BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016G12

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008228221.1|  PREDICTED: probable GPI-anchored adhesin-lik...    128   8e-31   
ref|XP_008228216.1|  PREDICTED: probable secreted beta-glucosidas...    128   1e-30   
ref|XP_008228217.1|  PREDICTED: probable secreted beta-glucosidas...    128   1e-30   Prunus mume [ume]
ref|XP_008228219.1|  PREDICTED: probable secreted beta-glucosidas...    123   3e-29   
ref|XP_008228218.1|  PREDICTED: probable GPI-anchored adhesin-lik...    122   1e-28   
ref|XP_008228220.1|  PREDICTED: probable secreted beta-glucosidas...    122   1e-28   Prunus mume [ume]
ref|XP_010261965.1|  PREDICTED: uncharacterized protein LOC104600...    121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010273948.1|  PREDICTED: uncharacterized protein LOC104609...    119   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010273947.1|  PREDICTED: uncharacterized protein LOC104609...    119   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010654471.1|  PREDICTED: uncharacterized protein LOC100248...    119   1e-27   Vitis vinifera
ref|XP_010654468.1|  PREDICTED: uncharacterized protein LOC100248...    119   2e-27   Vitis vinifera
ref|XP_009757816.1|  PREDICTED: uncharacterized protein LOC104210...    119   2e-27   Nicotiana sylvestris
ref|XP_009757817.1|  PREDICTED: uncharacterized protein LOC104210...    119   2e-27   Nicotiana sylvestris
ref|XP_009599552.1|  PREDICTED: uncharacterized protein LOC104095...    118   2e-27   Nicotiana tomentosiformis
ref|XP_010654470.1|  PREDICTED: uncharacterized protein LOC100248...    118   2e-27   Vitis vinifera
ref|XP_009599553.1|  PREDICTED: uncharacterized protein LOC104095...    118   2e-27   Nicotiana tomentosiformis
ref|XP_006361345.1|  PREDICTED: dentin sialophosphoprotein-like i...    118   2e-27   Solanum tuberosum [potatoes]
ref|XP_006361346.1|  PREDICTED: dentin sialophosphoprotein-like i...    118   3e-27   Solanum tuberosum [potatoes]
ref|XP_010261966.1|  PREDICTED: uncharacterized protein LOC104600...    117   7e-27   Nelumbo nucifera [Indian lotus]
ref|XP_006361347.1|  PREDICTED: dentin sialophosphoprotein-like i...    117   8e-27   Solanum tuberosum [potatoes]
ref|XP_010062690.1|  PREDICTED: uncharacterized protein LOC104450...    117   8e-27   Eucalyptus grandis [rose gum]
ref|XP_010062689.1|  PREDICTED: uncharacterized protein LOC104450...    117   8e-27   Eucalyptus grandis [rose gum]
ref|XP_009757818.1|  PREDICTED: uncharacterized protein LOC104210...    116   9e-27   Nicotiana sylvestris
emb|CBI35892.3|  unnamed protein product                                116   9e-27   Vitis vinifera
ref|XP_009599554.1|  PREDICTED: uncharacterized protein LOC104095...    116   1e-26   Nicotiana tomentosiformis
ref|XP_006426627.1|  hypothetical protein CICLE_v10024871mg             114   6e-26   Citrus clementina [clementine]
ref|XP_006465941.1|  PREDICTED: dentin sialophosphoprotein-like         114   6e-26   Citrus sinensis [apfelsine]
ref|XP_006426626.1|  hypothetical protein CICLE_v10024871mg             114   6e-26   Citrus clementina [clementine]
ref|XP_010936968.1|  PREDICTED: uncharacterized protein LOC105056...    113   1e-25   Elaeis guineensis
ref|XP_010314322.1|  PREDICTED: uncharacterized protein LOC101258...    112   3e-25   Solanum lycopersicum
ref|XP_004252392.1|  PREDICTED: uncharacterized protein LOC101258...    112   3e-25   Solanum lycopersicum
gb|KDO65081.1|  hypothetical protein CISIN_1g040475mg                   112   5e-25   Citrus sinensis [apfelsine]
gb|EYU21338.1|  hypothetical protein MIMGU_mgv1a001286mg                111   5e-25   Erythranthe guttata [common monkey flower]
ref|XP_010936970.1|  PREDICTED: uncharacterized protein LOC105056...    110   1e-24   Elaeis guineensis
ref|XP_007024588.1|  Uncharacterized protein isoform 5                  110   1e-24   
ref|XP_007024585.1|  Uncharacterized protein isoform 2                  110   1e-24   
ref|XP_010314323.1|  PREDICTED: uncharacterized protein LOC101258...    110   2e-24   Solanum lycopersicum
ref|XP_006583149.1|  PREDICTED: dentin sialophosphoprotein-like i...    109   3e-24   Glycine max [soybeans]
ref|XP_003528451.1|  PREDICTED: dentin sialophosphoprotein-like i...    109   3e-24   Glycine max [soybeans]
ref|XP_006583148.1|  PREDICTED: dentin sialophosphoprotein-like i...    109   4e-24   Glycine max [soybeans]
ref|XP_010654469.1|  PREDICTED: uncharacterized protein LOC100248...    108   5e-24   Vitis vinifera
ref|XP_008797669.1|  PREDICTED: uncharacterized protein LOC103712...    108   6e-24   Phoenix dactylifera
ref|XP_007024587.1|  Uncharacterized protein isoform 4                  107   1e-23   
ref|XP_007024589.1|  Uncharacterized protein isoform 6                  107   1e-23   
gb|EPS69388.1|  hypothetical protein M569_05379                         101   2e-23   Genlisea aurea
ref|XP_007024584.1|  Uncharacterized protein isoform 1                  107   2e-23   
ref|XP_009339841.1|  PREDICTED: uncharacterized protein LOC103932...    107   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_009339824.1|  PREDICTED: uncharacterized protein LOC103932...    107   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_009372373.1|  PREDICTED: uncharacterized protein LOC103961...    106   3e-23   Pyrus x bretschneideri [bai li]
ref|XP_007135474.1|  hypothetical protein PHAVU_010G132600g             106   5e-23   Phaseolus vulgaris [French bean]
gb|KHG27656.1|  ATP-dependent zinc metalloprotease FtsH                 105   1e-22   Gossypium arboreum [tree cotton]
ref|XP_004141213.1|  PREDICTED: uncharacterized protein LOC101203238    104   1e-22   
ref|XP_008338694.1|  PREDICTED: dentin sialophosphoprotein-like i...    104   1e-22   
