BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016P12

Length=412
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003612221.1|  hypothetical protein MTR_5g022670                72.0    6e-12   Medicago truncatula
gb|AFK40961.1|  unknown                                               71.2    8e-12   Lotus japonicus
ref|XP_004287784.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  70.5    2e-11   Fragaria vesca subsp. vesca
ref|NP_001242304.1|  uncharacterized protein LOC100811369             69.7    3e-11   
ref|XP_006572883.1|  PREDICTED: uncharacterized protein LOC100811...  69.7    3e-11   
ref|XP_007157885.1|  hypothetical protein PHAVU_002G106200g           69.7    3e-11   Phaseolus vulgaris [French bean]
ref|XP_004512157.1|  PREDICTED: cell number regulator 13-like iso...  69.7    3e-11   
emb|CAN71842.1|  hypothetical protein VITISV_036262                   69.7    4e-11   Vitis vinifera
ref|XP_004512162.1|  PREDICTED: cell number regulator 13-like iso...  68.9    5e-11   
tpg|DAA43437.1|  TPA: putative cell number regulator 13               66.6    5e-11   
ref|XP_009803786.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  68.9    5e-11   Nicotiana sylvestris
ref|XP_009611045.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  68.9    5e-11   Nicotiana tomentosiformis
dbj|BAK32933.1|  mid1-complementing activity 2                        68.9    5e-11   Nicotiana tabacum [American tobacco]
ref|XP_004985646.1|  PREDICTED: cell number regulator 13-like         68.9    6e-11   Setaria italica
ref|XP_009363461.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  67.8    2e-10   
ref|XP_008665504.1|  PREDICTED: cell number regulator 13-like         65.5    2e-10   
ref|XP_008352422.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  67.4    2e-10   Malus domestica [apple tree]
ref|XP_010933353.1|  PREDICTED: cell number regulator 13-like iso...  67.0    3e-10   
ref|XP_010933352.1|  PREDICTED: cell number regulator 13-like iso...  66.6    4e-10   Elaeis guineensis
gb|KDP23985.1|  hypothetical protein JCGZ_25373                       66.6    4e-10   Jatropha curcas
ref|XP_002468480.1|  hypothetical protein SORBIDRAFT_01g046630        66.6    4e-10   Sorghum bicolor [broomcorn]
ref|XP_008448524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  66.6    4e-10   Cucumis melo [Oriental melon]
ref|XP_004146155.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  66.6    4e-10   Cucumis sativus [cucumbers]
gb|ACN26521.1|  unknown                                               66.6    4e-10   Zea mays [maize]
ref|NP_001182136.1|  cell number regulator 13                         66.6    4e-10   Zea mays [maize]
ref|XP_008242042.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  66.2    5e-10   Prunus mume [ume]
ref|NP_001049013.1|  Os03g0157300                                     66.2    6e-10   
gb|EEE65313.1|  hypothetical protein OsJ_20556                        66.2    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002531154.1|  conserved hypothetical protein                   64.3    9e-10   
ref|XP_006574667.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  65.5    9e-10   
ref|XP_007156188.1|  hypothetical protein PHAVU_003G265800g           65.5    9e-10   Phaseolus vulgaris [French bean]
ref|XP_008807147.1|  PREDICTED: cell number regulator 13-like         65.5    9e-10   Phoenix dactylifera
ref|XP_008242040.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  65.5    9e-10   Prunus mume [ume]
ref|XP_007202160.1|  hypothetical protein PRUPE_ppa006351mg           65.5    9e-10   Prunus persica
ref|XP_003519857.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  65.1    1e-09   
ref|XP_006574663.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  65.1    1e-09   Glycine max [soybeans]
gb|AAM51833.1|AC105730_7  Unknown protein                             66.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002272810.2|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  65.1    1e-09   Vitis vinifera
ref|XP_004232512.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  65.1    1e-09   Solanum lycopersicum
ref|XP_003629262.1|  Cornifelin                                       65.1    1e-09   Medicago truncatula
ref|XP_006599316.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.3    1e-09   
ref|XP_010920111.1|  PREDICTED: cell number regulator 13-like         64.7    2e-09   Elaeis guineensis
gb|KJB17609.1|  hypothetical protein B456_003G007400                  64.7    2e-09   Gossypium raimondii
ref|XP_006340771.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.7    2e-09   Solanum tuberosum [potatoes]
ref|XP_009408218.1|  PREDICTED: cell number regulator 13-like iso...  64.7    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004159726.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...  64.7    2e-09   
ref|XP_009408217.1|  PREDICTED: cell number regulator 13-like iso...  64.3    2e-09   
ref|XP_009408216.1|  PREDICTED: cell number regulator 13-like iso...  64.3    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO71309.1|  hypothetical protein CISIN_1g014734mg                 64.3    2e-09   Citrus sinensis [apfelsine]
ref|XP_004509394.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.3    3e-09   Cicer arietinum [garbanzo]
gb|KHN35538.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                 64.3    3e-09   Glycine soja [wild soybean]
ref|XP_003548830.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.3    3e-09   Glycine max [soybeans]
gb|KJB17606.1|  hypothetical protein B456_003G007400                  64.3    3e-09   Gossypium raimondii
gb|KHG25004.1|  mid1-complementing activity 1 -like protein           64.3    3e-09   Gossypium arboreum [tree cotton]
ref|XP_006599313.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.3    3e-09   
ref|XP_010935125.1|  PREDICTED: cell number regulator 13-like         63.9    3e-09   Elaeis guineensis
pir||T08859  hypothetical protein A_TM017A05.4 - Arabidopsis thal...  62.8    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDO71305.1|  hypothetical protein CISIN_1g014734mg                 63.9    3e-09   Citrus sinensis [apfelsine]
ref|XP_009801746.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  63.9    3e-09   Nicotiana sylvestris
ref|XP_009624357.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  63.9    3e-09   Nicotiana tomentosiformis
ref|XP_009386557.1|  PREDICTED: cell number regulator 13-like iso...  63.5    4e-09   
ref|XP_009386556.1|  PREDICTED: cell number regulator 13-like iso...  63.5    4e-09   
ref|XP_006297774.1|  hypothetical protein CARUB_v10013809mg           63.5    4e-09   Capsella rubella
ref|XP_006466999.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  63.5    4e-09   Citrus sinensis [apfelsine]
ref|XP_006425392.1|  hypothetical protein CICLE_v10025703mg           63.5    4e-09   
ref|XP_008440854.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  63.5    4e-09   
ref|XP_010029652.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  63.5    4e-09   Eucalyptus grandis [rose gum]
ref|XP_010029651.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  63.5    4e-09   Eucalyptus grandis [rose gum]
ref|XP_009386555.1|  PREDICTED: cell number regulator 13-like iso...  63.5    4e-09   
ref|NP_001031366.1|  protein MID1-complementing activity 2            63.5    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179369.2|  protein MID1-complementing activity 2               63.5    5e-09   Arabidopsis thaliana [mouse-ear cress]
pir||D84556  hypothetical protein At2g17780 [imported] - Arabidop...  63.5    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886128.1|  hypothetical protein ARALYDRAFT_480672           63.5    5e-09   
gb|KCW56602.1|  hypothetical protein EUGRSUZ_I02323                   63.5    5e-09   Eucalyptus grandis [rose gum]
ref|XP_009386559.1|  PREDICTED: cell number regulator 13-like iso...  63.2    5e-09   
