BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF017C07

Length=426
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   4e-68   
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   6e-68   Nicotiana tomentosiformis
ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    223   1e-67   Solanum tuberosum [potatoes]
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    222   3e-67   Nicotiana sylvestris
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               217   2e-65   Petunia x hybrida [garden petunia]
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                216   6e-65   Erythranthe guttata [common monkey flower]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               215   1e-64   Rehmannia glutinosa [Chinese foxglove]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               215   1e-64   Rehmannia glutinosa [Chinese foxglove]
emb|CDO99410.1|  unnamed protein product                                213   7e-64   Coffea canephora [robusta coffee]
gb|AAL25590.1|  At2g33150/F25I18.11                                     208   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    210   1e-62   Sesamum indicum [beniseed]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             207   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             207   2e-61   
gb|KCW57292.1|  hypothetical protein EUGRSUZ_H00090                     203   7e-61   Eucalyptus grandis [rose gum]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             204   2e-60   Capsella rubella
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   2e-60   Tarenaya hassleriana [spider flower]
gb|KDO43603.1|  hypothetical protein CISIN_1g012506mg                   203   2e-60   Citrus sinensis [apfelsine]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   3e-60   Cucumis melo [Oriental melon]
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                   202   3e-60   Citrus sinensis [apfelsine]
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    203   4e-60   Eucalyptus grandis [rose gum]
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              202   6e-60   Mangifera indica
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   202   7e-60   Citrus sinensis [apfelsine]
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        202   7e-60   Cucumis sativus [cucumbers]
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                202   8e-60   Helianthus annuus
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   202   9e-60   Citrus sinensis [apfelsine]
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             202   1e-59   Citrus clementina [clementine]
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    201   3e-59   Brassica rapa
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    200   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    200   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    199   2e-58   Sesamum indicum [beniseed]
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             199   2e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    199   3e-58   Tarenaya hassleriana [spider flower]
emb|CDY37750.1|  BnaA04g19180D                                          198   4e-58   Brassica napus [oilseed rape]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    198   5e-58   
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    197   7e-58   
emb|CDY19452.1|  BnaC04g11470D                                          197   1e-57   Brassica napus [oilseed rape]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    197   1e-57   Brassica rapa
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    197   1e-57   Pyrus x bretschneideri [bai li]
emb|CDX84701.1|  BnaA03g15290D                                          197   1e-57   
emb|CDX79511.1|  BnaC03g18470D                                          197   1e-57   
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    197   1e-57   Brassica rapa
gb|KJB72151.1|  hypothetical protein B456_011G161700                    196   2e-57   Gossypium raimondii
emb|CAN81585.1|  hypothetical protein VITISV_023191                     196   2e-57   Vitis vinifera
emb|CDY23766.1|  BnaC04g43560D                                          196   2e-57   Brassica napus [oilseed rape]
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    196   2e-57   Gossypium arboreum [tree cotton]
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             196   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    196   4e-57   Vitis vinifera
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    196   4e-57   Populus euphratica
gb|KJB72152.1|  hypothetical protein B456_011G161700                    195   5e-57   Gossypium raimondii
gb|KJB72150.1|  hypothetical protein B456_011G161700                    195   5e-57   Gossypium raimondii
ref|XP_008349049.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    185   6e-57   
gb|EPS68937.1|  hypothetical protein M569_05826                         195   6e-57   Genlisea aurea
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    195   6e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    194   9e-57   Elaeis guineensis
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     194   1e-56   Brassica napus [oilseed rape]
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             191   7e-56   
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    192   9e-56   Cucumis melo [Oriental melon]
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    192   9e-56   Sesamum indicum [beniseed]
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    192   1e-55
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             191   2e-55   Prunus persica
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    191   2e-55   Prunus mume [ume]
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    191   2e-55   
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    191   3e-55   Camelina sativa [gold-of-pleasure]
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         191   3e-55   Jatropha curcas
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    189   7e-55   Fragaria vesca subsp. vesca
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    189   1e-54   Phoenix dactylifera
gb|ACU21519.1|  unknown                                                 186   1e-54   Glycine max [soybeans]
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    188   3e-54   Prunus mume [ume]
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               187   5e-54   Petunia x hybrida [garden petunia]
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   5e-54   Populus euphratica
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   5e-54   Populus euphratica
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   7e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   9e-54   Fragaria vesca subsp. vesca
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   9e-54   Cucumis sativus [cucumbers]
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    187   9e-54   
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    186   1e-53   
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             186   2e-53   Prunus persica
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    185   3e-53   Solanum tuberosum [potatoes]
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                185   4e-53   Glycine max [soybeans]
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                184   9e-53   
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    184   1e-52   Phoenix dactylifera
gb|AFW74043.1|  hypothetical protein ZEAMMB73_080325                    175   1e-52   
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                182   3e-52   Erythranthe guttata [common monkey flower]
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         182   4e-52   Jatropha curcas
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    182   5e-52   Nicotiana sylvestris
gb|KDO65878.1|  hypothetical protein CISIN_1g0125222mg                  178   9e-52   Citrus sinensis [apfelsine]
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    181   1e-51   Populus euphratica
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             181   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006605730.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    179   3e-51   
gb|ACJ84483.1|  unknown                                                 175   3e-51   Medicago truncatula
gb|KDO65876.1|  hypothetical protein CISIN_1g0125222mg                  178   3e-51   Citrus sinensis [apfelsine]
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    179   6e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO65875.1|  hypothetical protein CISIN_1g0125222mg                  177   7e-51   Citrus sinensis [apfelsine]
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    179   7e-51   Nicotiana tomentosiformis
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    179   8e-51   Elaeis guineensis
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    179   8e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          179   9e-51   Morus notabilis
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    179   1e-50   Glycine max [soybeans]
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    178   2e-50   Phoenix dactylifera
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    177   3e-50   Oryza brachyantha
gb|AFW74040.1|  hypothetical protein ZEAMMB73_080325                    176   3e-50   
dbj|BAJ85217.1|  predicted protein                                      176   3e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16781.1|  unknown                                                 177   4e-50   Picea sitchensis
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          177   4e-50   Amborella trichopoda
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             177   4e-50   Citrus clementina [clementine]
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    176   4e-50   Helianthus annuus
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             176   6e-50   
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             176   8e-50   Selaginella moellendorffii
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    176   9e-50   Elaeis guineensis
gb|AFW74041.1|  hypothetical protein ZEAMMB73_080325                    175   1e-49   
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          176   1e-49   
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          175   2e-49   Zea mays [maize]
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    175   2e-49   
emb|CDP03848.1|  unnamed protein product                                175   2e-49   Coffea canephora [robusta coffee]
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     175   3e-49   Medicago truncatula
gb|ACN39947.1|  unknown                                                 175   3e-49   Picea sitchensis
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    174   5e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    173   6e-49   Camelina sativa [gold-of-pleasure]
dbj|BAJ87577.1|  predicted protein                                      174   8e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    174   8e-49   Pyrus x bretschneideri [bai li]
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                173   1e-48   Ricinus communis
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    172   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    172   3e-48   Malus domestica [apple tree]
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   172   4e-48   Triticum aestivum [Canadian hard winter wheat]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  172   4e-48   
gb|ABR17647.1|  unknown                                                 172   4e-48   Picea sitchensis
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    171   7e-48   Brachypodium distachyon [annual false brome]
dbj|BAA25250.1|  mutated 3-ketoacyl-CoA thiolase                        161   1e-47   Arabidopsis thaliana [mouse-ear cress]
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    170   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    170   1e-47   Cicer arietinum [garbanzo]
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    170   2e-47   Gossypium arboreum [tree cotton]
gb|KJB10129.1|  hypothetical protein B456_001G185200                    167   3e-47   Gossypium raimondii
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             169   5e-47   Phaseolus vulgaris [French bean]
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    168   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    168   1e-46   Camelina sativa [gold-of-pleasure]
pdb|2C7Y|A  Chain A, Plant Enzyme                                       167   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    167   2e-46   Setaria italica
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    167   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB10128.1|  hypothetical protein B456_001G185200                    167   2e-46   Gossypium raimondii
gb|AFK40880.1|  unknown                                                 166   6e-46   Medicago truncatula
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             165   7e-46   Medicago truncatula
emb|CDX86611.1|  BnaC08g00920D                                          166   8e-46   
gb|ACN29136.1|  unknown                                                 166   9e-46   Zea mays [maize]
ref|XP_001764272.1|  predicted protein                                  165   1e-45   
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    164   3e-45   
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             164   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     164   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307516.1|  hypothetical protein CARUB_v10009140mg             160   4e-45   
ref|NP_001048523.1|  Os02g0817700                                       163   4e-45   
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    163   6e-45   Brassica rapa
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          163   6e-45   Sorghum bicolor [broomcorn]
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    163   9e-45   Elaeis guineensis
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   162   1e-44   Citrus sinensis [apfelsine]
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    162   1e-44   Gossypium arboreum [tree cotton]
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    162   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             162   2e-44   
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    162   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    161   3e-44   Oryza brachyantha
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    161   3e-44   Populus euphratica
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    161   3e-44   Populus euphratica
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    160   4e-44   Cicer arietinum [garbanzo]
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             160   5e-44   Phaseolus vulgaris [French bean]
