
            E 
Sbjct  77   EM  78



>ref|XP_010482460.1| PREDICTED: LOW QUALITY PROTEIN: putative U-box domain-containing 
protein 53 [Camelina sativa]
Length=821

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            PS  L +A+AI+G +KSK  V WAL KF  +  ++FKL+HV P ++++PTP G
Sbjct  30   PSQPLTIAIAISGSNKSKNVVKWALKKFASDKNVVFKLIHVHPKLTSLPTPSG  82



>emb|CDY61455.1| BnaC09g53040D [Brassica napus]
Length=811

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  345  GLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGE  524
            G +   PS S+ +A+AI+G SKSK  V WA+ KF  E  ++FKL+HV   I++VPTP G+
Sbjct  24   GSDVACPSQSMTIAIAISGSSKSKNIVKWAVKKFSSEKNVVFKLIHVHLKITSVPTPSGK  83

Query  525  FDS  533
              S
Sbjct  84   LVS  86



>ref|XP_006401994.1| hypothetical protein EUTSA_v10012716mg [Eutrema salsugineum]
 gb|ESQ43447.1| hypothetical protein EUTSA_v10012716mg [Eutrema salsugineum]
Length=809

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  366  SPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEFDS  533
            S S+ +AVAI+G +KSK  V WAL KF  +  ++FKL+H+ P I ++PTP G   S
Sbjct  31   SQSVTIAVAISGSNKSKNVVRWALKKFGSDKNVVFKLIHIHPKIMSLPTPTGNIVS  86



>emb|CDY42872.1| BnaAnng06970D [Brassica napus]
Length=314

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +3

Query  360  PPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            PPSP  VVAVAING  KSK    WAL+KF+P G   FKL++VRP I+ + TP
Sbjct  16   PPSP--VVAVAINGNKKSKDVAYWALEKFIPGGFSDFKLIYVRPPITYIITP  65



>ref|XP_010546139.1| PREDICTED: U-box domain-containing protein 51 isoform X1 [Tarenaya 
hassleriana]
Length=786

 Score = 50.1 bits (118),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  PPSPSLVVAVAINGK--SKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            P   +L VAVAI G   SKSK  V WA+ +F     ++FKLLHV+P I++V TP
Sbjct  7    PEDRALTVAVAIKGNNISKSKGLVRWAIQQFASLDHVVFKLLHVQPRITSVLTP  60


 Score = 30.0 bits (66),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEI  582
            GNSIPIS VR+D+A  + +++
Sbjct  63   GNSIPISSVREDIATVYKEDV  83



>ref|XP_010546141.1| PREDICTED: U-box domain-containing protein 51 isoform X3 [Tarenaya 
hassleriana]
Length=782

 Score = 50.1 bits (118),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  PPSPSLVVAVAINGK--SKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            P   +L VAVAI G   SKSK  V WA+ +F     ++FKLLHV+P I++V TP
Sbjct  7    PEDRALTVAVAIKGNNISKSKGLVRWAIQQFASLDHVVFKLLHVQPRITSVLTP  60


 Score = 30.0 bits (66),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEI  582
            GNSIPIS VR+D+A  + +++
Sbjct  63   GNSIPISSVREDIATVYKEDV  83



>ref|XP_010546142.1| PREDICTED: U-box domain-containing protein 51 isoform X4 [Tarenaya 
hassleriana]
Length=781

 Score = 49.7 bits (117),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +3

Query  360  PPSPSLVVAVAINGK--SKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP  515
            P   +L VAVAI G   SKSK  V WA+ +F     ++FKLLHV+P I++V TP
Sbjct  7    PEDRALTVAVAIKGNNISKSKGLVRWAIQQFASLDHVVFKLLHVQPRITSVLTP  60


 Score = 30.0 bits (66),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  520  GNSIPISQVRDDVAAAFIKEI  582
            GNSIPIS VR+D+A  + +++
Sbjct  63   GNSIPISSVREDIATVYKEDV  83



>ref|XP_010229350.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Brachypodium distachyon]
Length=797

 Score = 45.1 bits (105),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 7/71 (10%)
 Frame = +3

Query  327  LQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK----ILFKLLHVRPV  494
            +Q E +G  A      L V +A+ G   S Y   WAL KF   GK     +FKL+HV   
Sbjct  3    IQEEGEG--AGSADAPLTVGLALGGSKSSTYVFRWALAKFA-NGKDKPAPIFKLIHVLTP  59

Query  495  ISAVPTPMGEF  527
            + AVPTP+G +
Sbjct  60   VLAVPTPLGNY  70


 Score = 33.1 bits (74),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN IPI +VR D+A A+ KE+
Sbjct  66   PLGNYIPIDEVRPDIAEAYAKEV  88