ref|XP_008338695.1|  PREDICTED: dentin sialophosphoprotein-like i...    104   1e-22   
ref|XP_008464007.1|  PREDICTED: uncharacterized protein LOC103501...    104   2e-22   Cucumis melo [Oriental melon]
ref|XP_008464006.1|  PREDICTED: uncharacterized protein LOC103501...    104   2e-22   
ref|XP_011467415.1|  PREDICTED: uncharacterized protein LOC101293...    104   2e-22   Fragaria vesca subsp. vesca
ref|XP_004303676.1|  PREDICTED: uncharacterized protein LOC101293...    104   2e-22   Fragaria vesca subsp. vesca
ref|XP_009372374.1|  PREDICTED: uncharacterized protein LOC103961...    104   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_004163891.1|  PREDICTED: uncharacterized protein LOC101226902    104   2e-22   
gb|KGN59790.1|  hypothetical protein Csa_3G846060                       104   2e-22   Cucumis sativus [cucumbers]
ref|XP_010087685.1|  hypothetical protein L484_013447                   104   2e-22   
ref|XP_010685333.1|  PREDICTED: uncharacterized protein LOC104899...    103   3e-22   
ref|XP_010685331.1|  PREDICTED: uncharacterized protein LOC104899...    103   3e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB70100.1|  hypothetical protein B456_011G058000                    103   4e-22   Gossypium raimondii
gb|KJB70099.1|  hypothetical protein B456_011G058000                    103   4e-22   Gossypium raimondii
gb|KJB70101.1|  hypothetical protein B456_011G058000                    103   4e-22   Gossypium raimondii
gb|KJB70102.1|  hypothetical protein B456_011G058000                    103   4e-22   Gossypium raimondii
ref|XP_006849609.1|  hypothetical protein AMTR_s00024p00205340        97.1    7e-22   
gb|KEH18456.1|  plant/MDC16-11 protein                                  103   7e-22   Medicago truncatula
ref|XP_009339833.1|  PREDICTED: uncharacterized protein LOC103932...    102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_010685332.1|  PREDICTED: uncharacterized protein LOC104899...    102   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008338696.1|  PREDICTED: dentin sialophosphoprotein-like i...    101   2e-21   
ref|XP_004510436.1|  PREDICTED: flocculation protein FLO11-like         100   4e-21   Cicer arietinum [garbanzo]
ref|XP_008391371.1|  PREDICTED: dentin sialophosphoprotein-like i...    100   5e-21   Malus domestica [apple tree]
ref|XP_008391372.1|  PREDICTED: chitinase-like protein PB1E7.04c ...    100   5e-21   Malus domestica [apple tree]
gb|KHN39644.1|  hypothetical protein glysoja_020722                   99.4    1e-20   Glycine soja [wild soybean]
ref|XP_006598817.1|  PREDICTED: putative uncharacterized protein ...  99.4    1e-20   Glycine max [soybeans]
ref|XP_009391448.1|  PREDICTED: uncharacterized protein LOC103977608  99.0    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011072651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.0    1e-20   
ref|XP_010917132.1|  PREDICTED: uncharacterized protein LOC105041...  99.0    1e-20   Elaeis guineensis
ref|XP_010917133.1|  PREDICTED: uncharacterized protein LOC105041...  98.2    3e-20   Elaeis guineensis
gb|KDP40717.1|  hypothetical protein JCGZ_24716                       97.8    4e-20   Jatropha curcas
ref|XP_010932459.1|  PREDICTED: RNA polymerase II degradation fac...  95.5    2e-19   Elaeis guineensis
ref|XP_006296970.1|  hypothetical protein CARUB_v10012965mg           93.2    1e-18   Capsella rubella
emb|CAN69468.1|  hypothetical protein VITISV_042555                   92.8    2e-18   Vitis vinifera
ref|XP_009117284.1|  PREDICTED: uncharacterized protein LOC103842...  92.4    2e-18   Brassica rapa
ref|XP_009117292.1|  PREDICTED: uncharacterized protein LOC103842...  92.4    2e-18   Brassica rapa
ref|XP_002521347.1|  conserved hypothetical protein                   92.4    3e-18   Ricinus communis
ref|XP_002445374.1|  hypothetical protein SORBIDRAFT_07g013800        84.3    6e-18   
ref|XP_010465276.1|  PREDICTED: uncharacterized protein LOC104745...  90.5    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010465278.1|  PREDICTED: uncharacterized protein LOC104745...  90.5    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010465277.1|  PREDICTED: uncharacterized protein LOC104745...  90.5    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010542407.1|  PREDICTED: uncharacterized protein LOC104815...  90.1    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_010542406.1|  PREDICTED: uncharacterized protein LOC104815...  90.1    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_010542405.1|  PREDICTED: uncharacterized protein LOC104815...  90.1    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_008784271.1|  PREDICTED: uncharacterized protein LOC103703...  90.1    1e-17   Phoenix dactylifera
emb|CDY33258.1|  BnaC01g37310D                                        89.7    2e-17   Brassica napus [oilseed rape]
emb|CDY39087.1|  BnaA01g29690D                                        89.7    2e-17   Brassica napus [oilseed rape]
ref|XP_009146426.1|  PREDICTED: uncharacterized protein LOC103870...  89.0    4e-17   Brassica rapa
ref|XP_009146423.1|  PREDICTED: uncharacterized protein LOC103870...  89.0    4e-17   Brassica rapa
ref|XP_009146425.1|  PREDICTED: uncharacterized protein LOC103870...  89.0    4e-17   Brassica rapa
ref|XP_009146424.1|  PREDICTED: uncharacterized protein LOC103870...  89.0    4e-17   Brassica rapa
dbj|BAB02329.1|  unnamed protein product                              89.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97535.1|  BnaA05g25440D                                        89.0    4e-17   
ref|NP_001078149.1|  kinase-related protein                           89.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188015.2|  kinase-related protein                              89.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AES98495.2|  MLP3.11 protein                                       88.6    5e-17   Medicago truncatula