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    160   5e-44   Setaria italica
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    160   7e-44   
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             160   8e-44   Capsella rubella
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    159   1e-43   Arabis alpina [alpine rockcress]
ref|NP_001064764.1|  Os10g0457600                                       160   1e-43   
gb|EEC67095.1|  hypothetical protein OsI_33888                          160   1e-43   Oryza sativa Indica Group [Indian rice]
gb|KCW50170.1|  hypothetical protein EUGRSUZ_K03601                     159   1e-43   Eucalyptus grandis [rose gum]
gb|KCW50169.1|  hypothetical protein EUGRSUZ_K03601                     159   1e-43   Eucalyptus grandis [rose gum]
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    159   2e-43   Cicer arietinum [garbanzo]
gb|KJB42405.1|  hypothetical protein B456_007G152600                    159   2e-43   Gossypium raimondii
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    159   3e-43   
gb|KJB42404.1|  hypothetical protein B456_007G152600                    159   3e-43   Gossypium raimondii
gb|AEQ94132.1|  putative 3-ketoacyl CoA thiolase                        155   4e-43   Elaeis guineensis
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    158   4e-43   Eucalyptus grandis [rose gum]
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    158   4e-43   Nicotiana sylvestris
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    159   5e-43   
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     158   5e-43   Eucalyptus grandis [rose gum]
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    158   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049827.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    156   7e-43   
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  157   9e-43   Glycine soja [wild soybean]
ref|XP_007049828.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4    155   9e-43   
emb|CDY15520.1|  BnaA08g28040D                                          157   1e-42   Brassica napus [oilseed rape]
ref|NP_001242568.1|  uncharacterized protein LOC100789930               156   2e-42   
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    156   2e-42   Cucumis sativus [cucumbers]
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    155   5e-42   
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    155   6e-42   
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            154   1e-41   Glycine max [soybeans]
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             154   2e-41   Capsella rubella
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             153   2e-41   
ref|XP_001762605.1|  predicted protein                                  154   2e-41   
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             152   1e-40   Eutrema salsugineum [saltwater cress]
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  151   1e-40   Triticum urartu
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    150   3e-40   Arabidopsis lyrata subsp. lyrata
gb|ACJ84675.1|  unknown                                                 145   5e-40   Medicago truncatula
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  149   8e-40   Triticum urartu
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            149   9e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33940.1|  BnaA02g30470D                                          148   2e-39   Brassica napus [oilseed rape]
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    148   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    144   6e-38   Brassica rapa
ref|XP_007049829.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5    142   7e-38   
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    142   4e-37   Camelina sativa [gold-of-pleasure]
emb|CDY05657.1|  BnaC02g38800D                                          142   5e-37   
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    141   9e-37   Camelina sativa [gold-of-pleasure]
gb|ADE77908.1|  unknown                                                 140   3e-36   Picea sitchensis
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    139   5e-36   Brachypodium distachyon [annual false brome]
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 138   8e-36   Vanda hybrid cultivar
ref|XP_005646163.1|  thiolase                                           136   7e-35   Coccomyxa subellipsoidea C-169
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    134   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    134   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    134   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             133   6e-34   Eutrema salsugineum [saltwater cress]
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            132   8e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 132   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    132   1e-33   Brassica rapa
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    128   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             121   1e-29   Volvox carteri f. nagariensis
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         120   3e-29   Chlamydomonas reinhardtii
ref|XP_005845320.1|  hypothetical protein CHLNCDRAFT_25846              117   3e-28   Chlorella variabilis
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             117   3e-28   
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             115   1e-27   
gb|KIY92728.1|  acetyl-CoA acyltransferase 1                            106   1e-24   Monoraphidium neglectum
emb|CDY07823.1|  BnaC03g47990D                                          103   1e-23   Brassica napus [oilseed rape]
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             100   5e-22   Auxenochlorella protothecoides
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464           95.9    2e-20   Branchiostoma floridae
ref|XP_960422.1|  3-ketoacyl-CoA thiolase                             92.0    4e-19   Neurospora crassa OR74A
ref|XP_004349337.1|  peroxisomal 3-ketoacyl-CoA thiolase B            92.0    4e-19   Capsaspora owczarzaki ATCC 30864
ref|XP_005852686.1|  3-ketoacyl- thiolase peroxisomal                 91.3    5e-19   Nannochloropsis gaditana CCMP526
ref|XP_005854303.1|  beta-ketoacyl-CoA thiolase                       91.7    6e-19   Nannochloropsis gaditana CCMP526
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                      91.3    7e-19   Nannochloropsis gaditana
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal             90.9    9e-19   Xenopus tropicalis [western clawed frog]
ref|XP_003353115.1|  hypothetical protein SMAC_03432                  90.9    9e-19   Sordaria macrospora k-hell
emb|CEF98532.1|  Thiolase-like, subgroup                              90.9    1e-18   Ostreococcus tauri
ref|XP_003664280.1|  3-ketoacyl-CoA thiolase                          90.5    2e-18   Thermothelomyces thermophila ATCC 42464
gb|ERZ96342.1|  hypothetical protein GLOINDRAFT_71751                 90.1    2e-18   
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                89.7    3e-18   Rozella allomycis CSF55
ref|XP_643924.1|  acetyl-CoA C-acyltransferase                        89.4    3e-18   Dictyostelium discoideum AX4
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...  90.5    1e-17   
gb|EIE80258.1|  hypothetical protein RO3G_04963                       87.8    1e-17   Rhizopus delemar RA 99-880
emb|CCA76233.1|  probable POT1-acetyl-CoA C-acyltransferase, pero...  87.4    2e-17   Serendipita indica DSM 11827
gb|KDN71907.1|  putative acetyl-CoA acetyltransferase                 87.4    2e-17   Colletotrichum sublineola
emb|CCF32753.1|  acetyl-CoA acetyltransferase                         87.4    2e-17   Colletotrichum higginsianum
gb|EFQ33554.1|  acetyl-CoA acetyltransferase                          87.4    2e-17   Colletotrichum graminicola M1.001
ref|XP_003001876.1|  3-ketoacyl-CoA thiolase                          87.4    2e-17   Verticillium alfalfae VaMs.102
gb|EPE04951.1|  3-ketoacyl- thiolase                                  87.0    2e-17   Ophiostoma piceae UAMH 11346
gb|EHK49858.1|  putative 3-ketoacyl-CoA thiolase                      87.0    3e-17   Trichoderma atroviride IMI 206040
ref|XP_005082434.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  85.5    3e-17   
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  86.7    4e-17   
ref|XP_007513169.1|  unknown                                          86.7    4e-17   Bathycoccus prasinos
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  86.7    4e-17   Chrysemys picta bellii
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  86.7    5e-17   Strongylocentrotus purpuratus [purple urchin]
ref|XP_009648812.1|  3-ketoacyl-CoA thiolase                          86.7    5e-17   Verticillium dahliae VdLs.17
ref|XP_005348136.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  85.1    6e-17   
gb|EFA76209.1|  acetyl-CoA C-acyltransferase                          85.9    7e-17   Heterostelium album PN500
ref|XP_007595974.1|  acetyl-CoA acetyltransferase                     85.9    7e-17   
emb|CDO68177.1|  hypothetical protein BN946_scf184938.g29             85.9    8e-17   Trametes cinnabarina
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                            85.5    9e-17   Helicosporidium sp. ATCC 50920
ref|XP_001226866.1|  conserved hypothetical protein                   85.1    1e-16   Chaetomium globosum CBS 148.51
dbj|GAM22408.1|  hypothetical protein SAMD00019534_055830             85.1    1e-16   Acytostelium subglobosum LB1
ref|XP_005096572.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  85.1    2e-16   Aplysia californica
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal             84.7    2e-16   Xenopus laevis [clawed frog]
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  85.1    2e-16   Microtus ochrogaster [prairie voles]
ref|XP_005297193.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  84.3    2e-16   Chrysemys picta bellii
ref|XP_005348141.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  83.6    2e-16   
gb|KIS00576.1|  acetyl-CoA acyltransferase                            84.7    2e-16   Cryptococcus gattii VGII 2001/935-1
gb|KIM26928.1|  hypothetical protein M408DRAFT_72087                  84.3    2e-16   Serendipita vermifera MAFF 305830
gb|KIR31004.1|  acetyl-CoA acyltransferase                            84.7    2e-16   Cryptococcus gattii VGII LA55
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  84.7    2e-16   
ref|XP_009262137.1|  hypothetical protein FPSE_10745                  84.3    2e-16   Fusarium pseudograminearum CS3096
ref|XP_001905889.1|  hypothetical protein                             84.3    2e-16   Podospora anserina S mat+
ref|XP_011328216.1|  3-ketoacyl-CoA thiolase                          84.3    3e-16   Fusarium graminearum PH-1
gb|KIR35530.1|  acetyl-CoA acyltransferase                            84.0    3e-16   Cryptococcus gattii VGII MMRL2647
gb|KIO21034.1|  hypothetical protein M407DRAFT_131995                 84.0    3e-16   Tulasnella calospora MUT 4182
ref|XP_001247762.1|  hypothetical protein CIMG_01533                  83.6    3e-16   
emb|CEF85217.1|  unnamed protein product                              84.3    3e-16   
ref|XP_566859.1|  acetyl-CoA C-acyltransferase                        84.0    3e-16   Cryptococcus neoformans var. neoformans JEC21
ref|XP_777983.1|  hypothetical protein CNBA4520                       84.0    4e-16   Cryptococcus neoformans var. neoformans B-3501A
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  84.0    4e-16   
ref|XP_002904159.1|  3-ketoacyl-CoA thiolase A                        84.0    4e-16   
gb|ETI53494.1|  hypothetical protein F443_03599                       83.6    4e-16   
ref|XP_004360305.1|  acetyl-CoA C-acyltransferase                     85.5    4e-16   
gb|ENH84024.1|  3-ketoacyl-thiolase                                   84.0    4e-16   
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...  84.0    4e-16   
gb|ETK93319.1|  hypothetical protein L915_03492                       83.6    4e-16   
gb|KGG50758.1|  hypothetical protein DI09_57p130                      83.2    4e-16   
ref|XP_007582372.1|  putative 3-ketoacyl-coa thiolase peroxisomal...  83.6    5e-16   
ref|XP_003065696.1|  3-ketoacyl-CoA thiolase, peroxisomal precurs...  83.6    5e-16   
gb|KIH94193.1|  acetyl-CoA acyltransferase                            83.6    5e-16   
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  83.6    5e-16   
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572           83.2    6e-16   
gb|KIO16568.1|  hypothetical protein M407DRAFT_85857                  81.3    6e-16   
gb|ETO19211.1|  hypothetical protein RFI_18020                        79.7    6e-16   
ref|XP_004339798.1|  acetylCoA acyltransferase, putative              83.2    7e-16   
ref|XP_006680802.1|  hypothetical protein BATDEDRAFT_37225            83.2    7e-16   
gb|KGB75585.1|  acetyl-CoA C-acyltransferase                          83.2    7e-16   
gb|KIL93411.1|  hypothetical protein FAVG1_03392                      82.8    8e-16   
gb|AFR92621.1|  acetyl-CoA acyltransferase                            82.8    8e-16   
ref|XP_001271962.1|  3-ketoacyl-coA thiolase peroxisomal A precursor  82.8    8e-16   
ref|XP_002742159.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...  82.8    8e-16   
ref|XP_009549597.1|  hypothetical protein HETIRDRAFT_441328           82.8    8e-16   
ref|XP_007000547.1|  hypothetical protein TREMEDRAFT_24802            82.8    9e-16   
gb|KIJ47990.1|  hypothetical protein M422DRAFT_28531                  82.8    1e-15   
gb|ERS99148.1|  hypothetical protein HMPREF1624_04344                 82.4    1e-15   
ref|XP_006462290.1|  hypothetical protein AGABI2DRAFT_193507          82.4    1e-15   
ref|XP_001932756.1|  3-ketoacyl-CoA thiolase B                        82.8    1e-15   
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529           82.4    1e-15   
gb|KFA63582.1|  hypothetical protein S40285_04144                     82.4    1e-15   
gb|KEY69142.1|  hypothetical protein S7711_04925                      82.4    1e-15   
gb|KIR48491.1|  acetyl-CoA acyltransferase                            82.4    1e-15   
gb|KIY37061.1|  acetyl-CoA acyltransferase                            82.4    1e-15   
gb|ACJ02108.1|  3-ketoacyl-coenzyme A thiolase                        80.1    1e-15   
gb|KIR86712.1|  acetyl-CoA acyltransferase                            82.4    1e-15   
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                82.4    1e-15   
gb|KDQ28695.1|  hypothetical protein PLEOSDRAFT_1054697               82.0    1e-15   
gb|KIY48859.1|  thiolase                                              82.0    1e-15   
ref|XP_001275425.1|  peroxisomal 3-ketoacyl-coA thiolase (Kat1), ...  82.0    2e-15   
ref|XP_001418570.1|  predicted protein                                82.0    2e-15   
gb|EGU82326.1|  hypothetical protein FOXB_07155                       82.0    2e-15   
gb|EDL76922.1|  rCG25918, isoform CRA_a                               80.1    2e-15   