>ref|XP_010229348.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Brachypodium distachyon]
Length=801

 Score = 45.1 bits (105),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 7/71 (10%)
 Frame = +3

Query  327  LQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK----ILFKLLHVRPV  494
            +Q E +G  A      L V +A+ G   S Y   WAL KF   GK     +FKL+HV   
Sbjct  3    IQEEGEG--AGSADAPLTVGLALGGSKSSTYVFRWALAKFA-NGKDKPAPIFKLIHVLTP  59

Query  495  ISAVPTPMGEF  527
            + AVPTP+G +
Sbjct  60   VLAVPTPLGNY  70


 Score = 33.1 bits (74),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN IPI +VR D+A A+ KE+
Sbjct  66   PLGNYIPIDEVRPDIAEAYAKEV  88



>ref|XP_010229351.1| PREDICTED: U-box domain-containing protein 35-like isoform X4 
[Brachypodium distachyon]
Length=795

 Score = 44.7 bits (104),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 5/66 (8%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK----ILFKLLHVRPVISAVP  509
            +G  A      L V +A+ G   S Y   WAL KF   GK     +FKL+HV   + AVP
Sbjct  6    EGEGAGSADAPLTVGLALGGSKSSTYVFRWALAKFA-NGKDKPAPIFKLIHVLTPVLAVP  64

Query  510  TPMGEF  527
            TP+G +
Sbjct  65   TPLGNY  70


 Score = 32.7 bits (73),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN IPI +VR D+A A+ KE+
Sbjct  66   PLGNYIPIDEVRPDIAEAYAKEV  88



>ref|XP_010229353.1| PREDICTED: U-box domain-containing protein 35-like isoform X6 
[Brachypodium distachyon]
Length=737

 Score = 44.7 bits (104),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 5/66 (8%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK----ILFKLLHVRPVISAVP  509
            +G  A      L V +A+ G   S Y   WAL KF   GK     +FKL+HV   + AVP
Sbjct  6    EGEGAGSADAPLTVGLALGGSKSSTYVFRWALAKFA-NGKDKPAPIFKLIHVLTPVLAVP  64

Query  510  TPMGEF  527
            TP+G +
Sbjct  65   TPLGNY  70


 Score = 32.7 bits (73),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN IPI +VR D+A A+ KE+
Sbjct  66   PLGNYIPIDEVRPDIAEAYAKEV  88



>ref|XP_010229349.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Brachypodium distachyon]
 gb|ACF22761.1| protein kinase [Brachypodium distachyon]
Length=799

 Score = 44.7 bits (104),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 5/66 (8%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK----ILFKLLHVRPVISAVP  509
            +G  A      L V +A+ G   S Y   WAL KF   GK     +FKL+HV   + AVP
Sbjct  6    EGEGAGSADAPLTVGLALGGSKSSTYVFRWALAKFA-NGKDKPAPIFKLIHVLTPVLAVP  64

Query  510  TPMGEF  527
            TP+G +
Sbjct  65   TPLGNY  70


 Score = 32.7 bits (73),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN IPI +VR D+A A+ KE+
Sbjct  66   PLGNYIPIDEVRPDIAEAYAKEV  88



>ref|XP_010229352.1| PREDICTED: U-box domain-containing protein 35-like isoform X5 
[Brachypodium distachyon]
Length=767

 Score = 44.3 bits (103),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 5/66 (8%)
 Frame = +3

Query  342  DGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK----ILFKLLHVRPVISAVP  509
            +G  A      L V +A+ G   S Y   WAL KF   GK     +FKL+HV   + AVP
Sbjct  6    EGEGAGSADAPLTVGLALGGSKSSTYVFRWALAKFA-NGKDKPAPIFKLIHVLTPVLAVP  64

Query  510  TPMGEF  527
            TP+G +
Sbjct  65   TPLGNY  70


 Score = 32.7 bits (73),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GN IPI +VR D+A A+ KE+
Sbjct  66   PLGNYIPIDEVRPDIAEAYAKEV  88



>ref|XP_002865849.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42108.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=854

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEFDS  533
            PS  L +A+AI+G  KSK  + WAL+KF  +  + FKL+H+ P I+ +PT  G   S
Sbjct  30   PSQPLNIAIAISGSDKSKNVLKWALNKFGSDKNVTFKLIHIHPKITTLPTASGNIVS  86