ref|NP_001031368.1|  protein MID1-complementing activity 2            62.4    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135021.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  63.2    6e-09   Cucumis sativus [cucumbers]
emb|CDP01861.1|  unnamed protein product                              63.2    6e-09   Coffea canephora [robusta coffee]
ref|NP_001031367.1|  protein MID1-complementing activity 2            62.8    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266008.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.8    7e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010531102.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.8    8e-09   
ref|XP_006343349.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.8    8e-09   Solanum tuberosum [potatoes]
ref|XP_008440857.1|  PREDICTED: cell number regulator 13 isoform X2   62.0    1e-08   Cucumis melo [Oriental melon]
emb|CDY30346.1|  BnaA09g09310D                                        62.4    1e-08   Brassica napus [oilseed rape]
ref|XP_010467574.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010467573.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011099884.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    1e-08   
ref|XP_008809428.1|  PREDICTED: cell number regulator 13-like iso...  62.4    1e-08   
ref|XP_011043148.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    1e-08   Populus euphratica
ref|XP_006383064.1|  hypothetical protein POPTR_0005s11200g           62.4    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010413502.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009138395.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    1e-08   Brassica rapa
emb|CDY26830.1|  BnaC09g09570D                                        61.6    2e-08   Brassica napus [oilseed rape]
ref|XP_009112455.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  61.6    2e-08   Brassica rapa
ref|XP_009112457.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  61.2    2e-08   
ref|XP_009112456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  61.6    2e-08   Brassica rapa
gb|KGN48940.1|  hypothetical protein Csa_6G507150                     61.2    2e-08   
ref|XP_008809427.1|  PREDICTED: cell number regulator 13-like iso...  61.6    2e-08   
ref|XP_008809426.1|  PREDICTED: cell number regulator 13-like iso...  61.6    2e-08   
ref|XP_009418750.1|  PREDICTED: cell number regulator 13-like         61.6    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009379353.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  61.2    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_011074700.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  61.2    3e-08   Sesamum indicum [beniseed]
ref|XP_008393931.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  61.2    3e-08   
gb|EMT07324.1|  hypothetical protein F775_31025                       60.8    3e-08   
ref|XP_006409246.1|  hypothetical protein EUTSA_v10023167mg           60.8    3e-08   
gb|KHN36012.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                 60.8    4e-08   Glycine soja [wild soybean]
gb|EYU36803.1|  hypothetical protein MIMGU_mgv1a011010mg              59.3    6e-08   Erythranthe guttata [common monkey flower]
emb|CDX72565.1|  BnaC07g45870D                                        60.1    7e-08   
emb|CDY47043.1|  BnaAnng08310D                                        60.1    7e-08   Brassica napus [oilseed rape]
ref|XP_006412042.1|  hypothetical protein EUTSA_v10025310mg           60.1    7e-08   Eutrema salsugineum [saltwater cress]
ref|XP_009148721.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  60.1    7e-08   Brassica rapa
emb|CDX75539.1|  BnaA01g01630D                                        60.1    7e-08   
emb|CDX69186.1|  BnaC01g02670D                                        60.1    7e-08   
ref|XP_010446852.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  60.1    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010432209.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  60.1    7e-08   Camelina sativa [gold-of-pleasure]
dbj|BAH20129.1|  AT4G35920                                            60.1    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195317.2|  protein MID1-complementing activity 1               60.1    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282626.1|  hypothetical protein CARUB_v10004901mg           60.1    7e-08   Capsella rubella
ref|XP_002867046.1|  hypothetical protein ARALYDRAFT_491044           60.1    7e-08   
gb|AAK32909.1|AF367322_1  AT4g35920/F4B14_190                         60.1    7e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18486.1|  putative protein                                     60.1    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489416.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  59.3    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010489415.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  59.7    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010489410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  59.7    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010526810.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  59.7    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_006846924.1|  hypothetical protein AMTR_s00152p00084120        59.7    1e-07   Amborella trichopoda
ref|XP_011083456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  59.3    1e-07   Sesamum indicum [beniseed]
ref|XP_010113309.1|  hypothetical protein L484_026640                 58.5    2e-07   
ref|XP_008806599.1|  PREDICTED: cell number regulator 13-like iso...  58.5    2e-07   
ref|XP_008806598.1|  PREDICTED: cell number regulator 13-like iso...  58.5    2e-07   
gb|ABR16594.1|  unknown                                               58.5    2e-07   Picea sitchensis
ref|XP_006649427.1|  PREDICTED: cell number regulator 13-like         58.2    3e-07   Oryza brachyantha
gb|EYU17580.1|  hypothetical protein MIMGU_mgv1a007522mg              57.8    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_010266845.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  57.4    5e-07   Nelumbo nucifera [Indian lotus]
ref|XP_003558777.1|  PREDICTED: cell number regulator 13              56.6    9e-07   Brachypodium distachyon [annual false brome]
gb|KJB43289.1|  hypothetical protein B456_007G192000                  56.2    1e-06   Gossypium raimondii
gb|KHG10652.1|  mid1-complementing activity 1 -like protein           55.8    1e-06   Gossypium arboreum [tree cotton]
gb|EPS70744.1|  mid1-complementing activity 2                         55.8    2e-06   Genlisea aurea
gb|EYU30814.1|  hypothetical protein MIMGU_mgv1a007258mg              55.1    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_001767697.1|  predicted protein                                51.6    6e-06   
ref|XP_010680412.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  52.8    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  52.8    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007046628.1|  PLAC8 family protein                             52.8    2e-05   
ref|XP_001768983.1|  predicted protein                                51.2    5e-05   
gb|EEE57693.1|  hypothetical protein OsJ_08164                        50.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95227.1|  retrotransposon protein, putative, unclassified       50.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001785848.1|  predicted protein                                49.7    2e-04   
ref|XP_009389171.1|  PREDICTED: protein kinase 2A, chloroplastic-...  49.7    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001068428.2|  Os11g0670100                                     48.1    3e-04   
ref|XP_009389172.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  48.1    6e-04   
gb|EEC80653.1|  hypothetical protein OsI_23047                        47.4    8e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010692506.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  47.8    0.001   