dbj|BAK06976.1|  predicted protein                                    82.0    2e-15   
gb|EWG42127.1|  acetyl-CoA acyltransferase                            82.0    2e-15   
ref|XP_011121603.1|  hypothetical protein AOL_s00078g38               81.6    2e-15   
ref|XP_007366726.1|  thiolase                                         81.6    2e-15   
gb|EFX04324.1|  3-ketoacyl-CoA thiolase peroxisomal a precursor       81.6    2e-15   
ref|XP_003191423.1|  acetyl-CoA C-acyltransferase                     81.6    2e-15   
ref|XP_002564709.1|  Pc22g06820                                       81.6    2e-15   
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  81.6    2e-15   
gb|KIR50795.1|  acetyl-CoA acyltransferase                            81.6    2e-15   
ref|XP_002766693.1|  Acetyl-CoA acetyltransferase, putative           78.6    2e-15   
gb|EHK18224.1|  hypothetical protein TRIVIDRAFT_80821                 81.6    3e-15   
dbj|BAG62666.1|  unnamed protein product                              78.2    3e-15   
ref|XP_007382657.1|  thiolase                                         81.3    3e-15   
ref|XP_007913467.1|  putative 3-ketoacyl- thiolase protein            81.3    3e-15   
ref|XP_003650647.1|  hypothetical protein THITE_2110329               81.3    3e-15   
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  81.3    4e-15   
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                     81.3    4e-15   
gb|KDQ18816.1|  hypothetical protein BOTBODRAFT_103597                80.9    4e-15   
ref|XP_002842031.1|  hypothetical protein                             80.9    4e-15   
ref|XP_002626309.1|  3-ketoacyl-coA thiolase peroxisomal A            80.9    4e-15   
ref|XP_007770641.1|  acetyl-CoA acetyl transferase                    80.9    4e-15   
emb|CCO31845.1|  hypothetical protein BN14_05895                      80.9    4e-15   
ref|XP_003306063.1|  hypothetical protein PTT_19080                   80.9    5e-15   
gb|EJU03448.1|  thiolase                                              81.3    5e-15   
ref|XP_007261136.1|  thiolase                                         80.5    5e-15   
ref|XP_009833032.1|  hypothetical protein, variant 3                  79.3    5e-15   
gb|KFH68616.1|  acetyl-CoA acyltransferase                            80.9    5e-15   
emb|CEL63017.1|  acetyl-CoA acyltransferase                           80.5    5e-15   
emb|CEG63739.1|  Putative Acetyl-CoA acyltransferase                  80.5    5e-15   
gb|EKV04734.1|  hypothetical protein PDIG_87260                       80.5    5e-15   
emb|CEI96344.1|  Putative Acetyl-CoA acyltransferase                  80.5    5e-15   
ref|XP_009833030.1|  hypothetical protein, variant 1                  79.7    6e-15   
ref|XP_006694648.1|  3-ketoacyl-CoA thiolase-like protein             80.5    6e-15   
ref|XP_004635292.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...  79.3    6e-15   
ref|XP_003712230.1|  3-ketoacyl-CoA thiolase                          80.5    7e-15   
ref|XP_002780408.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...  80.5    7e-15   
gb|AAH89821.1|  Acaa1 protein                                         79.7    7e-15   
gb|ENH73947.1|  3-ketoacyl-CoA thiolase, peroxisomal                  81.6    7e-15   
ref|XP_007408145.1|  hypothetical protein MELLADRAFT_47782            80.1    7e-15   
dbj|GAA82972.1|  3-ketoacyl-coA thiolase peroxisomal A precursor      80.1    8e-15   
ref|XP_002780409.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...  80.1    8e-15   
gb|KDO17077.1|  hypothetical protein SPRG_17408                       75.5    8e-15   
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                80.1    8e-15   
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...  80.1    9e-15   
ref|XP_007276712.1|  3-ketoacyl- thiolase                             79.7    9e-15   
gb|KIK70777.1|  hypothetical protein GYMLUDRAFT_974072                80.1    9e-15   
ref|XP_009833029.1|  hypothetical protein H257_08703                  79.7    9e-15   
gb|KEQ93783.1|  hypothetical protein AUEXF2481DRAFT_90094             80.1    1e-14   
ref|XP_007943892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  79.0    1e-14   
ref|XP_005813530.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  79.7    1e-14   
gb|EKG13294.1|  Thiolase                                              80.1    1e-14   
ref|XP_010355558.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  79.7    1e-14   
gb|AAB88181.1|  similar to 3-oxoacyl-CoA thiolase                     76.3    1e-14   
ref|XP_006512179.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  77.8    1e-14   
ref|XP_005546712.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  79.0    1e-14   
gb|EDL76915.1|  rCG25819, isoform CRA_a                               79.7    1e-14   
gb|EWC45293.1|  peroxisomal 3-ketoacyl-CoA thiolase                   79.7    1e-14   
ref|XP_002111185.1|  expressed hypothetical protein                   79.7    1e-14   
gb|EQB52382.1|  acetyl-CoA acetyltransferase                          79.3    1e-14   
ref|XP_005001163.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  78.6    1e-14   
ref|XP_006986814.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  77.4    1e-14   
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal              79.7    1e-14   
gb|KIM88443.1|  hypothetical protein PILCRDRAFT_85575                 79.3    2e-14   
gb|ELU44100.1|  acetyl-CoA acetyl transferase                         79.3    2e-14   
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                79.3    2e-14   
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  79.3    2e-14   
dbj|GAA82341.1|  3-ketoacyl-CoA thiolase                              79.3    2e-14   
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...  79.3    2e-14   
gb|KFH70491.1|  acetyl-CoA acyltransferase                            79.3    2e-14   
gb|KGO78426.1|  Thiolase-like, subgroup                               79.3    2e-14   
ref|XP_007445301.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...  75.1    2e-14   
dbj|GAM87832.1|  hypothetical protein ANO11243_058600                 79.3    2e-14   
dbj|BAK63365.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor       75.9    2e-14   
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  79.3    2e-14   
ref|XP_007322708.1|  hypothetical protein SERLADRAFT_477203           79.0    2e-14   
gb|KDN42457.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...  79.0    2e-14   
gb|AAH14474.1|  ACAA1 protein                                         78.2    2e-14   
ref|NP_001123882.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform b   78.2    2e-14   
ref|XP_008900800.1|  hypothetical protein PPTG_08457                  79.0    2e-14   
gb|KIK43764.1|  hypothetical protein CY34DRAFT_803509                 79.0    2e-14   
gb|EYE97604.1|  putative acetyl-CoA c-acyltransferase                 79.0    2e-14   
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                 78.6    2e-14   
dbj|GAN09045.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor       79.0    2e-14   
gb|KIN95402.1|  hypothetical protein M404DRAFT_1007539                79.0    2e-14   
gb|KEY75796.1|  3 ketoacyl coA thiolase peroxisomal A                 79.0    2e-14   
ref|XP_751733.1|  3-ketoacyl-coA thiolase peroxisomal A precursor     79.0    2e-14   
gb|ACF24566.1|  acetyl-CoA acyltransferase                            77.0    2e-14   
emb|CEJ90926.1|  Putative 3-ketoacyl-coA thiolase peroxisomal A       79.0    2e-14   
ref|XP_001088834.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  79.0    2e-14   
ref|XP_008421414.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  78.6    2e-14   
ref|XP_003894723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  79.0    2e-14   
ref|XP_006986793.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  79.0    3e-14   
gb|KGO37526.1|  Thiolase-like, subgroup                               79.0    3e-14   
gb|KDO65879.1|  hypothetical protein CISIN_1g0125222mg                77.8    3e-14   
ref|XP_005546711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  79.0    3e-14   
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  79.0    3e-14   
gb|KEQ67540.1|  3-ketoacyl-CoA thiolase-like protein                  79.0    3e-14   
ref|XP_004033893.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  77.8    3e-14   
ref|XP_007969955.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  79.0    3e-14   
gb|EDL09239.1|  mCG21883, isoform CRA_d                               75.5    3e-14   
ref|XP_006713185.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  78.2    3e-14   
gb|KEQ77684.1|  3-ketoacyl-CoA thiolase-like protein                  78.6    3e-14   
ref|XP_007517130.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  77.4    3e-14   
gb|KEQ81585.1|  3-ketoacyl-CoA thiolase-like protein                  78.6    3e-14   
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  78.6    3e-14   
emb|CCI45800.1|  unnamed protein product                              78.6    3e-14   
dbj|BAE25296.1|  unnamed protein product                              78.2    4e-14   
ref|XP_007674965.1|  hypothetical protein BAUCODRAFT_146808           78.2    4e-14   
ref|XP_005994281.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  77.4    4e-14   
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor    78.2    4e-14   
emb|CDM36619.1|  3-ketoacyl-CoA thiolase, peroxisomal                 78.2    4e-14   
ref|XP_004662051.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  77.8    4e-14   
ref|XP_001401936.1|  acetyl-CoA C-acyltransferase                     78.2    4e-14   
ref|XP_009443455.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  77.8    4e-14   
ref|XP_002788186.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...  78.2    4e-14   
gb|KJA14052.1|  hypothetical protein HYPSUDRAFT_150863                78.2    4e-14   
ref|XP_003170852.1|  3-ketoacyl-CoA thiolase                          78.2    4e-14   
ref|XP_011110053.1|  hypothetical protein H072_4093                   78.2    4e-14   
ref|XP_003032461.1|  hypothetical protein SCHCODRAFT_75718            77.8    4e-14   
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a      78.2    5e-14   
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  78.2    5e-14   
gb|KIK20810.1|  hypothetical protein PISMIDRAFT_682010                77.8    5e-14   
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...  78.2    5e-14   
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  78.2    5e-14   
gb|KFH47479.1|  3-ketoacyl-CoA thiolase, peroxisomal-like protein     77.8    5e-14   
ref|XP_005386653.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  77.0    5e-14   
gb|KHN99131.1|  3-ketoacyl-CoA thiolase                               77.8    5e-14   
ref|XP_001208809.1|  3-ketoacyl-CoA thiolase                          77.8    5e-14   
gb|KFH69993.1|  acetyl-CoA acyltransferase                            77.8    5e-14   
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor    77.8    5e-14   
gb|ELR08725.1|  hypothetical protein GMDG_03407                       77.8    5e-14   
ref|XP_007836703.1|  3-ketoacyl-CoA thiolase                          77.8    5e-14   
emb|CCX07864.1|  Similar to 3-ketoacyl-CoA thiolase B, peroxisoma...  77.8    6e-14   
dbj|GAA95537.1|  hypothetical protein E5Q_02192                       77.8    6e-14   
gb|KDR70838.1|  hypothetical protein GALMADRAFT_254446                77.8    6e-14   
ref|XP_006910841.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  77.8    6e-14   
gb|KIW02151.1|  hypothetical protein PV09_06636                       77.4    6e-14   
gb|EPT01198.1|  hypothetical protein FOMPIDRAFT_1029944               77.8    6e-14   
dbj|BAE72965.1|  hypothetical protein                                 77.8    6e-14   
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  77.8    6e-14   
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  77.8    6e-14   
gb|EGC43203.1|  3-ketoacyl-CoA thiolase                               77.8    6e-14   
gb|EEH08158.1|  3-ketoacyl-coA thiolase peroxisomal A                 77.8    6e-14   
ref|XP_001544549.1|  hypothetical protein HCAG_01596                  77.8    6e-14   
gb|EGD97916.1|  3-ketoacyl-CoA thiolase peroxisomal A                 77.4    7e-14   
ref|XP_001266900.1|  3-ketoacyl-coA thiolase peroxisomal A precursor  77.4    7e-14   
gb|KIW25108.1|  hypothetical protein PV07_10773                       77.4    7e-14   
gb|KDB27199.1|  hypothetical protein H109_01068                       77.4    7e-14   
emb|CCM03113.1|  predicted protein                                    77.8    7e-14   
gb|EZF34509.1|  hypothetical protein H101_01942                       77.4    7e-14   
ref|XP_003232365.1|  3-ketoacyl-CoA thiolase peroxisomal A            77.4    7e-14   
gb|KIM38401.1|  hypothetical protein M413DRAFT_20051                  77.4    7e-14   
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...  77.4    7e-14   
gb|EPS33443.1|  hypothetical protein PDE_08405                        77.4    8e-14   
gb|EPQ67799.1|  3-ketoacyl-CoA thiolase                               77.4    8e-14   
ref|XP_005040596.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...  76.3    8e-14   
ref|XP_009216548.1|  3-ketoacyl-CoA thiolase                          77.4    8e-14   
emb|CDJ69704.1|  acetyl-CoA acyltransferase B, putative               75.9    8e-14   
emb|CCU81710.1|  3-ketoacyl-coA thiolase/POT1                         77.4    9e-14   
ref|XP_002584604.1|  3-ketoacyl-CoA thiolase                          77.0    9e-14   
ref|XP_003837833.1|  hypothetical protein LEMA_P121530.1              78.2    9e-14   
ref|XP_004471222.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  74.7    9e-14   
gb|KDO30583.1|  hypothetical protein SPRG_04484                       77.0    9e-14   
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  77.0    1e-13   
ref|XP_008314704.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  77.0    1e-13   
ref|XP_008616222.1|  acetyl-CoA acyltransferase 1                     77.0    1e-13   
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  77.0    1e-13   
ref|XP_003020839.1|  3-ketoacyl-CoA thiolase (POT1), putative         77.4    1e-13   
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  77.0    1e-13   
ref|XP_004676370.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...  75.9    1e-13   
ref|XP_001831920.1|  acetyl-CoA acetyl transferase                    76.6    1e-13   
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal  77.0    1e-13   
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...  77.4    1e-13   
gb|KFZ13138.1|  hypothetical protein V501_03843                       77.0    1e-13   
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  77.0    1e-13   
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...  77.0    1e-13   
ref|XP_007925002.1|  hypothetical protein MYCFIDRAFT_210863           77.0    1e-13   
gb|KGL84935.1|  3-ketoacyl-CoA thiolase B, peroxisomal                76.6    1e-13   
ref|XP_001260604.1|  peroxisomal 3-ketoacyl-coA thiolase (Kat1), ...  77.0    1e-13   