>ref|NP_199940.1| U-box domain-containing protein 53 [Arabidopsis thaliana]
 sp|Q9LU47.1|PUB53_ARATH RecName: Full=Putative U-box domain-containing protein 53; AltName: 
Full=Plant U-box protein 53; Includes: RecName: Full=E3 
ubiquitin ligase; Includes: RecName: Full=Serine/threonine-protein 
kinase [Arabidopsis thaliana]
 dbj|BAA97390.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96060.1| U-box domain-containing protein 53 [Arabidopsis thaliana]
Length=819

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  363  PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEFDS  533
            PS  + VA+AI+G  KSK  + WAL+KF  +  + FKL+H+ P I+ +PT  G   S
Sbjct  28   PSEPMTVALAISGSIKSKNVIKWALNKFGSDKNVTFKLIHIHPKITTLPTASGNIVS  84



>gb|ABF93477.1| U-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=783

 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 3/55 (5%)
 Frame = +3

Query  366  SPSLVVAVAINGKSKSKYAVNWALDKF---VPEGKILFKLLHVRPVISAVPTPMG  521
            +P L V +A+     S YA+ WAL +F     +   +F L+HV   +  VPTPMG
Sbjct  3    APPLTVGLALTDSKSSTYALQWALSRFKFTKDDDAPIFLLIHVLTKLLTVPTPMG  57


 Score = 32.7 bits (73),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +1

Query  496  FLQFQLPWGNSIPISQVRDDVAAAFIKEI  582
             L    P GN IPI +VR DVA A+ K++
Sbjct  49   LLTVPTPMGNHIPIDKVRTDVADAYFKDV  77



>ref|NP_001048651.1| Os03g0101200 [Oryza sativa Japonica Group]
 dbj|BAF10565.1| Os03g0101200 [Oryza sativa Japonica Group]
 gb|EAY88172.1| hypothetical protein OsI_09613 [Oryza sativa Indica Group]
 gb|EAZ25251.1| hypothetical protein OsJ_09055 [Oryza sativa Japonica Group]
Length=812

 Score = 41.2 bits (95),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 3/55 (5%)
 Frame = +3

Query  366  SPSLVVAVAINGKSKSKYAVNWALDKF---VPEGKILFKLLHVRPVISAVPTPMG  521
            +P L V +A+     S YA+ WAL +F     +   +F L+HV   +  VPTPMG
Sbjct  21   APPLTVGLALTDSKSSTYALQWALSRFKFTKDDDAPIFLLIHVLTKLLTVPTPMG  75


 Score = 32.7 bits (73),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = +1

Query  496  FLQFQLPWGNSIPISQVRDDVAAAFIKEI  582
             L    P GN IPI +VR DVA A+ K++
Sbjct  67   LLTVPTPMGNHIPIDKVRTDVADAYFKDV  95



>ref|XP_006353585.1| PREDICTED: U-box domain-containing protein 34-like [Solanum tuberosum]
Length=789

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = +3

Query  327  LQSEMDGLNAMPPSPS---LVVAVAINGK--SKSKYAVNWALDKFVPEGKILFKLLHVRP  491
            ++ ++DG   + P+P+   L VAVA+     S S+ AV WA++K +P+    F L+HV P
Sbjct  1    MKVKVDGDTGVSPAPAPANLTVAVAVKSDEGSGSQRAVKWAVEKLLPKAN-RFVLVHVMP  59

Query  492  VISAVPTPMGEF  527
             I+ +PTP GE+
Sbjct  60   TITTIPTPSGEY  71



>ref|XP_006580498.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Glycine max]
Length=789

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEFDS  533
            VVAVAI     S+YA  WA+D  +P+ + L  LLHVR  +S++PTP G   S
Sbjct  15   VVAVAIENNKTSQYAAKWAVDNLLPKDQALL-LLHVRQRVSSIPTPTGNLVS  65



>ref|XP_010696543.1| PREDICTED: U-box domain-containing protein 34 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=767

 Score = 44.7 bits (104),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 4/52 (8%)
 Frame = +3

Query  375  LVVAVAINGKSK---SKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            + VAV I G S+   SK AV WA++  +P+    F L+HV P+I+ +PTP G
Sbjct  4    VAVAVNIGGNSRGNGSKRAVKWAVENLLPQAD-HFVLVHVMPIITHIPTPSG  54


 Score = 25.8 bits (55),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GNSIPI+++   V A +++++
Sbjct  52   PSGNSIPITELDKKVVAKYMEDV  74



>ref|XP_010696544.1| PREDICTED: U-box domain-containing protein 34 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=766

 Score = 44.7 bits (104),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 6/53 (11%)
 Frame = +3