ref|XP_003615537.1|  hypothetical protein MTR_5g069290                88.6    5e-17   
ref|XP_010487182.1|  PREDICTED: uncharacterized protein LOC104765...  88.6    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010487183.1|  PREDICTED: uncharacterized protein LOC104765...  88.6    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010534929.1|  PREDICTED: uncharacterized protein LOC104810...  88.6    6e-17   Tarenaya hassleriana [spider flower]
gb|EEE65290.1|  hypothetical protein OsJ_20522                        87.8    9e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80202.1|  hypothetical protein OsI_22088                        87.8    1e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001057094.1|  Os06g0206100                                     87.8    1e-16   
ref|XP_010227879.1|  PREDICTED: uncharacterized protein LOC100833...  87.8    1e-16   Brachypodium distachyon [annual false brome]
ref|XP_010227878.1|  PREDICTED: uncharacterized protein LOC100833...  87.8    1e-16   Brachypodium distachyon [annual false brome]
ref|XP_010088349.1|  hypothetical protein L484_004857                 87.4    1e-16   
ref|XP_009765586.1|  PREDICTED: mucin-5AC-like                        86.3    2e-16   Nicotiana sylvestris
ref|XP_003544279.1|  PREDICTED: cell wall protein AWA1-like           87.0    2e-16   Glycine max [soybeans]
emb|CDP14411.1|  unnamed protein product                              87.0    2e-16   Coffea canephora [robusta coffee]
ref|XP_009610071.1|  PREDICTED: uncharacterized protein LOC104103...  86.7    2e-16   
ref|XP_002885002.1|  hypothetical protein ARALYDRAFT_478805           86.7    2e-16   
ref|XP_009610070.1|  PREDICTED: uncharacterized protein LOC104103...  86.7    2e-16   Nicotiana tomentosiformis
ref|XP_009610068.1|  PREDICTED: uncharacterized protein LOC104103...  86.7    2e-16   Nicotiana tomentosiformis
ref|XP_009610069.1|  PREDICTED: uncharacterized protein LOC104103...  86.7    2e-16   Nicotiana tomentosiformis
ref|XP_002301574.2|  hypothetical protein POPTR_0002s22320g           86.7    3e-16   
gb|KHN46209.1|  hypothetical protein glysoja_039933                   86.3    3e-16   Glycine soja [wild soybean]
ref|XP_006575395.1|  PREDICTED: cell wall protein AWA1-like           86.3    3e-16   Glycine max [soybeans]
ref|XP_004964933.1|  PREDICTED: uncharacterized protein LOC101755...  86.3    3e-16   Setaria italica
ref|XP_004964934.1|  PREDICTED: uncharacterized protein LOC101755...  86.3    3e-16   Setaria italica
ref|XP_009589264.1|  PREDICTED: protein PRRC2B-like isoform X6        86.3    3e-16   
ref|XP_009589263.1|  PREDICTED: protein PRRC2B-like isoform X5        86.3    3e-16   Nicotiana tomentosiformis
ref|XP_010501500.1|  PREDICTED: uncharacterized protein LOC104778...  86.3    3e-16   Camelina sativa [gold-of-pleasure]
gb|EPS69701.1|  hypothetical protein M569_05071                       80.9    4e-16   Genlisea aurea
ref|XP_010501510.1|  PREDICTED: uncharacterized protein LOC104778...  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010501505.1|  PREDICTED: uncharacterized protein LOC104778...  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010501517.1|  PREDICTED: uncharacterized protein LOC104778...  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009589259.1|  PREDICTED: protein PRRC2B-like isoform X1        86.3    4e-16   Nicotiana tomentosiformis
ref|XP_008658957.1|  PREDICTED: uncharacterized protein LOC100501...  86.3    4e-16   
ref|XP_010501523.1|  PREDICTED: uncharacterized protein LOC104778...  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009589260.1|  PREDICTED: uncharacterized protein LOC104086...  86.3    4e-16   Nicotiana tomentosiformis
ref|XP_004490553.1|  PREDICTED: flocculation protein FLO11-like       86.3    4e-16   Cicer arietinum [garbanzo]
ref|XP_008658956.1|  PREDICTED: uncharacterized protein LOC100501...  85.9    4e-16   Zea mays [maize]
gb|AFW85392.1|  putative DUF1296 domain containing family protein     85.9    4e-16   
ref|XP_008658959.1|  PREDICTED: uncharacterized protein LOC100501...  85.9    4e-16   Zea mays [maize]
ref|XP_008658958.1|  PREDICTED: uncharacterized protein LOC100501...  85.9    4e-16   Zea mays [maize]
ref|XP_009589262.1|  PREDICTED: uncharacterized protein LOC104086...  85.9    4e-16   Nicotiana tomentosiformis
ref|NP_001168331.1|  uncharacterized protein LOC100382099             85.9    4e-16   Zea mays [maize]
ref|XP_008648067.1|  PREDICTED: uncharacterized protein LOC100382...  85.9    4e-16   Zea mays [maize]
ref|XP_009782966.1|  PREDICTED: uncharacterized protein LOC104231...  85.9    5e-16   Nicotiana sylvestris
ref|XP_009782965.1|  PREDICTED: uncharacterized protein LOC104231...  85.9    5e-16   Nicotiana sylvestris
ref|XP_009782968.1|  PREDICTED: uncharacterized protein LOC104231...  85.9    5e-16   Nicotiana sylvestris
gb|AFW85393.1|  putative DUF1296 domain containing family protein     85.5    5e-16   
ref|XP_009589261.1|  PREDICTED: protein PRRC2B-like isoform X3        85.5    6e-16   Nicotiana tomentosiformis
ref|XP_008229782.1|  PREDICTED: putative GPI-anchored protein PB1...  85.5    6e-16   Prunus mume [ume]
ref|XP_008229781.1|  PREDICTED: cell wall protein AWA1 isoform X1     85.5    6e-16   Prunus mume [ume]
ref|XP_007214926.1|  hypothetical protein PRUPE_ppa001246mg           85.5    6e-16   Prunus persica
gb|AAT08008.1|  unknown                                               85.5    6e-16   Zea mays [maize]
ref|XP_006656745.1|  PREDICTED: uncharacterized protein LOC102709938  85.5    7e-16   