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTNL+PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNLSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+K+GGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKKGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTN++PSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNVSPSEIGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            +IERQRVLLQHLRP+  +SSL++++SS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    SIERQRVLLQHLRPSQTSSSLENLDSSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VLKAL+EKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGSFKDTYPDDLLAPVLKALMEKTNVSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHLRP+  +SSL+ IESS+SAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIESSLSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVMEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRV+LQHL+P+  +SSL++++SS+SASVCAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVVLQHLKPSFTSSSLENLDSSLSASVCAAGDSAAYHRTSAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YA  423
            YA
Sbjct  124  YA  125



>gb|AAL25590.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
Length=390

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLLQHLRP+  +S+L+ I SSVSAS+C AGDSAAY R+SV+GDD+VIVAA+RT 
Sbjct  4    AIDRQRVLLQHLRPSFTSSTLEDIGSSVSASICLAGDSAAYHRSSVFGDDVVIVAAHRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|KCW57292.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=380

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP   ASS  + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRP--CASSSHNFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG  KDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNLKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP+++ S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSPSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|KDO43603.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=415

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 109/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLRP+   SSL S +S +SAS C AGDSAAYQRNSV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPS---SSLHSHDSPLSASACLAGDSAAYQRNSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDI+VG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLGPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|KDO43602.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=406

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHLRP+N  SS  + ES+++ASVCAAGDSAAY R SVYGDD+VIVAA+RT 
Sbjct  4    AINRQQVLLQHLRPSN--SSSHNYESALAASVCAAGDSAAYHRASVYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNL+PSEVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLDPSEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ +LL HLRP+   SS  + ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPS---SSAYTNESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   ICKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   202 bits (514),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+P
Sbjct  4    AIERQRVLLEHLRPSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGG KDTYPDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAF
Sbjct  60   LCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP    SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRP----SSSHSFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  60   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   200 bits (509),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   200 bits (508),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHLRP+  +SSL+ I+SS+SAS+C+AGDS+AY R++V+GDD+VIVAAYRTP
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIDSSISASICSAGDSSAYHRSTVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++  SS  + E+S+SAS C AGDSA+YQR S+YGDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLRPSS--SSSHNFEASLSASACLAGDSASYQRASLYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEK N+NP+EVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKKNVNPAEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLQHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LLQHL P+  +S+  +  S++SAS C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AINRQQILLQHLNPSAPSSADQNYNSALSASACLAGDSAAYQRTNAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPGEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPKEVGDIVVGTVLAPGSLRAMECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSSH-SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  63   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  122

Query  418  YAG  426
            YAG
Sbjct  123  YAG  125



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPNEVGDIVVGTVLAPGSLRAIECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|KJB72151.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=415

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++ S     S++SAS C AGDSAAY R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFSSHQNNSALSASACLAGDSAAYLRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL+HLRP    SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLEHLRP----SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  60   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP+   SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPS---SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   195 bits (495),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_008349049.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=129

 Score =   185 bits (470),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLLQHLRP ++ SS +    ++SAS+CAAG+SAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNFESVALSASICAAGNSAAYHRTAAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVRAPGSLRATECRMAAF  123

Query  418  YA  423
            YA
Sbjct  124  YA  125



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 110/123 (89%), Gaps = 6/123 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQRVLL+HLRP      +++ ESS+SAS+CAAGDSA Y R+SV+GDD+VIVAAYR+ 
Sbjct  4    AVDRQRVLLRHLRP------IENTESSISASICAAGDSAPYHRSSVFGDDVVIVAAYRSA  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYP+D+LA VL+ALI+KTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  58   LCKSKRGSFKDTYPEDILAPVLRALIDKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  117

Query  418  YAG  426
            YAG
Sbjct  118  YAG  120



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP    SS    +SS+SASVC AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLDHLRP----SSQTHHQSSLSASVCLAGDSAAYHRTAAFGDDVVIVAAYRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGG+KDT+PDDLLA VLKALIEKTNLNP+EVGDIIVGTVLAPGS RA+ECRMAAF
Sbjct  60   LCKSKRGGYKDTHPDDLLAPVLKALIEKTNLNPNEVGDIIVGTVLAPGSQRATECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P+    SLD   S +SAS+CAAGDS AYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPST--PSLDE-SSMLSASICAAGDSTAYQRSSCFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 110/123 (89%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AMERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTV APGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVWAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  415  FYAG  426
            FYAG
Sbjct  122  FYAG  125



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQNILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTY DDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYADDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQR+LLQHLRPT++ S   S +SS+S S+C AGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    ATNRQRILLQHLRPTSSVSHQTS-DSSLSPSICLAGDSAAYHRTAAFGDDIVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT PDDLLA+VLKALI++TNLNP+EVGDIIVGTVLAPGS+RA ECRMAA 
Sbjct  63   ICKSKRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIIVGTVLAPGSLRAIECRMAAL  122

Query  418  YAG  426
            YAG
Sbjct  123  YAG  125



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 109/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMA F
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMATF  120

Query  418  YAG  426
            Y G
Sbjct  121  YPG  123



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  415  FYAG  426
            FYAG
Sbjct  122  FYAG  125



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A  RQRVLL HLRP+  +SSL   +SS +SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDSSSLSASACVAGDSAAYARTNVFGDDVVIVAAYRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  415  FYAG  426
            FYAG
Sbjct  122  FYAG  125



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLLQHLRP ++ SS +     +SAS+CAAGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNYESDPLSASICAAGDSAAYHRTAAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV+APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVMAPGSLRATECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP +++S   S ESS+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFESSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VL+ALI+KTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIDKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP++++S   + ESS+SAS C AGDSAAYQR +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPSSSSSH--NYESSLSASACLAGDSAAYQRTAVFGDDVVIVAAYRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNLN SEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLNASEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASS-LDSIESSV-SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            A+ RQ+VLLQHLRP ++ SS + + ESSV SA +CAAGDSAAY R   +GDDIVIVAAYR
Sbjct  4    ALNRQKVLLQHLRPNSSLSSAIQTHESSVLSAEICAAGDSAAYHRTGAFGDDIVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK+KRGGFKDT  DDLLA VLKA+IE+TNLNPSEVGDI+VGTVLAPGS+RA ECRMA
Sbjct  64   TAVCKAKRGGFKDTLADDLLAPVLKAVIERTNLNPSEVGDIVVGTVLAPGSLRAIECRMA  123

Query  412  AFYAG  426
            AFYAG
Sbjct  124  AFYAG  128



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P++ + +   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPSSPSPNESPM---LSASICAAGDSAAYQRSSCFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|ACU21519.1| unknown [Glycine max]
Length=349

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            A  RQRVLLQHL P ++ SS        +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4    AHNRQRVLLQHLLPNSSFSSAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNPSEVGDI+VGTV+APGS+RA+ECRM
Sbjct  64   RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPSEVGDIVVGTVMAPGSLRATECRM  123

Query  409  AAFYAG  426
            AAFYAG
Sbjct  124  AAFYAG  129



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL+HL+P    +   S  SS++ S+CAAGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AIQRQRVLLEHLQPIRHHTHDHS--SSLTTSICAAGDSAAYQRTAAFGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  DDLLA VLKA+IEKTNL+P EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  62   ICKSKRGGFKDTLSDDLLAPVLKAVIEKTNLDPKEVGDIVVGTVLAPGSIRAMECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 110/123 (89%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL+HLRP+ ++S   S    +SASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AIDRQRVLLRHLRPSPSSSPNGS--HLISASVCAAGDSAAYQRNSCFGDDVVVVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP++LL  VLKAL++KTNLNP+EVGDI+VGTVLAPG+ RA+ECRMAAF
Sbjct  62   ICKSKRGGFKDTYPEELLTVVLKALLDKTNLNPNEVGDIVVGTVLAPGAQRATECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HLRP +  SS  + E+ +SAS CAAGDS+AY R + +GDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPPS--SSDHNYEAFLSASNCAAGDSSAYHRTTAFGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VLKALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKAKRGSFKDTYPDDLLAPVLKALIEKTNVNPAEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLRP++++       SS+SASVCAAGDSAAY RN V+GDD+VIVAAYRTP
Sbjct  4    AINRQKVLLDHLRPSSSSDD-----SSLSASVCAAGDSAAYARNHVFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTY DDLLA VLKA++EKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTYADDLLAPVLKAVVEKTNLNPKEVGDIVVGTVLAPGSQRASECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 109/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLR    +SSL S +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLR---PSSSLPSHDSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 109/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLR    +SSL S +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLR---PSSSLPSHDSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 103/123 (84%), Gaps = 8/123 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNPSEVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPSEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  418  YAG  426
            YAG
Sbjct  116  YAG  118



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPT---NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            A  RQRVLLQHL P    +AA       +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4    AHNRQRVLLQHLLPNCSFSAAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNP EVGDI+VGTV+APGS+RA+ECRM
Sbjct  64   RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPGEVGDIVVGTVMAPGSLRATECRM  123

Query  409  AAFYAG  426
            AAFYAG
Sbjct  124  AAFYAG  129



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 8/123 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNP+EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPNEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  418  YAG  426
            YAG
Sbjct  116  YAG  118



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HLRP+ ++SSL + +SS+SAS C+AGDSAAYQR SVYGDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPS-SSSSLHNYDSSLSASACSAGDSAAYQRTSVYGDDVVIVAAHRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKALIEKT LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63   LCKSKRGGFKDTFADDLLAPVLKALIEKTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  418  YAG  426
            YAG
Sbjct  123  YAG  125



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL P++ +        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AIGRQRVLLQHLHPSSGSDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>gb|AFW74043.1| hypothetical protein ZEAMMB73_080325, partial [Zea mays]
Length=145

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAAS---SQPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ++LL HLRPT++   L S + S+S +VC AGDSAAY R   +GDDIVIVAAYRT 
Sbjct  4    AANRQKILLDHLRPTSSVPHLIS-QPSLSRAVCLAGDSAAYHRTPAFGDDIVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKS RGGFKDT PDDLLA+VLKALI++TNLNP+EVGDI+VGTVLAPGS+RA ECRMAA 
Sbjct  63   LCKSTRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIVVGTVLAPGSLRAIECRMAAL  122

Query  418  YAG  426
            YAG
Sbjct  123  YAG  125



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIE--SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            RQ+VLL HL+P +++S L   +  SS+S S+CAAG+ AAY+R +V GDD+VIVAAYRT +
Sbjct  7    RQKVLLGHLQPNSSSSFLSHTQKSSSLSTSICAAGNGAAYRRTAVSGDDVVIVAAYRTAI  66

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+K+GGFKDT PDDL+ SVLKALIEKTN+NPSEVGDI+VGTVLAPGS+RA ECRM AFY
Sbjct  67   CKAKKGGFKDTLPDDLIGSVLKALIEKTNVNPSEVGDIVVGTVLAPGSLRAIECRMGAFY  126

Query  421  AG  426
            AG
Sbjct  127  AG  128



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 106/123 (86%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HL+P  ++S      SS++ S+C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  29   AIERQRVLLEHLQPIRSSSHQ---FSSLTPSICLAGDSAAYQRTAAFGDDVVIVAAYRTA  85

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFK+T  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  86   ICKAKRGGFKNTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAAF  145

Query  418  YAG  426
            YAG
Sbjct  146  YAG  148



>gb|KDO65878.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=320

 Score =   178 bits (451),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 7/123 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  418  YAG  426
            YAG
Sbjct  117  YAG  119



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 7/123 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  418  YAG  426
            YAG
Sbjct  117  YAG  119



>ref|XP_006605730.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Glycine max]
Length=410

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|ACJ84483.1| unknown [Medicago truncatula]
Length=259

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  418  YAG  426
            YAG
Sbjct  123  YAG  125



>gb|KDO65876.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
 gb|KDO65877.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=374

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 104/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+++ +S DS   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPSSSQTS-DS--PAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL HL+P+    S       +S  VCAAGDSA YQR+S +GDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPSPPLRS-----PILSTEVCAAGDSAKYQRSSCFGDDVVIVAACRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTHPEDLLAPVLKALLDKTQLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>gb|KDO65875.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=397