>ref|XP_003612221.1| hypothetical protein MTR_5g022670 [Medicago truncatula]
 gb|AES95179.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=416

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW ++GD AN+AQLTG+DA+KLIGMIVKAASTA+MHK
Sbjct  1    MASWDHMGDFANIAQLTGVDAVKLIGMIVKAASTARMHK  39



>gb|AFK40961.1| unknown [Lotus japonicus]
Length=386

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW ++GD AN+AQLTG+DA+KLIGMIVKAASTA+MHK
Sbjct  1    MASWDHMGDFANIAQLTGVDAVKLIGMIVKAASTARMHK  39



>ref|XP_004287784.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Fragaria vesca 
subsp. vesca]
Length=415

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + GD+ANVAQLTG+DA+KLIGMIVKAA+TA+MHK
Sbjct  1    MASWDHFGDIANVAQLTGLDAVKLIGMIVKAAATARMHK  39



>ref|NP_001242304.1| uncharacterized protein LOC100811369 [Glycine max]
 gb|ACU17641.1| unknown [Glycine max]
Length=372

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  +G+LANVAQLTG+DA++LIGMIV+AASTA+MHK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHK  39



>ref|XP_006572883.1| PREDICTED: uncharacterized protein LOC100811369 isoform X1 [Glycine 
max]
Length=415

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  +G+LANVAQLTG+DA++LIGMIV+AASTA+MHK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHK  39



>ref|XP_007157885.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157886.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157887.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157888.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29879.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29880.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29881.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29882.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
Length=416

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  +G+LANVAQLTG+DA++LIGMIV+AASTA+MHK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHK  39



>ref|XP_004512157.1| PREDICTED: cell number regulator 13-like isoform X1 [Cicer arietinum]
 ref|XP_004512158.1| PREDICTED: cell number regulator 13-like isoform X2 [Cicer arietinum]
 ref|XP_004512159.1| PREDICTED: cell number regulator 13-like isoform X3 [Cicer arietinum]
 ref|XP_004512160.1| PREDICTED: cell number regulator 13-like isoform X4 [Cicer arietinum]
 ref|XP_004512161.1| PREDICTED: cell number regulator 13-like isoform X5 [Cicer arietinum]
Length=417

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW N+GD ANVAQLTG+DA+KLI MI KAA+TA+MHK
Sbjct  1    MASWENMGDFANVAQLTGVDAVKLIAMIAKAATTARMHK  39



>emb|CAN71842.1| hypothetical protein VITISV_036262 [Vitis vinifera]
Length=425

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  286  GVKMASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            G+KMA+W + G++ANVAQLTG+DA++LIGMIV AA+TA+MHK
Sbjct  95   GLKMATWEHFGEIANVAQLTGVDAVRLIGMIVSAANTARMHK  136



>ref|XP_004512162.1| PREDICTED: cell number regulator 13-like isoform X6 [Cicer arietinum]
Length=387