emb|CAN69467.1|  hypothetical protein VITISV_042554                   79.7    7e-16   Vitis vinifera
ref|XP_009782967.1|  PREDICTED: uncharacterized protein LOC104231...  85.1    8e-16   Nicotiana sylvestris
ref|XP_008342252.1|  PREDICTED: flocculation protein FLO11-like i...  85.1    9e-16   
ref|XP_008342251.1|  PREDICTED: chitinase-like protein PB1E7.04c ...  85.1    9e-16   
gb|EMT03241.1|  hypothetical protein F775_28234                       84.7    1e-15   
ref|XP_008678496.1|  PREDICTED: uncharacterized protein LOC103653...  84.7    1e-15   Zea mays [maize]
ref|XP_008678497.1|  PREDICTED: uncharacterized protein LOC103653...  84.3    1e-15   Zea mays [maize]
gb|AGT17314.1|  Protein of unknown function DUF1296                   84.3    2e-15   Saccharum hybrid cultivar R570
ref|XP_010245042.1|  PREDICTED: RNA polymerase II degradation fac...  84.3    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004502111.1|  PREDICTED: flocculation protein FLO11-like       84.3    2e-15   Cicer arietinum [garbanzo]
ref|XP_010036125.1|  PREDICTED: uncharacterized protein LOC104425...  84.3    2e-15   Eucalyptus grandis [rose gum]
ref|XP_008678494.1|  PREDICTED: probable GPI-anchored adhesin-lik...  84.0    2e-15   Zea mays [maize]
ref|XP_010036126.1|  PREDICTED: uncharacterized protein LOC104425...  84.0    2e-15   Eucalyptus grandis [rose gum]
ref|XP_002304144.2|  hypothetical protein POPTR_0003s06200g           84.3    2e-15   
ref|XP_010245043.1|  PREDICTED: uncharacterized protein LOC104588...  84.3    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004973209.1|  PREDICTED: flocculation protein FLO11-like       84.0    2e-15   Setaria italica
ref|XP_010245040.1|  PREDICTED: uncharacterized protein LOC104588...  84.0    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010245041.1|  PREDICTED: uncharacterized protein LOC104588...  84.0    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_008678495.1|  PREDICTED: probable GPI-anchored adhesin-lik...  84.0    2e-15   Zea mays [maize]
emb|CDO97864.1|  unnamed protein product                              84.0    2e-15   Coffea canephora [robusta coffee]
gb|AFW61911.1|  putative DUF1296 domain containing family protein     83.6    2e-15   
gb|AFW61910.1|  putative DUF1296 domain containing family protein     83.6    2e-15   
ref|XP_006353098.1|  PREDICTED: putative GPI-anchored protein PB1...  83.6    2e-15   Solanum tuberosum [potatoes]
ref|XP_006353099.1|  PREDICTED: putative GPI-anchored protein PB1...  83.6    2e-15   Solanum tuberosum [potatoes]
ref|XP_008678498.1|  PREDICTED: probable GPI-anchored adhesin-lik...  83.6    3e-15   Zea mays [maize]
ref|XP_006857739.1|  hypothetical protein AMTR_s00061p00187940        83.6    3e-15   Amborella trichopoda
ref|XP_011467310.1|  PREDICTED: endochitinase A isoform X3            83.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_011467309.1|  PREDICTED: endochitinase A isoform X2            83.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_011467308.1|  PREDICTED: endochitinase A isoform X1            83.2    4e-15   Fragaria vesca subsp. vesca
dbj|BAK02193.1|  predicted protein                                    82.8    5e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011100583.1|  PREDICTED: uncharacterized protein LOC105178745  82.8    6e-15   
ref|XP_009412058.1|  PREDICTED: uncharacterized protein LOC103993639  82.8    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007049403.1|  Cell wall protein AWA1 isoform 1                 82.4    6e-15   
ref|XP_009361530.1|  PREDICTED: mucin-12 isoform X2                   82.4    7e-15   
ref|XP_009361529.1|  PREDICTED: uncharacterized protein LOC103951...  82.4    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_007049405.1|  Cell wall protein AWA1 isoform 3                 82.4    7e-15   
ref|XP_002320531.2|  hypothetical protein POPTR_0014s16780g           82.4    8e-15   
ref|XP_008380020.1|  PREDICTED: flocculation protein FLO11-like i...  81.6    1e-14   
ref|XP_008380021.1|  PREDICTED: flocculation protein FLO11-like i...  81.6    1e-14   
ref|XP_010321075.1|  PREDICTED: uncharacterized protein LOC101250...  81.3    2e-14   Solanum lycopersicum
ref|XP_010321076.1|  PREDICTED: uncharacterized protein LOC101250...  81.3    2e-14   Solanum lycopersicum
ref|XP_006357673.1|  PREDICTED: flocculation protein FLO11-like i...  81.3    2e-14   
ref|XP_006357672.1|  PREDICTED: flocculation protein FLO11-like i...  81.3    2e-14   
ref|XP_006357671.1|  PREDICTED: flocculation protein FLO11-like i...  81.3    2e-14   
ref|XP_010323917.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    2e-14   Solanum lycopersicum
ref|XP_010323919.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    2e-14   Solanum lycopersicum
ref|XP_010323918.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    2e-14   Solanum lycopersicum
ref|XP_010323920.1|  PREDICTED: melanoma-associated antigen C1 is...  81.3    2e-14   Solanum lycopersicum
emb|CDY65326.1|  BnaCnng46620D                                        81.3    2e-14   Brassica napus [oilseed rape]
ref|XP_008783017.1|  PREDICTED: uncharacterized protein LOC103702...  80.9    2e-14   Phoenix dactylifera
ref|XP_008783018.1|  PREDICTED: uncharacterized protein LOC103702...  80.9    2e-14   Phoenix dactylifera
ref|XP_002964401.1|  hypothetical protein SELMODRAFT_438753           80.9    2e-14   
ref|XP_011007010.1|  PREDICTED: uncharacterized protein LOC105112...  80.9    3e-14   Populus euphratica
ref|XP_011007012.1|  PREDICTED: uncharacterized protein LOC105112...  80.5    3e-14   Populus euphratica
ref|XP_009407930.1|  PREDICTED: uncharacterized protein LOC103990491  80.5    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002436662.1|  hypothetical protein SORBIDRAFT_10g006740        80.5    3e-14   Sorghum bicolor [broomcorn]