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            AIERQRVLL+HL+P  ++S     +SS ++ S+C AGDSAAY+R + + DD+VIVAAYRT
Sbjct  33   AIERQRVLLEHLQPIRSSSHHTHDQSSSLTPSICLAGDSAAYRRTAAFDDDVVIVAAYRT  92

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
             +CK+KRGGFKDT  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAA
Sbjct  93   AICKAKRGGFKDTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAA  152

Query  415  FYAG  426
            FYAG
Sbjct  153  FYAG  156



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQH  P++A+        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AISRQRVLLQHFHPSSASDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT+P+DLLA VLK L++KT LNPSEVGDI+VGTVLA GS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKELLDKTKLNPSEVGDIVVGTVLASGSQRAIECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P  ++SS     S VSASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AINRQRVLLQHLQPFPSSSS-----SLVSASVCAAGDSAAYQRNSSFGDDVVVVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            + KSKRGGFKDTYP++LL +VLKAL++KTNLNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  59   ISKSKRGGFKDTYPEELLTAVLKALLDKTNLNPNEVGDIVVGTVLAPGSQRATECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQRVLLQHL PT   SS  +  +S+SAS+CAAG S AYQR + +GDDIVIVAA RT 
Sbjct  4    AAERQRVLLQHLSPT---SSQTNDTASLSASICAAGQSGAYQRTAAFGDDIVIVAACRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA+VLKA+IE+TNL+PSE+GDI+VGTVLAPGS+RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTPVDDLLAAVLKAVIERTNLDPSEIGDIVVGTVLAPGSVRAIECRMAAI  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ VLLQHLRP    SS      ++SAS+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQSVLLQHLRP----SSDFGDRPALSASICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKS RGGF++T+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSSRGGFRNTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P++++S+    +  +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSSSSSN----QPLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +C++KRGGFKDTYP+DLL +VLKA+++ T +NP E+GDI+VG+VL PGS RA ECR AAF
Sbjct  60   ICRAKRGGFKDTYPEDLLTTVLKAVLDNTRINPGEIGDIVVGSVLGPGSQRAVECRAAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>gb|AFW74040.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=378

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>dbj|BAJ85217.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQR+LL+HL P   A+  +   S+VSASVCAAGDSAAY R   + DDIVIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP---AAGANPTASAVSASVCAAGDSAAYHRGPCFADDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDT P+DLL  V KAL+EKT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVEKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 98/120 (82%), Gaps = 4/120 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+VLL HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVLLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  65   AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRASECRMAAFYAG  124



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 4/120 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HLRP+  ASS ++  S++ ASVC AGDSAAY R++ +GDD+VIVAAYRT  CK
Sbjct  7    RQKILLDHLRPS--ASSQEN--SNLQASVCLAGDSAAYARSAPFGDDVVIVAAYRTAQCK  62

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            SKRGGFKDT+P+DLLA VLKALI+KT L+P EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  63   SKRGGFKDTFPEDLLAPVLKALIDKTKLDPREVGDIVVGTVLAPGSQRASECRMAAFYAG  122



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 99/110 (90%), Gaps = 4/110 (4%)
 Frame = +1

Query  97   PTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTY  276
            P++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+PLCK+KRGG KDTY
Sbjct  2    PSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSPLCKAKRGGLKDTY  57

Query  277  PDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            PDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAFYAG
Sbjct  58   PDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAG  107



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   176 bits (447),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 100/120 (83%), Gaps = 5/120 (4%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  2    RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  56

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  57   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  116



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 100/120 (83%), Gaps = 5/120 (4%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  10   RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  65   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  124



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 111/123 (90%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P +++S+   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPPSSSSNDAPM---LSASICAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP+DLLA+VLKAL++KT LNP EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLAAVLKALLDKTKLNPREVGDIVVGTVLAPGSQRANECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|AFW74041.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=407

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  145  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  324
            ASVC AGDSAAYQR +V+GDD+VIVAAYRTPLCKSKRGGFKDT+ DDLLA VLKALIEKT
Sbjct  33   ASVCLAGDSAAYQRTNVFGDDVVIVAAYRTPLCKSKRGGFKDTHADDLLAPVLKALIEKT  92

Query  325  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            NLNPSEVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  93   NLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAG  126



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPHLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASS--LDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            AI RQ+VLL+HL+PT+  S        SS+S S+C AGDSAAYQR + +GDD+VIVAAYR
Sbjct  4    AIFRQKVLLEHLQPTSCFSHQLTHEESSSISPSICLAGDSAAYQRTAAFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKSKRGGFKDT  DDLLA VLKALI+KTN+NPSEVGDI+VGTV+APGS RA+ECRMA
Sbjct  64   TAICKSKRGGFKDTLADDLLAPVLKALIDKTNINPSEVGDIVVGTVVAPGSQRATECRMA  123

Query  412  AFYAG  426
            AFYAG
Sbjct  124  AFYAG  128



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  418  YAG  426
            YAG
Sbjct  123  YAG  125



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 4/120 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+VLL HLRP    +      + + ASVC+AGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVLLDHLRP----ARFPKASTDLVASVCSAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDT PDDLLA VLKALI+KT +NP+EV DI+VGTVLAPGS RASECRMA+FYAG
Sbjct  65   AKRGGFKDTLPDDLLAPVLKALIDKTGINPNEVRDIVVGTVLAPGSQRASECRMASFYAG  124



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQ+VLLQHL PT    S      + S SVC++GD   Y RN+ +GDD+VIVAA RTP
Sbjct  4    ALNRQKVLLQHLNPT----STRPHNVTFSTSVCSSGDDGTYHRNAAFGDDVVIVAACRTP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI+KTN+ PSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKAKRGGFKDTLADDLLAPVLKALIQKTNVKPSEVGDIVVGTVLAPGSARAMECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 100/122 (82%), Gaps = 13/122 (11%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+KRG FKDTYPDDLLASVL+ALIEKTN+NP+EVGDI+VGTVL PGS RASECRMAAFY
Sbjct  52   CKAKRGSFKDTYPDDLLASVLRALIEKTNVNPTEVGDIVVGTVLGPGSQRASECRMAAFY  111

Query  421  AG  426
            AG
Sbjct  112  AG  113



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ A++      S +SAS CAAGDSAAYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPASAG-----SQLSASACAAGDSAAYQRTSCFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  59   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  118

Query  418  YAG  426
             AG
Sbjct  119  LAG  121



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTNVFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ DDLLA VLKA++EKTN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVEKTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSV--SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            A+ RQ++LL HL+P++  SSL   + SV  S S+CAAGDS AY R + + DD+VIVAAYR
Sbjct  4    AVNRQKILLGHLQPSSPLSSLSQTQESVRLSTSICAAGDSTAYHRTAAFNDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKSKR GFKDT+PDDLL SVLKALIEKTN+NP+EVGDI+VGTVLAPGS+RA+ECRMA
Sbjct  64   TAICKSKRRGFKDTHPDDLLGSVLKALIEKTNVNPNEVGDIVVGTVLAPGSVRATECRMA  123

Query  412  AFYAG  426
            AF+AG
Sbjct  124  AFFAG  128



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 13/122 (11%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+KRG FKDTYP+DLLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RA+ECRMAAFY
Sbjct  52   CKAKRGSFKDTYPEDLLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRATECRMAAFY  111

Query  421  AG  426
            AG
Sbjct  112  AG  113



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R  V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTHVFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ DDLLA VLKA++E+TN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVERTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 6/123 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  418  YAG  426
             AG
Sbjct  118  LAG  120



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 6/123 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  418  YAG  426
             AG
Sbjct  118  LAG  120



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 96/120 (80%), Gaps = 4/120 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+V L HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVSLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RA ECRMAAFYAG
Sbjct  65   AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRAIECRMAAFYAG  124



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ ++S+       +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLAPSASSSAQGQ---QLSASACAAGDSAAYQRSSCFGDDVVIVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR A+ 
Sbjct  61   ICKAKRGGFKDTYPEDLLTPVLKAVLDNTGINPGEIGDIVVGTVLGPGSQRAIECRTASL  120

Query  418  YAG  426
             AG
Sbjct  121  LAG  123



>dbj|BAA25250.1| mutated 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=114

 Score =   161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVG  363
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGD+  G
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDMGCG  103



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  AGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPS  339
            AGDSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS
Sbjct  16   AGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPS  75

Query  340  EVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  76   EVGDIVVGTVLAPGSQRASECRMAAFYAG  104



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++SS     +S+SAS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSQSSSS-----TSLSASACLAGDSAAYHRTASFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT+ DDLLA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTHADDLLAPVLKAVIEKTNLNPSEVGDIVVGSVLGGGSQRASECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 100/123 (81%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HL+P++   S  S  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSS--QSHQSPAAILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+I++T LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLKAVIDRTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|KJB10129.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=371

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++  S     SS+SAS CAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSNHS-----SSLSASACAAGDSAAYHRTSTFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKA+IE+TN+NPSEVGDIIVGTVLAPGS RASECRM+AF
Sbjct  59   LCKSKRGGFKDTHADDLLAPVLKAVIERTNVNPSEVGDIIVGTVLAPGSQRASECRMSAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 99/123 (80%), Gaps = 13/123 (11%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  418  YAG  426
            YAG
Sbjct  111  YAG  113



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 99/123 (80%), Gaps = 13/123 (11%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  418  YAG  426
            YAG
Sbjct  111  YAG  113



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  345
            DSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEV
Sbjct  1    DSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEV  60

Query  346  GDIIVGTVLAPGSIRASECRMAAFYAG  426
            GDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  61   GDIVVGTVLAPGSQRASECRMAAFYAG  87



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL H      +SS  S +  ++AS CAAGDSAAYQR S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH---LLPSSSSPSSQPQLAASECAAGDSAAYQRTSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP ++GDI+VGTVL PGS RA+ECRMAAF
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGDIGDIVVGTVLGPGSQRANECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 6/123 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQR+LL HLRP+ +A        S+S +VC+A  SA   R+S +GDD+VIVAA RT 
Sbjct  4    AIERQRILLHHLRPSPSADP-----PSISTAVCSASGSAK-DRSSCFGDDVVIVAACRTA  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+++GGFKDTYPDDLLA VLKAL++KT LNPSEVGDIIVGTVLAPGS RA ECRM AF
Sbjct  58   LCKARKGGFKDTYPDDLLAPVLKALLDKTRLNPSEVGDIIVGTVLAPGSQRAIECRMGAF  117

Query  418  YAG  426
            YAG
Sbjct  118  YAG  120



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  418  YAG  426
            YAG
Sbjct  124  YAG  126



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (80%), Gaps = 8/123 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  418  YAG  426
            YAG
Sbjct  116  YAG  118



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (80%), Gaps = 8/123 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  418  YAG  426
            YAG
Sbjct  116  YAG  118



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL HLR         S  SS+S S C AGDSAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLR---PPPPSSSQASSLSVSACLAGDSAAYQRTSLYGDDVVIVAAQRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLA VL+A+IEKT LNPSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLAPVLRAVIEKTKLNPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   166 bits (419),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQRVLL+HL   N A++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AVDRQRVLLRHL---NPAAAGSPAPPAISASACAAGDSAAYHRRPAFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 4/120 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HL+P     +     ++V  S+C+A DSA Y R + + DD+VIVAAYRTP+CK
Sbjct  7    RQQLLLDHLKPETGRRA----AANVVTSICSANDSAPYARTTDFLDDVVIVAAYRTPICK  62

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDTYPDDLLA VL+A++EKT +NP+E+GDI++GTVLAPG+ RA+ECRMAAFYAG
Sbjct  63   AKRGGFKDTYPDDLLAPVLRAVVEKTGVNPAEIGDIVIGTVLAPGAQRANECRMAAFYAG  122