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW N+GD ANVAQLTG+DA+KLI MI KAA+TA+MHK
Sbjct  1    MASWENMGDFANVAQLTGVDAVKLIAMIAKAATTARMHK  39



>tpg|DAA43437.1| TPA: putative cell number regulator 13 [Zea mays]
Length=163

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHK  39



>ref|XP_009803786.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009803787.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + G++ANVAQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHK  39



>ref|XP_009611045.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009611046.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
Length=419

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + G++ANVAQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHK  39



>dbj|BAK32933.1| mid1-complementing activity 2 [Nicotiana tabacum]
Length=419

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + G++ANVAQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHK  39



>ref|XP_004985646.1| PREDICTED: cell number regulator 13-like [Setaria italica]
Length=418

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLG+L+N+AQLTG+DA+KLI +IVKAASTA+MHK
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVKAASTARMHK  39



>ref|XP_009363461.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Pyrus x bretschneideri]
Length=415

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW +LG++ANVAQLTG+DA++LIG+IVKAA+TA+MHK
Sbjct  1    MASWDHLGEIANVAQLTGLDAVRLIGLIVKAANTARMHK  39



>ref|XP_008665504.1| PREDICTED: cell number regulator 13-like [Zea mays]
 ref|XP_008665505.1| PREDICTED: cell number regulator 13-like [Zea mays]
Length=224

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHK  39



>ref|XP_008352422.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
 ref|XP_008352423.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
Length=415

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG++ANVAQLTG+DA++LIG+IVKAA+TA+MHK
Sbjct  1    MASWDQLGEIANVAQLTGLDAVRLIGLIVKAANTARMHK  39



>ref|XP_010933353.1| PREDICTED: cell number regulator 13-like isoform X2 [Elaeis guineensis]
Length=402

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  LG++ANVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SSWDQLGEIANVAQLTGLDAVRLIGMIVKAASTARMHK  40



>ref|XP_010933352.1| PREDICTED: cell number regulator 13-like isoform X1 [Elaeis guineensis]
Length=421

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  LG++ANVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SSWDQLGEIANVAQLTGLDAVRLIGMIVKAASTARMHK  40



>gb|KDP23985.1| hypothetical protein JCGZ_25373 [Jatropha curcas]
Length=415

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLG+LA VAQLTG+DA++LI MI KAA+TA+MHK
Sbjct  1    MASWDNLGELATVAQLTGVDAVRLIAMIAKAATTARMHK  39



>ref|XP_002468480.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
 gb|EER95478.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
Length=420

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHK  39



>ref|XP_008448524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Cucumis melo]
Length=418

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M+SW  LG++ANVAQLTGIDA++LI MIVK+ASTA+MHK
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMHK  39



>ref|XP_004146155.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 gb|KGN55644.1| hypothetical protein Csa_3G002640 [Cucumis sativus]
Length=418

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M+SW  LG++ANVAQLTGIDA++LI MIVK+ASTA+MHK
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMHK  39



>gb|ACN26521.1| unknown [Zea mays]
 tpg|DAA43436.1| TPA: putative cell number regulator 13 [Zea mays]
Length=428

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHK  39



>ref|NP_001182136.1| cell number regulator 13 [Zea mays]
 sp|B6SJQ0.1|CNR13_MAIZE RecName: Full=Cell number regulator 13; AltName: Full=ZmCNR13 
[Zea mays]
 gb|ACG25083.1| domain of unknown function DUF614 containing protein [Zea mays]
 gb|ADI48426.1| cell number regulator 13 [Zea mays]
Length=428

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHK  39



>ref|XP_008242042.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Prunus 
mume]
Length=385

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW + G++ANVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHK  40



>ref|NP_001049013.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|ABF94063.1| Protein of unknown function, DUF614 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10927.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|EEC74547.1| hypothetical protein OsI_10083 [Oryza sativa Indica Group]
 dbj|BAJ40168.1| mid1-complementing activity 1 [Oryza sativa Japonica Group]
Length=418

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLGD+A V QLTG+DA++LI MIVKAASTA++HK
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHK  39



>gb|EEE65313.1| hypothetical protein OsJ_20556 [Oryza sativa Japonica Group]
Length=458

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLGD+A V QLTG+DA++LI MIVKAASTA++HK
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHK  39



>ref|XP_002531154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31239.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M+SW + G++ANVAQLTG+DA++LIGMI KAASTA+MHK
Sbjct  1    MSSWDHFGEIANVAQLTGLDAVRLIGMIGKAASTARMHK  39



>ref|XP_006574667.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X6 [Glycine max]
 ref|XP_006574668.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X7 [Glycine max]
Length=378

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHK
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHK  41



>ref|XP_007156188.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 ref|XP_007156189.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28182.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28183.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
Length=415

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA++LIGMIVKAASTA+MHK
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAASTARMHK  40



>ref|XP_008807147.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
 ref|XP_008807148.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
Length=421

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  LG+++NVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SSWDQLGEISNVAQLTGLDAVRLIGMIVKAASTARMHK  40



>ref|XP_008242040.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
 ref|XP_008242041.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
Length=416

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW + G++ANVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHK  40



>ref|XP_007202160.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
 gb|EMJ03359.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
Length=416

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW + G++ANVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHK  40



>ref|XP_003519857.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
 gb|KHN00454.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=416

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHK
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHK  41



>ref|XP_006574663.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006574664.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006574665.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
 ref|XP_006574666.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=418

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHK
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHK  41



>gb|AAM51833.1|AC105730_7 Unknown protein [Oryza sativa Japonica Group]
Length=1202

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW NLGD+A V QLTG+DA++LI MIVKAASTA++HK
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHK  39