gb|AAL68853.1|AF466199_12  gb protein                                 80.1    4e-14   Sorghum bicolor [broomcorn]
ref|XP_009391914.1|  PREDICTED: uncharacterized protein LOC103977...  80.1    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391913.1|  PREDICTED: uncharacterized protein LOC103977...  80.1    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676081.1|  PREDICTED: uncharacterized protein LOC104891...  79.3    5e-14   
gb|KJB42722.1|  hypothetical protein B456_007G165200                  80.1    5e-14   Gossypium raimondii
ref|XP_010252822.1|  PREDICTED: uncharacterized protein LOC104594...  80.1    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010252821.1|  PREDICTED: uncharacterized protein LOC104594...  80.1    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010252820.1|  PREDICTED: uncharacterized protein LOC104594...  80.1    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010109270.1|  hypothetical protein L484_014864                 79.7    5e-14   Morus notabilis
ref|XP_008462126.1|  PREDICTED: flocculation protein FLO11            79.7    5e-14   Cucumis melo [Oriental melon]
ref|XP_010676080.1|  PREDICTED: uncharacterized protein LOC104891...  79.7    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010252823.1|  PREDICTED: uncharacterized protein LOC104594...  79.7    6e-14   Nelumbo nucifera [Indian lotus]
gb|KDP29958.1|  hypothetical protein JCGZ_18527                       79.7    6e-14   Jatropha curcas
ref|XP_002967632.1|  hypothetical protein SELMODRAFT_440086           79.3    8e-14   
ref|XP_004144622.1|  PREDICTED: uncharacterized protein LOC101212400  78.6    1e-13   Cucumis sativus [cucumbers]
ref|XP_004162890.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  78.6    2e-13   
emb|CDP13693.1|  unnamed protein product                              78.2    2e-13   Coffea canephora [robusta coffee]
ref|XP_009396030.1|  PREDICTED: uncharacterized protein LOC103981...  78.2    2e-13   
ref|XP_009396005.1|  PREDICTED: uncharacterized protein LOC103981...  77.8    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396015.1|  PREDICTED: uncharacterized protein LOC103981...  77.8    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396023.1|  PREDICTED: uncharacterized protein LOC103981...  77.4    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929039.1|  PREDICTED: uncharacterized protein LOC105050...  77.4    3e-13   Elaeis guineensis
ref|XP_010929038.1|  PREDICTED: uncharacterized protein LOC105050...  77.4    3e-13   Elaeis guineensis
ref|XP_010929036.1|  PREDICTED: uncharacterized protein LOC105050...  77.4    3e-13   Elaeis guineensis
ref|XP_010929035.1|  PREDICTED: uncharacterized protein LOC105050...  77.4    3e-13   Elaeis guineensis
ref|XP_009396039.1|  PREDICTED: uncharacterized protein LOC103981...  77.4    3e-13   
ref|XP_008219419.1|  PREDICTED: flocculation protein FLO11-like       77.0    4e-13   Prunus mume [ume]
ref|XP_001756751.1|  predicted protein                                71.2    4e-13   
gb|KDO50974.1|  hypothetical protein CISIN_1g006896mg                 76.6    5e-13   Citrus sinensis [apfelsine]
ref|XP_006447831.1|  hypothetical protein CICLE_v10014215mg           77.0    5e-13   Citrus clementina [clementine]
ref|XP_007142439.1|  hypothetical protein PHAVU_008G280600g           76.6    5e-13   Phaseolus vulgaris [French bean]
ref|XP_006447832.1|  hypothetical protein CICLE_v10014215mg           77.0    5e-13   Citrus clementina [clementine]
ref|XP_004491525.1|  PREDICTED: putative GPI-anchored protein PB1...  77.0    5e-13   
ref|XP_006595682.1|  PREDICTED: putative GPI-anchored protein PB1...  76.6    5e-13   Glycine max [soybeans]
ref|XP_003545090.1|  PREDICTED: putative GPI-anchored protein PB1...  76.6    5e-13   Glycine max [soybeans]
gb|KHN23829.1|  hypothetical protein glysoja_028122                   76.6    5e-13   Glycine soja [wild soybean]
ref|XP_011008079.1|  PREDICTED: flocculation protein FLO11            76.6    6e-13   Populus euphratica
ref|XP_008783014.1|  PREDICTED: uncharacterized protein LOC103702...  76.6    7e-13   Phoenix dactylifera
ref|XP_008783012.1|  PREDICTED: uncharacterized protein LOC103702...  76.6    7e-13   Phoenix dactylifera
gb|KHN43908.1|  hypothetical protein glysoja_025947                   76.3    7e-13   Glycine soja [wild soybean]
ref|XP_011035693.1|  PREDICTED: uncharacterized protein LOC105133...  76.6    7e-13   Populus euphratica
ref|XP_011035692.1|  PREDICTED: uncharacterized protein LOC105133...  76.6    7e-13   Populus euphratica
ref|XP_006575712.1|  PREDICTED: mucin-19-like isoform X1              76.3    7e-13   Glycine max [soybeans]
ref|XP_008783016.1|  PREDICTED: uncharacterized protein LOC103702...  76.6    7e-13   Phoenix dactylifera
ref|XP_008783013.1|  PREDICTED: uncharacterized protein LOC103702...  76.6    7e-13   Phoenix dactylifera
ref|XP_008783009.1|  PREDICTED: uncharacterized protein LOC103702...  76.6    7e-13   Phoenix dactylifera
ref|XP_006575714.1|  PREDICTED: mucin-19-like isoform X3              76.3    7e-13   Glycine max [soybeans]
ref|XP_008783011.1|  PREDICTED: uncharacterized protein LOC103702...  76.6    7e-13   Phoenix dactylifera
ref|XP_006575713.1|  PREDICTED: mucin-19-like isoform X2              76.3    7e-13   Glycine max [soybeans]
ref|XP_008783015.1|  PREDICTED: uncharacterized protein LOC103702...  76.3    7e-13   Phoenix dactylifera
ref|XP_002299597.2|  hydroxyproline-rich glycoprotein                 76.3    8e-13   Populus trichocarpa [western balsam poplar]
gb|KJB06118.1|  hypothetical protein B456_001G0984002                 76.3    8e-13   Gossypium raimondii