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSI-ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            AI RQRVLL+HLRP++++ S   I ESS+SAS+C AG+ A    +S  GDDIV+VAA RT
Sbjct  4    AINRQRVLLEHLRPSSSSPSPSPINESSLSASICLAGNRATNPVDS--GDDIVVVAACRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
             +CK+KRGGFKDT PDD+LA VLKALIEKTN++PSEVGDI+VGTVLAPGS RA ECRMAA
Sbjct  62   AICKAKRGGFKDTLPDDILAPVLKALIEKTNVDPSEVGDIVVGTVLAPGSQRAIECRMAA  121

Query  415  FYAG  426
            FYAG
Sbjct  122  FYAG  125



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 10/123 (8%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  418  YAG  426
            YAG
Sbjct  114  YAG  116



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 10/123 (8%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  418  YAG  426
            YAG
Sbjct  114  YAG  116



>ref|XP_006307516.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40414.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=315

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 10/123 (8%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  418  YAG  426
            YAG
Sbjct  114  YAG  116



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL H        S  S +S +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH-----LLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR AAF
Sbjct  59   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLL HL+P  ++SS     SS+S S C AGDS AYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHHLQPLPSSSSQ---ASSLSVSACLAGDSNAYQRTSLYGDDVVIVAAQRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL+HL  + AA++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AIDRQRVLLRHL--SPAAAAESPAPPAISASACAAGDSAAYHRTPAFADDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  62   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   163 bits (412),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHLRP++ +        +++ S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQRVLLQHLRPSSGSDD----RPALTTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKS RGGFK+T+P+DLLA +LKAL++KT +NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSNRGGFKNTHPEDLLAPLLKALLDKTKVNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  418  YAG  426
            YAG
Sbjct  120  YAG  122



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 92/104 (88%), Gaps = 2/104 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  369
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+V TV
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVETV  105



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSH-ESAAALFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  63   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  122

Query  418  YAG  426
            YAG
Sbjct  123  YAG  125



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 104/125 (83%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  412  AFYAG  426
            A+YAG
Sbjct  124  AYYAG  128



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 9/123 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQRVLL HLR   ++SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHLR---SSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  418  YAG  426
            YAG
Sbjct  115  YAG  117



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 104/125 (83%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  412  AFYAG  426
            A+YAG
Sbjct  124  AYYAG  128



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HL P    ++      + +AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAATPAA-----PAFTASACAAGDSAAYHRGACFADDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 9/123 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  418  YAG  426
            YAG
Sbjct  115  YAG  117



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 9/123 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  418  YAG  426
            YAG
Sbjct  115  YAG  117



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 9/126 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDS---IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AIERQRVLL+HL+P ++ S+  S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSAFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDIIVGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIIVGTVLGPGSEKATECRM  117

Query  409  AAFYAG  426
            AAFYAG
Sbjct  118  AAFYAG  123



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 103/126 (82%), Gaps = 4/126 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL+HL+P++++S+        + +SAS C AG+S+  QR     DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPSSSSSNFSHQTHQSTDLSASSCFAGNSSHGQRGGSE-DDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAG  426
            AAFYAG
Sbjct  123  AAFYAG  128



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQR+LL+HL   + A++      ++SAS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AIDRQRILLRHL---DPAAAPSPAPPAISASACAAGDSAAYHRRAAFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ +DLL  VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVLKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ +Q+VLLQHLRP ++ SS +   + +SAS+CAAGDSAAY R + +   I++  AYRT 
Sbjct  4    AMNKQKVLLQHLRPNSSVSSSNYESAPLSASICAAGDSAAYHRTAAFAVKIMLNRAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLL  VLKA+IE+TNLNPS V D++VGTV+APGS+RA+E RM AF
Sbjct  64   ICKAKRGGFKDTLPDDLLPPVLKAVIERTNLNPSAVADVVVGTVMAPGSLRATESRMVAF  123

Query  418  YA  423
            YA
Sbjct  124  YA  125



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 10/123 (8%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  418  YAG  426
            YAG
Sbjct  114  YAG  116



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 7/123 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL HL+P +++S+     +S+S S C AG++   QR S Y DD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPLSSSSN----AASLSVSACFAGEN---QRTSQYEDDVVIVAAQRTA  56

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLA VL+ALIEKT+LNPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  57   LCKAKRGSFKDTYPDELLAPVLRALIEKTHLNPSEVGDIVVGTVLGPGSQRASECRMAAF  116

Query  418  YAG  426
            YAG
Sbjct  117  YAG  119



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HL     A+S  +   +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHL---EPAASPAAAAPAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HL     A+S  +   +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLE---PAASPAAAAPAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>gb|KCW50170.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAG  426
            AFYAG
Sbjct  124  AFYAG  128



>gb|KCW50169.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAG  426
            AFYAG
Sbjct  124  AFYAG  128



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 98/126 (78%), Gaps = 9/126 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAAS---SLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AIERQRVLL+HL+P ++ S   S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSVFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDI+VGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIVVGTVLGPGSEKATECRM  117

Query  409  AAFYAG  426
            AAFYAG
Sbjct  118  AAFYAG  123



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 7/125 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  231
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  13   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  67

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  68   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  127

Query  412  AFYAG  426
            AF AG
Sbjct  128  AFCAG  132



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  418  YAG  426
            YAG
Sbjct  122  YAG  124



>gb|AEQ94132.1| putative 3-ketoacyl CoA thiolase [Elaeis guineensis]
Length=324

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  345
            DSAAYQR+S +GDD+V+VAAYRTP+CKSKRGGFKDT+P+DLLA+VLK L++KT LNP+EV
Sbjct  1    DSAAYQRSSSFGDDVVVVAAYRTPICKSKRGGFKDTHPEDLLATVLKGLLDKTKLNPNEV  60

Query  346  GDIIVGTVLAPGSIRASECRMAAFYAG  426
             DI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  61   SDIVVGTVLAPGSQRATECRMAAFYAG  87



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAG  426
            AFYAG
Sbjct  124  AFYAG  128



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  148  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  327
            S+C AGDSAAYQR + +GDD+VIVAAYRT +CK+KRGGFK+T  DDLLA VLKA++EKTN
Sbjct  32   SICLAGDSAAYQRTAAFGDDVVIVAAYRTAICKAKRGGFKNTLADDLLAPVLKAVVEKTN  91

Query  328  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            L+P+EVGDI+VGTVLAPGS+RA ECRMAAFYAG
Sbjct  92   LSPNEVGDIVVGTVLAPGSLRAMECRMAAFYAG  124



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 7/125 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  231
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  54   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  108

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  109  TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  168

Query  412  AFYAG  426
            AF AG
Sbjct  169  AFCAG  173



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAG  426
            AFYAG
Sbjct  124  AFYAG  128



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 13/126 (10%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLK---ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            LCK+KRG FKDT+PD+LLASVL+   ALIEKTN+NPSEVGDI+VGTVL PGS RASECRM
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRVCLALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRM  113

Query  409  AAFYAG  426
            AAFYAG
Sbjct  114  AAFYAG  119



>ref|XP_007049827.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOX93984.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=376

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAG  426
            RMAAFYAG
Sbjct  124  RMAAFYAG  131



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 102/126 (81%), Gaps = 4/126 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL+HL+P +++S+        + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAG  426
            AAFYAG
Sbjct  123  AAFYAG  128



>ref|XP_007049828.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
 gb|EOX93985.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
Length=374

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAG  426
            RMAAFYAG
Sbjct  124  RMAAFYAG  131



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLL H           S ++S+S S C AG SAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHH---LQPPLPSSSSQASLSVSACLAGGSAAYQRTSLYGDDVVIVAAQRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 102/126 (81%), Gaps = 4/126 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL+HL+P +++S+        + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTPPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAG  426
            AAFYAG
Sbjct  123  AAFYAG  128



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 7/125 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  231
            A  RQ+VLLQHL+P++++ S     +S+S SVC AG+SA+  Y R + +GDDIVIVAA R
Sbjct  4    AFNRQKVLLQHLQPSSSSES-----ASLSTSVCVAGESASNSYHRTAAFGDDIVIVAANR  58

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  59   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  118

Query  412  AFYAG  426
            AF AG
Sbjct  119  AFCAG  123



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAG  426
            RMAAFYAG
Sbjct  124  RMAAFYAG  131



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAG  426
            RMAAFYAG
Sbjct  124  RMAAFYAG  131



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 4/126 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL HL+P +++S+        + +SAS+C A +S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLDHLQPISSSSNFSSQTHQSTDLSASLCFAKNSSHGQIGG-SDDDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN+NP+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVNPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAG  426
            AAFYAG
Sbjct  123  AAFYAG  128



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P ++ SS  + E +V +SV  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPISSFSSSLNHEPTVLSSVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  61   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 82/94 (87%), Gaps = 4/94 (4%)
 Frame = +1

Query  145  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  324
            AS C A +SAAYQ    YGDD+VIVAA RTPLCK+KRG FKDTYPD+LLASVL+ LIEKT
Sbjct  1    ASPCLAKESAAYQ----YGDDVVIVAAQRTPLCKAKRGSFKDTYPDELLASVLRGLIEKT  56

Query  325  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            N+NPSEVGDI+VGTVL PGS RASECRMAAFYAG
Sbjct  57   NVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAG  90



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 95/120 (79%), Gaps = 9/120 (8%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+VLL HL+P     +         +S+C+A DSA Y R + + DD+VIVAAYRT +C+
Sbjct  7    RQQVLLDHLKPETGRRA---------SSICSANDSAPYARTTDFLDDVVIVAAYRTAICR  57

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDTYPDDLLA VL+A++EKT ++P+E+GDI++G+VLAPG+ RA+ECRMAAF+AG
Sbjct  58   AKRGGFKDTYPDDLLAPVLRAVVEKTGVSPAEIGDIVIGSVLAPGAQRANECRMAAFFAG  117



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P  ++SS  ++     A + A   ++ +   + +GDDIVIVAAYRT 
Sbjct  4    ATERQKILLRHLNPIYSSSSSLTLIKDEPALLSAVNCASEFSPMAAFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  418  YAG  426
            +AG
Sbjct  124  FAG  126



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  145  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  324
            AS CAAGDSAAYQR+S +GDD+VIVAAYRTP+CK+KRGGFKDTYP+DLL  VLKA+++KT
Sbjct  36   ASACAAGDSAAYQRSSCFGDDVVIVAAYRTPICKAKRGGFKDTYPEDLLTPVLKAVLDKT  95

Query  325  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
             +NP+++GD++VGTVL PGS RA ECR A+  AG
Sbjct  96   GINPAQIGDVVVGTVLGPGSQRAIECRTASLLAG  129



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQ++LL+HL P ++ +S  + E S+ + V  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AVERQKILLRHLNPISSTNSSLNHEPSLFSLVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>gb|ACJ84675.1| unknown [Medicago truncatula]
Length=234

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            LCK KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  G
Sbjct  63   LCKVKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAG  110



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQR+LL+HL P   AS   S  S+   +   AGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEPAAGASPAASAVSASVCA---AGDSAAYHRGPCFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDT P+DLL  V KAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQ++LL+HL P ++++S    E S+ + V    + +     + +GDDIVIVAAYRT 
Sbjct  4    AMERQKILLRHLNPVSSSNSSLKHEPSLLSPVNCVSEVSPM---AAFGDDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  418  YAG  426
            +AG
Sbjct  121  FAG  123



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 98/123 (80%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P ++ S      + +SA  CAA  S+     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLNPLSS-SPPPYKPTLLSAVNCAAELSSM----AAFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AAF
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAF  118

Query  418  YAG  426
            +AG
Sbjct  119  FAG  121



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 99/123 (80%), Gaps = 4/123 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P  ++SSL+   S +S   CA+  S      + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPIPSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  60   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  119

Query  418  YAG  426
            +AG
Sbjct  120  FAG  122



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 97/123 (79%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P ++ S      + +SA  CAA  S      + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLYPLSS-SPPPYKPTLLSAVNCAAELSPM----ASFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  118

Query  418  YAG  426
            +AG
Sbjct  119  FAG  121



>ref|XP_007049829.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
 gb|EOX93986.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
Length=333

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  148  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  327
            S+CAAGD +AY   + + +D+VIVAA RT +CK+KRGGFKDT  DDLLA VLKALI++T 
Sbjct  9    SICAAGDGSAYHGTAAFANDVVIVAACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTK  68