>ref|XP_002272810.2| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Vitis vinifera]
Length=420

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++ANVAQLTG+DA++LIGMIV AA+TA+MHK
Sbjct  1    MATWEHFGEIANVAQLTGVDAVRLIGMIVSAANTARMHK  39



>ref|XP_004232512.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
 ref|XP_010316435.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
Length=418

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MAS  + GD+AN+AQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  1    MASLDHFGDIANIAQLTGIDAVRLIGMIVKAAATARMHK  39



>ref|XP_003629262.1| Cornifelin [Medicago truncatula]
 gb|AET03738.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=424

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTG+DA+KLIGMIVKAA+TA+MHK
Sbjct  3    SSWEQFGEIANVAQLTGLDAVKLIGMIVKAANTARMHK  40



>ref|XP_006599316.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=335

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHK  40



>ref|XP_010920111.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010920112.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=414

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  +G+++NVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SSWDQMGEISNVAQLTGLDAVRLIGMIVKAASTARMHK  40



>gb|KJB17609.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=378

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + G++ANVAQL G DA++LI MIVKAASTA+MHK
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHK  39



>ref|XP_006340771.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006340772.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
Length=418

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MAS  + GD+AN+AQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  1    MASLDHFGDVANIAQLTGIDAVRLIGMIVKAAATARMHK  39



>ref|XP_009408218.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHR  39



>ref|XP_004159726.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Cucumis sativus]
Length=418

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMH  408
            M+SW  LG++ANVAQLTGIDA++LI MIVK+ASTA+MH
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMH  38



>ref|XP_009408217.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=410

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHR  39



>ref|XP_009408216.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHR  39



>gb|KDO71309.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=409

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++ANVAQL G DA++LIGMIVKAA+TA+MHK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGMIVKAATTARMHK  39



>ref|XP_004509394.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004509396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Cicer arietinum]
Length=424

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW + G++ANVAQLTG+DA++LIGMIVKAA+TA+MHK
Sbjct  3    SSWEHFGEIANVAQLTGLDAVRLIGMIVKAANTARMHK  40



>gb|KHN35538.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=415

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHK  40



>ref|XP_003548830.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=415

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHK  40



>gb|KJB17606.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17607.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17608.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=418

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + G++ANVAQL G DA++LI MIVKAASTA+MHK
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHK  39



>gb|KHG25004.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=418

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + G++ANVAQL G DA++LI MIVKAASTA+MHK
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHK  39



>ref|XP_006599313.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006599314.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006599315.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
Length=432

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW   G++ANVAQLTGIDA++LIGMIVKAA+TA+MHK
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHK  40



>ref|XP_010935125.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010935126.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=420

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG+L+ VAQLTG+DA++LIG+IV+AA+TA+MHK
Sbjct  1    MASWDQLGELSTVAQLTGLDAVRLIGLIVRAATTARMHK  39



>pir||T08859 hypothetical protein A_TM017A05.4 - Arabidopsis thaliana
Length=276

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHK  40



>gb|KDO71305.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71306.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71307.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71308.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=419

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++ANVAQL G DA++LIGMIVKAA+TA+MHK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGMIVKAATTARMHK  39



>ref|XP_009801746.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009801747.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++AN AQL G+DA++LIGMIVKAASTA+MHK
Sbjct  1    MATWEHFGEVANFAQLAGLDAVRLIGMIVKAASTARMHK  39



>ref|XP_009624357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009624358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 dbj|BAK32932.1| mid1-complementing activity 1 [Nicotiana tabacum]
Length=419

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++AN AQL G+DA++LIGMIVKAASTA+MHK
Sbjct  1    MATWEHFGEVANFAQLAGLDAVRLIGMIVKAASTARMHK  39



>ref|XP_009386557.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  +GD+ANV QLTG+DA++LIGMIVKAAS A+MHK
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHK  40



>ref|XP_009386556.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  +GD+ANV QLTG+DA++LIGMIVKAAS A+MHK
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHK  40



>ref|XP_006297774.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
 gb|EOA30672.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
Length=417

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LGD A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  4    SWEQLGDFASVAQLTGVDAVKLIGMIVSAANTARMHK  40



>ref|XP_006466999.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467000.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Citrus sinensis]
Length=419

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++ANVAQL G DA++LIG+IVKAASTA+MHK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGLIVKAASTARMHK  39



>ref|XP_006425392.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425393.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425394.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425395.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425396.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38632.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38633.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38634.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38635.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38636.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
Length=419

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++ANVAQL G DA++LIG+IVKAASTA+MHK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGLIVKAASTARMHK  39



>ref|XP_008440854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440855.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
Length=415

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M+SW +LGD+A+VAQLTGI+A++LI MIVKAA+TA+MHK
Sbjct  1    MSSWDSLGDVASVAQLTGINAVQLISMIVKAANTARMHK  39



>ref|XP_010029652.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Eucalyptus grandis]
Length=417

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W   G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHK  39



>ref|XP_010029651.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Eucalyptus grandis]
Length=418

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W   G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHK  39



>ref|XP_009386555.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=423

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  +GD+ANV QLTG+DA++LIGMIVKAAS A+MHK
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHK  40



>ref|NP_001031366.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06683.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=414

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHK  40



>ref|NP_179369.2| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 sp|Q3EBY6.1|MCAC2_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 2 [Arabidopsis 
thaliana]
 dbj|BAF46390.1| Mca2 [Arabidopsis thaliana]
 gb|AEC06682.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=416