gb|KJB06119.1|  hypothetical protein B456_001G0984002                 76.3    8e-13   Gossypium raimondii
ref|XP_008797740.1|  PREDICTED: uncharacterized protein LOC103712...  76.3    9e-13   Phoenix dactylifera
ref|XP_008797742.1|  PREDICTED: uncharacterized protein LOC103712...  76.3    9e-13   Phoenix dactylifera
ref|XP_008797741.1|  PREDICTED: uncharacterized protein LOC103712...  76.3    9e-13   Phoenix dactylifera
ref|XP_008797739.1|  PREDICTED: uncharacterized protein LOC103712...  76.3    9e-13   Phoenix dactylifera
ref|XP_010657492.1|  PREDICTED: uncharacterized protein LOC100245...  75.9    1e-12   Vitis vinifera
ref|XP_008797743.1|  PREDICTED: uncharacterized protein LOC103712...  75.9    1e-12   Phoenix dactylifera
ref|XP_007020433.1|  GBF-interacting protein 1, putative isoform 2    75.5    1e-12   
ref|XP_010657491.1|  PREDICTED: uncharacterized protein LOC100245...  75.9    1e-12   Vitis vinifera
ref|XP_002267265.1|  PREDICTED: uncharacterized protein LOC100245...  75.9    1e-12   Vitis vinifera
ref|XP_010942576.1|  PREDICTED: uncharacterized protein LOC105060...  75.9    1e-12   Elaeis guineensis
ref|XP_010942575.1|  PREDICTED: uncharacterized protein LOC105060...  75.9    1e-12   
ref|XP_010942571.1|  PREDICTED: uncharacterized protein LOC105060...  75.9    1e-12   
ref|XP_010942570.1|  PREDICTED: uncharacterized protein LOC105060...  75.9    1e-12   
ref|XP_010942574.1|  PREDICTED: uncharacterized protein LOC105060...  75.9    1e-12   
ref|XP_010942572.1|  PREDICTED: uncharacterized protein LOC105060...  75.9    1e-12   
ref|XP_010942569.1|  PREDICTED: uncharacterized protein LOC105060...  75.9    1e-12   
emb|CAN73914.1|  hypothetical protein VITISV_035233                   75.9    1e-12   
ref|XP_003617862.1|  hypothetical protein MTR_5g096290                75.1    2e-12   
ref|XP_010932458.1|  PREDICTED: RNA polymerase II degradation fac...  74.7    3e-12   
gb|EMT26073.1|  hypothetical protein F775_05710                       74.3    4e-12   
emb|CDP17325.1|  unnamed protein product                              73.9    5e-12   
ref|XP_007020432.1|  GBF-interacting protein 1, putative isoform 1    73.6    5e-12   
gb|KJB42721.1|  hypothetical protein B456_007G165200                  73.9    5e-12   
ref|XP_008229801.1|  PREDICTED: uncharacterized protein LOC103329149  72.8    6e-12   
ref|XP_010689210.1|  PREDICTED: uncharacterized protein LOC104902...  73.6    6e-12   
ref|XP_010689211.1|  PREDICTED: uncharacterized protein LOC104902...  73.6    6e-12   
ref|XP_006660473.1|  PREDICTED: flocculation protein FLO11-like       73.2    8e-12   
ref|XP_008353055.1|  PREDICTED: uncharacterized protein LOC103416590  72.8    1e-11   
ref|XP_008367199.1|  PREDICTED: uncharacterized protein LOC103430833  71.6    1e-11   
ref|XP_010644611.1|  PREDICTED: RNA polymerase II degradation fac...  72.0    2e-11   
gb|KJB63043.1|  hypothetical protein B456_009G451000                  72.0    2e-11   
gb|KJB63041.1|  hypothetical protein B456_009G451000                  72.0    2e-11   
ref|XP_008366272.1|  PREDICTED: uncharacterized protein LOC103429921  70.9    2e-11   
gb|KJB63042.1|  hypothetical protein B456_009G451000                  72.0    2e-11   
ref|XP_010644610.1|  PREDICTED: RNA polymerase II degradation fac...  72.0    2e-11   
ref|XP_010644609.1|  PREDICTED: RNA polymerase II degradation fac...  72.0    2e-11   
gb|KDO60962.1|  hypothetical protein CISIN_1g0031901mg                66.6    3e-11   
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like           71.2    4e-11   
ref|XP_009367245.1|  PREDICTED: uncharacterized protein LOC103956912  70.9    4e-11   
ref|XP_009334669.1|  PREDICTED: uncharacterized protein LOC103927468  70.9    4e-11   
ref|XP_010324240.1|  PREDICTED: uncharacterized protein LOC101262230  67.0    5e-11   
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...  70.5    6e-11   
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...  70.5    6e-11   
gb|KJB63039.1|  hypothetical protein B456_009G451000                  70.5    7e-11   
gb|KJB63040.1|  hypothetical protein B456_009G451000                  70.1    7e-11   
ref|XP_010917134.1|  PREDICTED: eukaryotic translation initiation...  70.1    8e-11   
ref|XP_011085417.1|  PREDICTED: uncharacterized protein LOC105167...  70.5    8e-11   
ref|XP_011085415.1|  PREDICTED: uncharacterized protein LOC105167...  70.1    8e-11   
ref|XP_011085416.1|  PREDICTED: uncharacterized protein LOC105167...  70.1    8e-11   
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg              70.1    1e-10   
gb|KCW70460.1|  hypothetical protein EUGRSUZ_F03678                   69.7    1e-10   
gb|KJB69764.1|  hypothetical protein B456_011G041100                  69.3    1e-10   
gb|KJB69767.1|  hypothetical protein B456_011G041100                  69.3    1e-10   
gb|KCW70461.1|  hypothetical protein EUGRSUZ_F03678                   69.3    1e-10   
ref|XP_008384597.1|  PREDICTED: formin-like protein 7                 69.7    1e-10   
gb|KHF99174.1|  hypothetical protein F383_17166                       69.7    1e-10   
gb|KJB69766.1|  hypothetical protein B456_011G041100                  69.3    1e-10   
gb|KHF99173.1|  hypothetical protein F383_17166                       69.3    1e-10   
ref|XP_010063251.1|  PREDICTED: uncharacterized protein LOC104450411  69.3    1e-10   
gb|KDO59193.1|  hypothetical protein CISIN_1g004145mg                 69.3    2e-10   
ref|XP_006452644.1|  hypothetical protein CICLE_v10007522mg           69.3    2e-10   
gb|KDO59191.1|  hypothetical protein CISIN_1g004145mg                 69.3    2e-10   
ref|XP_006474835.1|  PREDICTED: mucin-17-like isoform X3              69.3    2e-10   
ref|XP_006474834.1|  PREDICTED: mucin-17-like isoform X2              68.9    2e-10   