Query  328  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            LNPSEVGDI+VGTVLAPGS R  ECRMAAFYAG
Sbjct  69   LNPSEVGDIVVGTVLAPGSQRGIECRMAAFYAG  101



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 6/125 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESS--VSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            A ERQ++ L+HL P  ++SS      S  +S   CA+  S      + +GDDIVIVAAYR
Sbjct  4    AAERQKIFLRHLNPIPSSSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYR  59

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+A
Sbjct  60   TAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVA  119

Query  412  AFYAG  426
            A++AG
Sbjct  120  AYFAG  124



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++L++HL P +++ SL SI  +    + A   +A     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILIRHLNPLSSSPSLPSINDNKPTLLSAVNCAAELSPMAAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  418  YAG  426
            +AG
Sbjct  124  FAG  126



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTN-AASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A ERQ++LL+HL P   ++SS  + ESSV   V  A + +     + +GDDIVIVAAYRT
Sbjct  4    AAERQKILLRHLNPIPCSSSSSLNHESSVLYPVNCASEVSPM---AAFGDDIVIVAAYRT  60

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA
Sbjct  61   AICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAA  120

Query  415  FYAG  426
            ++AG
Sbjct  121  YFAG  124



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSA---AYQRNSVYGDDIVIVAAYRTP  237
            RQ+VL+ HL   + A  L +    VS SVC  GDS    A    S   DD+VIVAAYRTP
Sbjct  2    RQQVLMGHLTGFSTAP-LVAHNLLVSPSVCMGGDSGIDHARAAESCNDDDVVIVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             C++KRGGFKDT P+DLL  VLKA++E+T + P EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   QCRAKRGGFKDTRPEDLLDPVLKAVVERTGIRPDEVGDIVVGTVLAPGSRRAMECRMAAF  120

Query  418  YAG  426
            YAG
Sbjct  121  YAG  123



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 11/123 (9%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQR+LL+HL P   A+  +   S++SAS CAAG          + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP---AAGPNPAASAISASACAAG--------GCFADDVVIVAAYRTA  52

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT P+DLL  V KAL++KT LNPSE+GDI+VGTVLAPGS RA ECRMAA 
Sbjct  53   ICKSKRGGFKDTLPEDLLVPVFKALVDKTKLNPSEIGDIVVGTVLAPGSQRAIECRMAAL  112

Query  418  YAG  426
            YAG
Sbjct  113  YAG  115



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   138 bits (348),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 5/123 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQ VL +HL+    +SS D   +S+SASV AAGDS+AYQ+N  + DD+VIVAA RT 
Sbjct  4    AIDRQGVLRRHLQ----SSSYDH-PTSLSASVGAAGDSSAYQKNHGFDDDVVIVAACRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            + K+ RGGFKDT+ +DLLA +LKAL+EKT LNP EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   IGKANRGGFKDTHAEDLLAPLLKALLEKTKLNPYEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  418  YAG  426
            YAG
Sbjct  119  YAG  121



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = +1

Query  67   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  243
            RQ+VLL HLRP  N  ++ + ++  + AS CAAGDSAAY+R +   DD+VIV+A RTP+ 
Sbjct  13   RQQVLLNHLRPAGNTEAAFERMQ--LQASACAAGDSAAYERRASGPDDVVIVSALRTPIT  70

Query  244  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  423
            K+KRGGFKDT PDDL+A+V +A +++T +NP+++GDI++G+VL   S RA + R+A F A
Sbjct  71   KAKRGGFKDTLPDDLMAAVFQATLDRTGINPADIGDIVIGSVLGDSSQRAIQVRIAGFLA  130

Query  424  G  426
            G
Sbjct  131  G  131



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLA
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA++AG
Sbjct  64   PGSQRAMECRVAAYFAG  80



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLA
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA++AG
Sbjct  64   PGSQRAMECRVAAYFAG  80



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLA
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA++AG
Sbjct  64   PGSQRAMECRVAAYFAG  80



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA++AG
Sbjct  64   PGSQRAMECRVAAYFAG  80



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA++AG
Sbjct  64   PGSQRAMECRVAAYFAG  80



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA++AG
Sbjct  64   PGSQRAMECRVAAYFAG  80



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDD+VIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDVVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA++AG
Sbjct  64   PGSQRAMECRVAAYFAG  80



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAA+RT +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAHRTAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAG  426
            PGS RA ECR+AA+YAG
Sbjct  64   PGSQRAMECRVAAYYAG  80



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 84/121 (69%), Gaps = 8/121 (7%)
 Frame = +1

Query  67   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  243
            R  VL +H+ P  N    L       S   C+AGDSAAY+R++   DD+VIVAA RTPL 
Sbjct  10   RLSVLAKHICPVPNGVQGL-------SLQGCSAGDSAAYERHNTADDDVVIVAALRTPLT  62

Query  244  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  423
            K++RGG KDT   DLLA+V KA++++T + P  +GDI++G+VL P S RA+ECR+A+F+A
Sbjct  63   KARRGGLKDTDAVDLLATVFKAVLDRTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFA  122

Query  424  G  426
            G
Sbjct  123  G  123



>ref|XP_001697225.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
 gb|EDP00480.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
Length=461

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  136  SVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALI  315
            S+S   C+AGDSAAY+R +   DD+VIVA+ RTPL K+KRGG +DT   DLL+++ KA++
Sbjct  25   SLSLQTCSAGDSAAYERRNTADDDVVIVASLRTPLTKAKRGGLRDTDAADLLSTLFKAVL  84

Query  316  EKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            E+T + P  +GDI++G+VL P S RA+ECR+A+F+AG
Sbjct  85   ERTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFAG  121



>ref|XP_005845320.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
 gb|EFN53218.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
Length=354

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ+VLL HL    ++++      S   +  +AGDSAAY+R ++  DD+VIV+A RT 
Sbjct  4    AAHRQQVLLGHLEAAVSSAAPAPPPMSAHPT--SAGDSAAYERRNLACDDVVIVSACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT  DDL+A+VLK  I ++ + P  VGD+  G+V+ P S RA+ECR+A F
Sbjct  62   LCKAKRGGFKDTPVDDLIATVLKETIRRSGVEPEAVGDVCFGSVMGPSSQRANECRIAMF  121

Query  418  YAG  426
             AG
Sbjct  122  LAG  124



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P+EVGDI+VGTV+APG
Sbjct  16   DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPAEVGDIVVGTVIAPG  75

Query  382  SIRASECRMAAFYAG  426
            S RA+ECR+AA  AG
Sbjct  76   SHRAAECRIAALLAG  90



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P++VGDI+VGTV+APG
Sbjct  6    DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPADVGDIVVGTVIAPG  65

Query  382  SIRASECRMAAFYAG  426
            S RA+ECR+AA  AG
Sbjct  66   SHRAAECRIAALLAG  80



>gb|KIY92728.1| acetyl-CoA acyltransferase 1 [Monoraphidium neglectum]
Length=323

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +1

Query  133  SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  312
            + +S   C+AGDS+AYQR     DD+VIV+A RTPL K++RGG +DT   DLLA+V +A 
Sbjct  23   AGLSLQSCSAGDSSAYQRQGAALDDVVIVSALRTPLTKARRGGLRDTDAVDLLATVYRAT  82

Query  313  IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +++T + P+ +GD++VG+VL P S RA+E R+A F AG
Sbjct  83   LDRTRVEPAALGDVVVGSVLGPSSQRANEARIAMFIAG  120



>emb|CDY07823.1| BnaC03g47990D [Brassica napus]
Length=319

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = +1

Query  76   VLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKR  255
            VLL+HLRP    SS  S E S+SAS C A DSAAYQR S+YGDD+VIVAA+RT LCKSKR
Sbjct  179  VLLEHLRP----SSSHSFEGSLSASACLAWDSAAYQRTSLYGDDVVIVAAHRTALCKSKR  234

Query  256  GGFKDTYPDDLLAS  297
            G FKDT+PDD  AS
Sbjct  235  GNFKDTFPDDHFAS  248



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 10/123 (8%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A +RQ+VLL HL   +    +    +S  +    AGD           DD+VIV+  RT 
Sbjct  4    AAQRQKVLLSHLASAHGTPEVAPQPTSAESHDRRAGDL----------DDVVIVSTCRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LC+++RGGFKDT  DDL+A+VLK  + +T + P  VGDI+ G+V+ P S RA+E RMA  
Sbjct  54   LCRARRGGFKDTPVDDLIAAVLKDTLRRTGIEPEAVGDIVFGSVMGPSSQRANELRMAML  113

Query  418  YAG  426
            +AG
Sbjct  114  FAG  116



>ref|XP_002591918.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
 gb|EEN47929.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
Length=430

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 73/122 (60%), Gaps = 10/122 (8%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            +ER + +  H+   N A +          S  +   +    R +   DD+VI++A RTP+
Sbjct  1    MERMQTIFGHISVPNRAQN---------QSFSSLAQNEVKGRFAESEDDVVIISALRTPI  51

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
             K+ RG FKDT PDDLL SVLKA +E+TN+NPSE+GDI VG VL PG+  A   R+A F 
Sbjct  52   GKAARGSFKDTTPDDLLVSVLKATLERTNVNPSEIGDICVGNVLQPGAGPAV-FRIAQFA  110

Query  421  AG  426
            AG
Sbjct  111  AG  112



>ref|XP_960422.1| 3-ketoacyl-CoA thiolase [Neurospora crassa OR74A]
 ref|XP_009854111.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2508]
 gb|EAA31186.1| 3-ketoacyl-CoA thiolase [Neurospora crassa OR74A]
 gb|EGO54113.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2508]
 gb|EGZ68464.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2509]
 gb|KHE88997.1| hypothetical protein GE21DRAFT_8776 [Neurospora crassa]
Length=419

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +1

Query  118  LDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLAS  297
            L  I + +SA V   G     Q+N+   DDIV+  A RTP  K  +GGFKDT+  DL+A 
Sbjct  7    LSQIGNQISAGVTGGGRDQILQKNA---DDIVVTCALRTPFTKGGKGGFKDTHAADLMAG  63

Query  298  VLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
             L+ LIE++ ++PS V DI VGTVLAPG   A+E R AA  AG
Sbjct  64   ALRGLIERSKIDPSLVEDIKVGTVLAPGG-GATEMRAAALVAG  105



>ref|XP_004349337.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE91455.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
Length=423

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIV+A RTP+ K+KRGGF+DT PDDLLA+ ++A +++ N++P  +GDI+VG VL PG
Sbjct  35   DDVVIVSAVRTPITKAKRGGFRDTPPDDLLAAAMQAAVQRANVDPKLIGDIVVGNVLQPG  94

Query  382  SIRASECRMAAFYAG  426
            +  A   R A F+AG
Sbjct  95   A-GALTSRFAQFFAG  108



>ref|XP_005852686.1| 3-ketoacyl- thiolase peroxisomal, partial [Nannochloropsis gaditana 
CCMP526]
 gb|EKU23146.1| 3-ketoacyl- thiolase peroxisomal, partial [Nannochloropsis gaditana 
CCMP526]
Length=392

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  184  RNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVG  363
            R    G D+V+V+A RTPLCK+KRG FK T  DDLLA VL+A+++++ ++ + +GDI+VG
Sbjct  26   RPGFLGGDVVVVSALRTPLCKAKRGAFKSTTTDDLLAPVLEAVVKQSGVDAATLGDIVVG  85

Query  364  TVLAPGSIRASECRMAAFYAG  426
             VL PGS  A   RMA FYAG
Sbjct  86   NVLQPGS-GAVGARMAQFYAG  105



>ref|XP_005854303.1| beta-ketoacyl-CoA thiolase [Nannochloropsis gaditana CCMP526]
 gb|EKU22055.1| beta-ketoacyl-CoA thiolase [Nannochloropsis gaditana CCMP526]
Length=424

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  184  RNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVG  363
            R    G D+V+V+A RTPLCK+KRG FK T  DDLLA VL+A+++++ ++ + +GDI+VG
Sbjct  26   RPGFLGGDVVVVSALRTPLCKAKRGAFKSTTTDDLLAPVLEAVVKQSGVDAATLGDIVVG  85