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHK  40



>pir||D84556 hypothetical protein At2g17780 [imported] - Arabidopsis thaliana
Length=417

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHK  40



>ref|XP_002886128.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62387.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHK  40



>gb|KCW56602.1| hypothetical protein EUGRSUZ_I02323 [Eucalyptus grandis]
Length=472

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W   G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHK  39



>ref|XP_009386559.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386560.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW  +GD+ANV QLTG+DA++LIGMIVKAAS A+MHK
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHK  40



>ref|NP_001031368.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06685.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=314

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHK  40



>ref|XP_004135021.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 ref|XP_004158901.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
Length=416

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M+SW +LGD+A VAQLTGI+A++LI MIVKAA+TA+MHK
Sbjct  1    MSSWDSLGDVAGVAQLTGINAVQLISMIVKAANTARMHK  39



>emb|CDP01861.1| unnamed protein product [Coffea canephora]
Length=419

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M++W + G++ANVAQLTG+DA++LIGMIV+AA+TA++HK
Sbjct  1    MSTWEHFGEIANVAQLTGVDAVRLIGMIVQAANTARLHK  39



>ref|NP_001031367.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06684.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=410

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHK  40



>ref|XP_010266008.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266009.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266010.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=420

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            ++W +LG++ NVAQLTG+DA++LIGMIV+AASTA+MHK
Sbjct  3    SAWDHLGEIGNVAQLTGLDAVRLIGMIVQAASTARMHK  40



>ref|XP_010531102.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531103.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531104.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531105.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531106.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=416

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW +LGD+A+VAQLTG+DA++LIGMIV AA+TA+MHK
Sbjct  4    SWDHLGDIASVAQLTGLDAVRLIGMIVSAANTARMHK  40



>ref|XP_006343349.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343350.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006343351.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Solanum tuberosum]
Length=419

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W + G++AN AQL G+DA+KLIG+IVKAASTA+MHK
Sbjct  1    MATWEHFGEIANGAQLAGLDAVKLIGLIVKAASTARMHK  39



>ref|XP_008440857.1| PREDICTED: cell number regulator 13 isoform X2 [Cucumis melo]
Length=336

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M+SW +LGD+A+VAQLTGI+A++LI MIVKAA+TA+MHK
Sbjct  1    MSSWDSLGDVASVAQLTGINAVQLISMIVKAANTARMHK  39



>emb|CDY30346.1| BnaA09g09310D [Brassica napus]
Length=389

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGVDALKLIGMIVTAANTARMHK  40



>ref|XP_010467574.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=419

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  2    SWEQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHK  38



>ref|XP_010467573.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=420

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  2    SWEQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHK  38



>ref|XP_011099884.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099885.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099886.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099887.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
Length=416

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M++W + G++ANVAQL G+DA  LIGMIVKAA+TA+MHK
Sbjct  1    MSTWEHFGEIANVAQLAGVDAASLIGMIVKAANTARMHK  39



>ref|XP_008809428.1| PREDICTED: cell number regulator 13-like isoform X3 [Phoenix 
dactylifera]
Length=397

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +S+  LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHK
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHK  40



>ref|XP_011043148.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
 ref|XP_011043149.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
Length=419

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W +LG++ANV QLTGIDA++LI MI KAA+TA+MHK
Sbjct  1    MATWEHLGEVANVVQLTGIDAVRLIAMIGKAATTARMHK  39



>ref|XP_006383064.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
 gb|ERP60861.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
Length=419

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W +LG++ANV QLTGIDA++LI MI KAA+TA+MHK
Sbjct  1    MATWEHLGEVANVVQLTGIDAVRLIAMIGKAATTARMHK  39



>ref|XP_010413502.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413510.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413517.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
Length=419

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHK  38



>ref|XP_009138395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
 ref|XP_009138396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
Length=416

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA+MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTARMHK  40



>emb|CDY26830.1| BnaC09g09570D [Brassica napus]
Length=391

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVTAANTARMHK  40



>ref|XP_009112455.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Brassica rapa]
Length=389

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHK  40



>ref|XP_009112457.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Brassica rapa]
Length=376

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHK  40



>ref|XP_009112456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Brassica rapa]
Length=388

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHK  40



>gb|KGN48940.1| hypothetical protein Csa_6G507150 [Cucumis sativus]
Length=336

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M+SW +LGD+A VAQLTGI+A++LI MIVKAA+TA+MHK
Sbjct  1    MSSWDSLGDVAGVAQLTGINAVQLISMIVKAANTARMHK  39



>ref|XP_008809427.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=420

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +S+  LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHK
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHK  40



>ref|XP_008809426.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=421

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +S+  LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHK
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHK  40



>ref|XP_009418750.1| PREDICTED: cell number regulator 13-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG+L+ VAQLTG+DA +LIG+IV+AA+TA+MH+
Sbjct  1    MASWEQLGELSTVAQLTGLDAGRLIGLIVQAATTARMHR  39



>ref|XP_009379353.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379354.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379355.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379356.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379359.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
Length=412

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 3/39 (8%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MAS+   G+LANVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  1    MASF---GELANVAQLTGVDAVRLIGMIVKAASTARMHK  36



>ref|XP_011074700.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=403

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA+W   G++ANV QLTG++A+ LIG+IVKAASTA+MHK
Sbjct  1    MAAWEQFGEIANVVQLTGLNAVSLIGLIVKAASTARMHK  39



>ref|XP_008393931.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393938.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393943.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393951.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393959.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
Length=408