gb|KDO59190.1|  hypothetical protein CISIN_1g004145mg                 68.9    2e-10   
gb|KDO59192.1|  hypothetical protein CISIN_1g004145mg                 68.9    2e-10   
ref|XP_006474833.1|  PREDICTED: mucin-17-like isoform X1              68.9    2e-10   
ref|XP_006452645.1|  hypothetical protein CICLE_v10007522mg           68.9    2e-10   
ref|XP_010654472.1|  PREDICTED: uncharacterized protein LOC100248...  68.9    2e-10   
ref|XP_010942880.1|  PREDICTED: uncharacterized protein LOC105060...  68.9    2e-10   
ref|XP_010942881.1|  PREDICTED: uncharacterized protein LOC105060...  68.9    2e-10   
gb|KDP39314.1|  hypothetical protein JCGZ_01071                       68.2    4e-10   
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549  67.8    5e-10   
ref|XP_011095579.1|  PREDICTED: endochitinase A                       67.4    6e-10   
ref|XP_010551966.1|  PREDICTED: uncharacterized protein LOC104822439  67.0    8e-10   
ref|XP_002884662.1|  hypothetical protein ARALYDRAFT_896937           67.0    8e-10   
ref|XP_006407810.1|  hypothetical protein EUTSA_v10020055mg           67.0    8e-10   
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730        67.0    8e-10   
ref|XP_002522794.1|  conserved hypothetical protein                   67.0    1e-09   
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...  67.0    1e-09   
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...  67.0    1e-09   
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg           67.0    1e-09   
ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...  66.6    1e-09   
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...  66.6    1e-09   
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...  66.6    1e-09   
gb|KDO78065.1|  hypothetical protein CISIN_1g0026402mg                66.2    1e-09   
gb|KDO78063.1|  hypothetical protein CISIN_1g0026402mg                66.2    1e-09   
gb|KDO78068.1|  hypothetical protein CISIN_1g0026402mg                66.2    1e-09   
gb|KFK38755.1|  hypothetical protein AALP_AA3G156400                  66.6    1e-09   
gb|KFK38754.1|  hypothetical protein AALP_AA3G156400                  66.6    1e-09   
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...  66.6    1e-09   
gb|KFK38756.1|  hypothetical protein AALP_AA3G156400                  66.6    1e-09   
gb|KDO78064.1|  hypothetical protein CISIN_1g0026402mg                66.2    1e-09   
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...  66.2    2e-09   
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...  66.2    2e-09   
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306  66.2    2e-09   
ref|XP_010524628.1|  PREDICTED: uncharacterized protein LOC104802632  66.2    2e-09   
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg           66.2    2e-09   
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg           66.2    2e-09   
ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...  65.9    2e-09   
ref|XP_010456509.1|  PREDICTED: uncharacterized protein LOC104737938  65.9    2e-09   
gb|AFK38455.1|  unknown                                               65.5    2e-09   
ref|NP_187423.2|  uncharacterized protein                             65.9    2e-09   
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351  65.9    2e-09   
ref|XP_010486335.1|  PREDICTED: uncharacterized protein LOC104764492  65.9    2e-09   
ref|XP_010464402.1|  PREDICTED: uncharacterized protein LOC104744...  65.9    2e-09   
ref|XP_002891854.1|  F20N2.19                                         65.9    2e-09   
ref|XP_010487071.1|  PREDICTED: uncharacterized protein LOC104765097  65.5    3e-09   
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...  65.5    3e-09   
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...  65.5    3e-09   
ref|XP_010552357.1|  PREDICTED: uncharacterized protein LOC104822725  65.1    3e-09   
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...  65.1    3e-09   
ref|XP_010237341.1|  PREDICTED: uncharacterized protein LOC100835561  65.1    4e-09   
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...  65.1    4e-09   
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...  65.1    4e-09   
ref|NP_187929.4|  GBF-interacting protein 1                           64.7    4e-09   
gb|AAT44198.1|  unknown protein                                       65.1    4e-09   
ref|XP_010465140.1|  PREDICTED: uncharacterized protein LOC104745563  64.7    4e-09   
ref|XP_002519742.1|  conserved hypothetical protein                   64.7    5e-09   
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...  64.7    5e-09   
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...  64.7    5e-09   
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like           64.7    5e-09   
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like           64.7    6e-09   
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...  64.3    6e-09   
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...  64.3    6e-09   
gb|KHN22963.1|  hypothetical protein glysoja_030633                   64.7    6e-09   
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...  64.3    6e-09   
ref|XP_006827353.1|  hypothetical protein AMTR_s00011p00072820        64.3    7e-09   
gb|KFK38227.1|  hypothetical protein AALP_AA3G085200                  64.3    7e-09   
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g           64.3    7e-09   
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like             64.3    7e-09   
ref|XP_002884954.1|  hypothetical protein ARALYDRAFT_478702           63.9    8e-09   
ref|XP_010500212.1|  PREDICTED: uncharacterized protein LOC104777...  63.9    8e-09   