Query  378  VVAVAIN--GKSK---SKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            +VAVA+N  G S+   SK AV WA++  +P+    F L+HV P+I+ +PTP G
Sbjct  3    IVAVAVNIGGNSRGNGSKRAVKWAVENLLPQAD-HFVLVHVMPIITHIPTPSG  54


 Score = 25.8 bits (55),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEI  582
            P GNSIPI+++   V A +++++
Sbjct  52   PSGNSIPITELDKKVVAKYMEDV  74



>ref|XP_006843200.1| hypothetical protein AMTR_s00146p00100330 [Amborella trichopoda]
 gb|ERN04875.1| hypothetical protein AMTR_s00146p00100330 [Amborella trichopoda]
Length=313

 Score = 42.0 bits (97),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VVAV +   S S  AV WA++  V     +  L+HV PVI A+PTP G++
Sbjct  15   VVAVGVCKSSTSMAAVRWAMENLVNHHDRIL-LIHVIPVIKAIPTPKGKY  63


 Score = 28.9 bits (63),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P G  IPI+Q++DDV A ++++ +
Sbjct  59   PKGKYIPIAQIQDDVVAMYMQDTK  82



>ref|XP_007160217.1| hypothetical protein PHAVU_002G302700g [Phaseolus vulgaris]
 gb|ESW32211.1| hypothetical protein PHAVU_002G302700g [Phaseolus vulgaris]
Length=778

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query  378  VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGEF  527
            VVAVAI     S+YA  WA+D  +P+ ++L  L+HVR   S++PTP G  
Sbjct  15   VVAVAIENNKTSQYAAKWAVDNLLPKEQVLL-LIHVRQRASSIPTPAGNL  63



>emb|CBI24063.3| unnamed protein product [Vitis vinifera]
Length=616

 Score = 43.5 bits (101),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAI+    S+YA+ WA+D  + +G+ +  LLH++   S++P P+G
Sbjct  13   VAVAIDKDKGSQYALKWAVDHLLSKGQSV-TLLHIKQKASSIPNPLG  58


 Score = 26.6 bits (57),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN + IS V +DVA A+ ++++
Sbjct  56   PLGNQVAISDVNEDVARAYKQQLD  79



>ref|XP_010656705.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Vitis vinifera]
 emb|CAN79719.1| hypothetical protein VITISV_012742 [Vitis vinifera]
Length=826

 Score = 42.7 bits (99),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAI+    S+YA+ WA+D  + +G+ +  LLH++   S++P P+G
Sbjct  13   VAVAIDKDKGSQYALKWAVDHLLSKGQSV-TLLHIKQKASSIPNPLG  58


 Score = 26.6 bits (57),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN + IS V +DVA A+ ++++
Sbjct  56   PLGNQVAISDVNEDVARAYKQQLD  79



>ref|XP_010656706.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Vitis vinifera]
Length=825

 Score = 42.7 bits (99),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAI+    S+YA+ WA+D  + +G+ +  LLH++   S++P P+G
Sbjct  13   VAVAIDKDKGSQYALKWAVDHLLSKGQSV-TLLHIKQKASSIPNPLG  58


 Score = 26.6 bits (57),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN + IS V +DVA A+ ++++
Sbjct  56   PLGNQVAISDVNEDVARAYKQQLD  79



>ref|XP_010656707.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 
[Vitis vinifera]
Length=806

 Score = 42.7 bits (99),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +3

Query  381  VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMG  521
            VAVAI+    S+YA+ WA+D  + +G+ +  LLH++   S++P P+G
Sbjct  13   VAVAIDKDKGSQYALKWAVDHLLSKGQSV-TLLHIKQKASSIPNPLG  58


 Score = 26.6 bits (57),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  514  PWGNSIPISQVRDDVAAAFIKEIE  585
            P GN + IS V +DVA A+ ++++
Sbjct  56   PLGNQVAISDVNEDVARAYKQQLD  79



>ref|XP_004252067.1| PREDICTED: U-box domain-containing protein 34 [Solanum lycopersicum]
Length=760

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +3

Query  327  LQSEMDGLNAMPPSPSLV-VAVAINGKS----KSKYAVNWALDKFVPEGKILFKLLHVRP  491
            ++ ++DG     P+P+ V V VA+  KS     S+ AV WA++K +P+    F L+HV P
Sbjct  1    MKVKVDGDAGASPAPAPVNVTVAVAVKSVEGNGSQRAVKWAVEKLLPKAN-RFVLVHVMP  59

Query  492  VISAVPTPMGEF  527
             I+ +PTP GE+
Sbjct  60   TITTIPTPSGEY  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690