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  310  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            + G++ANVAQLTG+DA++LIGMIVKAASTA+MHK
Sbjct  3    SFGEMANVAQLTGVDAVRLIGMIVKAASTARMHK  36



>gb|EMT07324.1| hypothetical protein F775_31025 [Aegilops tauschii]
Length=395

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +1

Query  310  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            N+GDLAN+AQLTG+DA++LIG+IVKAA+TA+MHK
Sbjct  3    NVGDLANIAQLTGLDAVRLIGLIVKAAATARMHK  36



>ref|XP_006409246.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
 gb|ESQ50699.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
Length=373

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA++LIGMIV AA+TA+MHK
Sbjct  4    SWDQLGEIASVAQLTGVDAVRLIGMIVTAANTARMHK  40



>gb|KHN36012.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=409

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  313  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +G+LANVAQLTG+DA++LIGMIV+AASTA+MHK
Sbjct  1    MGELANVAQLTGVDAVRLIGMIVRAASTARMHK  33



>gb|EYU36803.1| hypothetical protein MIMGU_mgv1a011010mg [Erythranthe guttata]
Length=295

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M SW   G++ANV QL+G++A+ LIG+IVKAASTA+MHK
Sbjct  1    MGSWEQFGEIANVVQLSGLNAISLIGLIVKAASTARMHK  39



>emb|CDX72565.1| BnaC07g45870D [Brassica napus]
Length=414

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>emb|CDY47043.1| BnaAnng08310D [Brassica napus]
Length=416

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|XP_006412042.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412043.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412044.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412045.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53495.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53496.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53497.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53498.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
Length=418

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|XP_009148721.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
 ref|XP_009148775.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
Length=419

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>emb|CDX75539.1| BnaA01g01630D [Brassica napus]
Length=419

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>emb|CDX69186.1| BnaC01g02670D [Brassica napus]
Length=420

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|XP_010446852.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446853.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|XP_010432209.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010432210.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437400.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437401.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>dbj|BAH20129.1| AT4G35920 [Arabidopsis thaliana]
Length=421

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|NP_195317.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849503.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849504.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 sp|Q8L7E9.1|MCAC1_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 1 [Arabidopsis 
thaliana]
 gb|AAM96959.1| putative protein [Arabidopsis thaliana]
 gb|AAO30093.1| putative protein [Arabidopsis thaliana]
 dbj|BAF46389.1| Mca1 [Arabidopsis thaliana]
 dbj|BAH19557.1| AT4G35920 [Arabidopsis thaliana]
 gb|AEE86589.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86590.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86591.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
Length=421

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|XP_006282626.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 ref|XP_006282627.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15524.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15525.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
Length=421

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|XP_002867046.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43305.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>gb|AAK32909.1|AF367322_1 AT4g35920/F4B14_190 [Arabidopsis thaliana]
 gb|AAM91434.1| AT4g35920/F4B14_190 [Arabidopsis thaliana]
Length=440

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>emb|CAA18486.1| putative protein [Arabidopsis thaliana]
 emb|CAA21478.1| putative protein [Arabidopsis thaliana]
 emb|CAB81501.1| putative protein [Arabidopsis thaliana]
Length=447

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHK
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHK  40



>ref|XP_010489416.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Camelina sativa]
Length=315

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HK
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHK  38



>ref|XP_010489415.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=420

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HK
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHK  38



>ref|XP_010489410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489413.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489414.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=421

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW  LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HK
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHK  38



>ref|XP_010526810.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010526811.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=409

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  301  SWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            SW +LG++++VAQLTG+DA++LIGMIV AA+TA+MHK
Sbjct  4    SWDHLGEISSVAQLTGLDAVRLIGMIVSAANTARMHK  40



>ref|XP_006846924.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
 gb|ERN08505.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
Length=421

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            A+W  LG++A VAQLTG+DA+KLI MI +AA+TA+MHK
Sbjct  3    ATWDQLGEIATVAQLTGLDAVKLIAMIARAATTARMHK  40



>ref|XP_011083456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=405

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW + G++ANV QLTG++A+ LIG+IVKAA+TA+MH+
Sbjct  1    MASWEHFGEVANVIQLTGLNAVALIGLIVKAANTARMHR  39



>ref|XP_010113309.1| hypothetical protein L484_026640 [Morus notabilis]
 gb|EXC35316.1| hypothetical protein L484_026640 [Morus notabilis]
Length=397

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +1

Query  295  MAS-WXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MAS W + G++AN+AQL G+DA++LI +IVKAASTA+MHK
Sbjct  1    MASQWEHFGEIANIAQLAGLDAIRLIALIVKAASTARMHK  40



>ref|XP_008806599.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=418

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG+L+ V QLTG+DA++LIG+IV+  +TA+MHK
Sbjct  1    MASWDQLGELSTVVQLTGLDAVRLIGLIVQTTATARMHK  39



>ref|XP_008806598.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=420

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW  LG+L+ V QLTG+DA++LIG+IV+  +TA+MHK
Sbjct  1    MASWDQLGELSTVVQLTGLDAVRLIGLIVQTTATARMHK  39



>gb|ABR16594.1| unknown [Picea sitchensis]
Length=418

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  304  WXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            W N+GDLANV QLTG++A+ LI +IVKAAS A+MHK
Sbjct  7    WENVGDLANVTQLTGLNAVSLIALIVKAASNARMHK  42



>ref|XP_006649427.1| PREDICTED: cell number regulator 13-like [Oryza brachyantha]
Length=419