Query  364  TVLAPGSIRASECRMAAFYAG  426
             VL PGS  A   RMA FYAG
Sbjct  86   NVLQPGS-GAVGARMAQFYAG  105



>gb|EWM24705.1| 3-ketoacyl- thiolase peroxisomal [Nannochloropsis gaditana]
Length=424

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  184  RNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVG  363
            R    G D+V+V+A RTPLCK+KRG FK T  DDLLA VL+A+++++ ++ + +GDI+VG
Sbjct  26   RPGFLGGDVVVVSALRTPLCKAKRGAFKSTTTDDLLAPVLEAVVKQSGVDAATLGDIVVG  85

Query  364  TVLAPGSIRASECRMAAFYAG  426
             VL PGS  A   RMA FYAG
Sbjct  86   NVLQPGS-GAVGARMAQFYAG  105



>ref|NP_001072686.1| 3-ketoacyl-CoA thiolase, peroxisomal [Xenopus (Silurana) tropicalis]
 gb|AAI24020.1| acetyl-Coenzyme A acyltransferase 1 [Xenopus (Silurana) tropicalis]
Length=419

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 72/122 (59%), Gaps = 18/122 (15%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            + R RV+L HL P N            S  + A   SAA  ++     DIVIVA  RTP+
Sbjct  1    MHRVRVVLGHL-PAN------------SRGIWAENSSAAADKS----QDIVIVAGRRTPI  43

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+KRGGFK+T PD+LL++V+ A++   NLNP  +GDI VG VL PG+  A   R+  F 
Sbjct  44   CKAKRGGFKETTPDELLSAVMTAVLNDVNLNPELLGDICVGNVLQPGA-GALVARIGQFL  102

Query  421  AG  426
            +G
Sbjct  103  SG  104



>ref|XP_003353115.1| hypothetical protein SMAC_03432 [Sordaria macrospora k-hell]
 emb|CCC09876.1| unnamed protein product [Sordaria macrospora k-hell]
Length=419

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +1

Query  118  LDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLAS  297
            L  I + +SA V   G     Q+N+   DDIV+  A RTP  K  +GGFKDT+  DL+A 
Sbjct  7    LSQIGNQISAGVTGGGRDKILQKNA---DDIVVTCALRTPFTKGGKGGFKDTHAADLMAG  63

Query  298  VLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
             L+ LIE++ ++P+ V DI VGTVLAPG   A+E R AA  AG
Sbjct  64   ALRGLIERSKIDPALVEDIKVGTVLAPGG-GATEMRAAALVAG  105



>emb|CEF98532.1| Thiolase-like, subgroup [Ostreococcus tauri]
Length=424

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  41   DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  100

Query  382  SIRASECRMAAFYAG  426
            S RA+ECR+A F AG
Sbjct  101  SQRANECRIAMFLAG  115



>ref|XP_003664280.1| 3-ketoacyl-CoA thiolase [Myceliophthora thermophila ATCC 42464]
 gb|AEO59035.1| 3-ketoacyl-CoA thiolase [Myceliophthora thermophila ATCC 42464]
Length=419

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  103  NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPD  282
             A   L  + S +S +  A G +   ++N    DDIV+ AA RT +CK  +G FKDT+  
Sbjct  2    GALDRLSQLGSQISGTASAGGKAKLLEKNP---DDIVVTAALRTAICKGGKGFFKDTFAA  58

Query  283  DLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            DL+A  LK +IE++ +NP+ V DI VGTVLAPG   A+E R AA  AG
Sbjct  59   DLMAGALKGIIERSKINPALVQDIAVGTVLAPGG-GATEMRAAALVAG  105



>gb|ERZ96342.1| hypothetical protein GLOINDRAFT_71751 [Rhizophagus irregularis 
DAOM 181602]
Length=417

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+V+V A RTP+ KSK+GGFKDT P+DLLA+V KA++EK+ ++P+ + D+ VG VL PG
Sbjct  28   DDVVVVTAVRTPMTKSKKGGFKDTLPEDLLAAVFKAILEKSKIDPNLIQDVAVGNVLPPG  87

Query  382  SIRASECRMAAFYAG  426
               A+  R A+ YAG
Sbjct  88   G-GANVARAASLYAG  101



>gb|EPZ32623.1| 3-ketoacyl-CoA thiolase A, peroxisomal [Rozella allomycis CSF55]
Length=407

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIV++ RTP+C++KRG FKDT+ ++LLA VLKA++EK  LN + V DIIVG VL PG
Sbjct  20   DDVVIVSSVRTPICRAKRGPFKDTHQEELLAVVLKAVVEKVGLNKALVDDIIVGNVLPPG  79

Query  382  SIRASECRMAAFYAG  426
               A+  RMA  YAG
Sbjct  80   G-GATISRMAQLYAG  93



>ref|XP_643924.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
 gb|EAL70062.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
Length=416

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  199  GDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAP  378
            GDDIVIVA +RT +CK+KRG FK+T PDDLLA V+K +I+ T L+P  +GD+++G VL  
Sbjct  32   GDDIVIVAPFRTAICKAKRGAFKETAPDDLLAPVIKHIIKVTKLDPKLIGDVVMGAVLPR  91

Query  379  GSIRASECRMAAFYAG  426
             S  A+E R+A   AG
Sbjct  92   SSQGATEVRVATLLAG  107



>ref|XP_003080093.1| Dynein 1-alpha heavy chain, flagellar inner arm (IC) [Ostreococcus 
tauri]
Length=5068

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  202   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
             DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  4685  DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  4744

Query  382   SIRASECRMAAFYAG  426
             S RA+ECR+A F AG
Sbjct  4745  SQRANECRIAMFLAG  4759



>gb|EIE80258.1| hypothetical protein RO3G_04963 [Rhizopus delemar RA 99-880]
Length=415

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            +D+VIVAA RT + ++++GGFKDT P+++LA V K LIE+T ++P+ V DI VG VL PG
Sbjct  28   EDVVIVAALRTAITRARKGGFKDTLPEEMLAGVFKGLIEQTKIDPAIVNDIAVGNVLPPG  87

Query  382  SIRASECRMAAFYAG  426
               A+  RMAA YAG
Sbjct  88   G-GATNARMAALYAG  101



>emb|CCA76233.1| probable POT1-acetyl-CoA C-acyltransferase, peroxisomal [Piriformospora 
indica DSM 11827]
Length=402

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            + DD+V+V+AYRT + K+++GGFKDT+P+++LA+VL+A+  K NL+P  + D+ VG VL 
Sbjct  11   HDDDVVVVSAYRTAITKARKGGFKDTHPEEMLAAVLRAVYTKVNLDPKLIQDVSVGNVLP  70

Query  376  PGSIRASECRMAAFYAG  426
            PG   A+  RMA  YAG
Sbjct  71   PGG-GATVARMAQLYAG  86



>gb|KDN71907.1| putative acetyl-CoA acetyltransferase [Colletotrichum sublineola]
Length=415

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 4/98 (4%)
 Frame = +1

Query  133  SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  312
            + +     A G     Q+N    DD+V+ AA RTP  K  +GGFKDT   DL+A  LKAL
Sbjct  8    TQLGGQFSAGGKDKILQKNP---DDVVVTAALRTPFTKGGKGGFKDTQAADLMAGALKAL  64

Query  313  IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            IE++ ++P+ V DI VGTVLAPG   A+E R AA  AG
Sbjct  65   IERSKIDPALVEDIAVGTVLAPGG-GATEMRAAALVAG  101



>emb|CCF32753.1| acetyl-CoA acetyltransferase [Colletotrichum higginsianum]
Length=415

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query  133  SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  312
            + +     A G     Q+N+   DD+V+ AA RTP  K  +GGFKDT   DL+A  LKAL
Sbjct  8    TQLGGQFTAGGKDKILQKNA---DDVVVTAALRTPFTKGGKGGFKDTQAADLMAGALKAL  64

Query  313  IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +E++ ++P+ V DI VGTVLAPG   A+E R AA  AG
Sbjct  65   LERSKIDPALVEDIAVGTVLAPGG-GATEMRAAALVAG  101



>gb|EFQ33554.1| acetyl-CoA acetyltransferase [Colletotrichum graminicola M1.001]
Length=415

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query  133  SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  312
            + +     A G     Q+N+   DD+V+ AA RTP  K  +GGFKDT   DL+A  LKAL
Sbjct  8    TQLGGQFSAGGKDKILQKNA---DDVVVTAALRTPFTKGGKGGFKDTQAADLMAGALKAL  64

Query  313  IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +E++ ++P+ V DI VGTVLAPG   A+E R AA  AG
Sbjct  65   LERSKIDPALVEDIAVGTVLAPGG-GATEMRAAALVAG  101



>ref|XP_003001876.1| 3-ketoacyl-CoA thiolase [Verticillium alfalfae VaMs.102]
 gb|EEY22025.1| 3-ketoacyl-CoA thiolase [Verticillium alfalfae VaMs.102]
Length=416

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +1

Query  151  VCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNL  330
            V A+G     Q+N    DD+V+ AA RTP  K  +GGFKDT   DL+A  LKAL+E++ +
Sbjct  15   VGASGKEKLLQKNP---DDVVVTAALRTPFTKGGKGGFKDTQAADLMAGALKALLERSKI  71

Query  331  NPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +P+ V DI VGTVLAPG   A+E R AA  AG
Sbjct  72   DPALVEDIAVGTVLAPGG-GATEMRAAALVAG  102



>gb|EPE04951.1| 3-ketoacyl- thiolase [Ophiostoma piceae UAMH 11346]
Length=418

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = +1

Query  118  LDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLAS  297
            L SI S ++ S  A G +   ++N    DD+V+ AA RTP  K  +GGFKDT   DL+  
Sbjct  7    LSSISSQITGSP-AGGKAKLLEKNP---DDVVVTAALRTPFTKGGKGGFKDTQASDLIVG  62

Query  298  VLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
             LKALIE++ ++P+ V D++VGTVLAPG   A+E R A   AG
Sbjct  63   ALKALIERSKIDPALVEDVVVGTVLAPGG-GATEMRAAVLVAG  104



>gb|EHK49858.1| putative 3-ketoacyl-CoA thiolase [Trichoderma atroviride IMI 
206040]
Length=419

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 4/108 (4%)
 Frame = +1

Query  103  NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPD  282
            +A + +  I   +S +  A G     +++    DDIV+ AA RT   K  +GGFKDT   
Sbjct  2    SAVARISQIGGQISGNPTAGGREKLLEKHP---DDIVVTAACRTAFTKGGKGGFKDTPAG  58

Query  283  DLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            DLLA VLKAL+E++ +NP+ V DI VG VLAPG+  A+E R AAF AG
Sbjct  59   DLLAGVLKALLERSKINPALVEDIAVGNVLAPGA-GATEFRAAAFVAG  105



>ref|XP_005082434.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Mesocricetus 
auratus]
Length=286

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 17/124 (14%)
 Frame = +1

Query  61   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            + R +V+L HL  RP ++        S++ A+ C+AG   A+        D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFRQAW------ASDVVVVHGRRT  46

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+ ++ RGGFKDT PD+LL++VL A+++   L P E+GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPEELGDISVGNVLQPGA-GAIMARIAQ  105

Query  415  FYAG  426
            F +G
Sbjct  106  FLSG  109



>ref|XP_008161239.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal isoform X2 [Chrysemys 
picta bellii]
Length=421

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 73/124 (59%), Gaps = 13/124 (10%)
 Frame = +1

Query  61   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            ++R  V+L HL  RP            ++ A+ C  G  AA        DD+V+V   RT
Sbjct  1    MQRVTVVLGHLAARPVGG--------PALRAAQC--GGVAAGPGRDGEPDDVVVVHGLRT  50

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+ K+KRGGFKDT PD+LL++V+ A++   NL+P +VGDI VG VL PG+  A   R+A 
Sbjct  51   PIAKAKRGGFKDTTPDELLSAVMTAVLTDVNLSPEKVGDICVGNVLQPGA-GAFTARVAQ  109

Query  415  FYAG  426
            F +G
Sbjct  110  FLSG  113



Lambda      K        H        a         alpha
   0.316    0.130    0.364    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175