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVK--AASTAKMHK  411
            MASW NLG++A V QLTG+DA +LI MIVK  AASTA++HK
Sbjct  1    MASWENLGEVATVVQLTGLDAGRLISMIVKAAAASTARLHK  41



>gb|EYU17580.1| hypothetical protein MIMGU_mgv1a007522mg [Erythranthe guttata]
Length=404

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW   G++AN+ QL+G++A  LIG+IVKAA+TA+MHK
Sbjct  1    MASWEQFGEIANIVQLSGLNAAALIGLIVKAANTARMHK  39



>ref|XP_010266845.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=409

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            ++W ++G++ NVAQL G+DA++LIGMIV AASTA+MHK
Sbjct  3    SAWDHIGEIGNVAQLAGMDAVRLIGMIVHAASTARMHK  40



>ref|XP_003558777.1| PREDICTED: cell number regulator 13 [Brachypodium distachyon]
Length=412

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +1

Query  310  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +LGD+ANVAQ+TG+DA+++I +IVKAASTA+MHK
Sbjct  3    SLGDVANVAQVTGLDAVRIIALIVKAASTARMHK  36



>gb|KJB43289.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43290.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43291.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
Length=416

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +1

Query  295  MAS-WXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MAS W + G++ANVAQL G DA++LI MI KAASTA+MHK
Sbjct  1    MASVWEHFGEVANVAQLAGFDAVRLIAMIGKAASTARMHK  40



>gb|KHG10652.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=332

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +1

Query  295  MAS-WXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MAS W + G++ANVAQL G DA++LI MI KAASTA+MHK
Sbjct  1    MASAWEHFGEVANVAQLAGFDAVRLIAMIGKAASTARMHK  40



>gb|EPS70744.1| mid1-complementing activity 2 [Genlisea aurea]
Length=376

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MASW   G+ ANV QL G++A+ LIG+IVKAA+TA+MHK
Sbjct  1    MASWDQFGEAANVIQLAGLNAVALIGLIVKAANTARMHK  39



>gb|EYU30814.1| hypothetical protein MIMGU_mgv1a007258mg [Erythranthe guttata]
Length=413

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  310  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            + G++ANVAQL G+DA  LIGMIVKAA+TA+MHK
Sbjct  3    HFGEMANVAQLAGMDAASLIGMIVKAATTARMHK  36



>ref|XP_001767697.1| predicted protein [Physcomitrella patens]
 gb|EDQ67448.1| predicted protein, partial [Physcomitrella patens]
Length=110

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  313  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            LGD+ANV QLTGI+A++LI MIV+AA+ A+MHK
Sbjct  1    LGDVANVGQLTGINAVQLISMIVQAANNARMHK  33



>ref|XP_010680412.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  310  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            ++ D+A +AQLTG+DA+KLIG+IVKAA+TA+MH+
Sbjct  3    HMEDVATIAQLTGLDAVKLIGLIVKAANTARMHR  36



>ref|XP_010680410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=410

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  310  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            ++ D+A +AQLTG+DA+KLIG+IVKAA+TA+MH+
Sbjct  3    HMEDVATIAQLTGLDAVKLIGLIVKAANTARMHR  36



>ref|XP_007046628.1| PLAC8 family protein [Theobroma cacao]
 gb|EOX90785.1| PLAC8 family protein [Theobroma cacao]
Length=421

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +SW ++G++A+V QL G DA +LI MI KAA+TA+MHK
Sbjct  3    SSWEHIGEVASVVQLAGFDAGRLIAMIAKAANTARMHK  40



>ref|XP_001768983.1| predicted protein [Physcomitrella patens]
 gb|EDQ66181.1| predicted protein [Physcomitrella patens]
Length=415

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  304  WXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            W  LGD+A+  QL GI+A++LI MIVKAA+ A+MHK
Sbjct  3    WLALGDVASFGQLAGINAVQLIAMIVKAANNARMHK  38



>gb|EEE57693.1| hypothetical protein OsJ_08164 [Oryza sativa Japonica Group]
Length=1467

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK ++
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNR  39



>gb|ABA95227.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2776

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK ++
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNR  39



>ref|XP_001785848.1| predicted protein [Physcomitrella patens]
 gb|EDQ49335.1| predicted protein, partial [Physcomitrella patens]
Length=399

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  313  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            +GD+ANV QL GI+A++LI MIVKAA  A+MHK
Sbjct  1    MGDVANVGQLVGINAVQLIAMIVKAAKNARMHK  33



>ref|XP_009389171.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=597

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            ++W  +GD+A+V QL G+DA+ LI MI+K AS A+MH+
Sbjct  3    STWGPVGDVASVMQLVGVDAVSLIRMIIKVASDARMHR  40



>ref|NP_001068428.2| Os11g0670100 [Oryza sativa Japonica Group]
 dbj|BAF28791.2| Os11g0670100 [Oryza sativa Japonica Group]
Length=205

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK ++
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNR  39



>ref|XP_009389172.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=366

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  ASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            ++W  +GD+A+V QL G+DA+ LI MI+K AS A+MH+
Sbjct  3    STWGPVGDVASVMQLVGVDAVSLIRMIIKVASDARMHR  40



>gb|EEC80653.1| hypothetical protein OsI_23047 [Oryza sativa Indica Group]
Length=279

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK ++
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNQ  39



>ref|XP_010692506.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692507.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692508.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
Length=406

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  295  MASWXNLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHK  411
            M++W  L ++ N+AQLTG++A+ LIG+IV  A+ A++HK
Sbjct  1    MSNWDTLNEVGNLAQLTGVNAVGLIGLIVDTANRARLHK  39



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564491502050