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...  64.3    8e-09   
ref|XP_006299052.1|  hypothetical protein CARUB_v10015191mg           63.9    8e-09   
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...  63.9    8e-09   
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...  63.9    9e-09   
ref|XP_010434571.1|  PREDICTED: probable serine/threonine-protein...  63.9    9e-09   
ref|XP_010500220.1|  PREDICTED: uncharacterized protein LOC104777...  63.5    9e-09   
ref|XP_010434569.1|  PREDICTED: probable serine/threonine-protein...  63.9    9e-09   
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...  63.9    9e-09   
ref|XP_009147476.1|  PREDICTED: uncharacterized protein LOC103871018  63.9    9e-09   
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...  63.9    9e-09   
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...  63.9    9e-09   
gb|KFK35559.1|  hypothetical protein AALP_AA4G006700                  63.5    1e-08   
ref|XP_006296980.1|  hypothetical protein CARUB_v10012975mg           63.9    1e-08   
dbj|BAB01415.1|  unnamed protein product                              63.5    1e-08   
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...  63.9    1e-08   
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593  63.9    1e-08   
ref|XP_006392705.1|  hypothetical protein EUTSA_v10011240mg           63.5    1e-08   
ref|XP_006392599.1|  hypothetical protein EUTSA_v10011305mg           63.5    1e-08   
ref|XP_006392706.1|  hypothetical protein EUTSA_v10011240mg           63.5    1e-08   
ref|NP_001056433.1|  Os05g0581800                                     63.5    1e-08   
gb|KFK27097.1|  hypothetical protein AALP_AA8G333800                  60.1    1e-08   
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...  63.5    1e-08   
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...  63.5    1e-08   
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like             63.5    1e-08   
ref|XP_010469383.1|  PREDICTED: uncharacterized protein LOC104749...  60.5    2e-08   
emb|CDY61669.1|  BnaC01g40800D                                        63.2    2e-08   
emb|CDX78828.1|  BnaA01g08950D                                        62.8    2e-08   
ref|XP_009131438.1|  PREDICTED: flocculation protein FLO11            62.8    2e-08   
ref|XP_010462445.1|  PREDICTED: uncharacterized protein LOC104743021  62.4    2e-08   
ref|XP_004162612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.4    3e-08   
ref|XP_010469381.1|  PREDICTED: uncharacterized protein LOC104749...  59.7    3e-08   
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211388  62.4    3e-08   
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...  62.4    3e-08   
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...  62.4    3e-08   
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...  62.4    3e-08   
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...  62.4    3e-08   
ref|XP_009395691.1|  PREDICTED: mucin-17-like                         62.4    3e-08   
ref|XP_003567874.1|  PREDICTED: uncharacterized protein LOC100840916  62.4    3e-08   
gb|KJB69763.1|  hypothetical protein B456_011G041100                  62.0    3e-08   
emb|CDY43361.1|  BnaA01g29920D                                        62.0    3e-08   
gb|KGN49366.1|  hypothetical protein Csa_6G522110                     62.0    4e-08   
gb|KJB69765.1|  hypothetical protein B456_011G041100                  62.0    4e-08   
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...  62.0    4e-08   
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...  62.0    4e-08   
ref|XP_006414144.1|  hypothetical protein EUTSA_v10027504mg           62.0    4e-08   
ref|XP_010501199.1|  PREDICTED: uncharacterized protein LOC104778449  61.6    4e-08   
ref|XP_010547194.1|  PREDICTED: uncharacterized protein LOC104819...  62.0    4e-08   
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756  62.0    4e-08   
ref|XP_010547193.1|  PREDICTED: uncharacterized protein LOC104819...  62.0    4e-08   
ref|XP_010547195.1|  PREDICTED: uncharacterized protein LOC104819...  62.0    4e-08   
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...  62.0    4e-08   
emb|CDY22126.1|  BnaC01g39750D                                        62.0    4e-08   
ref|XP_009124224.1|  PREDICTED: uncharacterized protein LOC103849165  62.0    4e-08   
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...  61.6    5e-08   
ref|XP_010102151.1|  hypothetical protein L484_021385                 61.6    5e-08   
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g           61.6    6e-08   
ref|XP_006307156.1|  hypothetical protein CARUB_v10008748mg           61.2    6e-08   
ref|XP_010480139.1|  PREDICTED: uncharacterized protein LOC104758...  60.8    6e-08   
ref|XP_010480138.1|  PREDICTED: uncharacterized protein LOC104758...  60.8    7e-08   
gb|KHG18569.1|  Protein translocase subunit SecA                      61.2    8e-08   
gb|KJB57295.1|  hypothetical protein B456_009G157400                  61.2    8e-08   
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                61.2    8e-08   
gb|KHN40031.1|  hypothetical protein glysoja_009408                   56.2    8e-08   
ref|XP_010559258.1|  PREDICTED: uncharacterized protein LOC104827...  60.8    8e-08   
ref|XP_010559260.1|  PREDICTED: uncharacterized protein LOC104827...  60.8    9e-08   
ref|XP_006346245.1|  PREDICTED: uncharacterized protein LOC102592558  60.8    9e-08   
ref|NP_001141689.1|  uncharacterized protein LOC100273818             60.8    9e-08   
ref|XP_010559259.1|  PREDICTED: uncharacterized protein LOC104827...  60.8    9e-08   
ref|XP_010559257.1|  PREDICTED: uncharacterized protein LOC104827...  60.8    9e-08   
emb|CDY24202.1|  BnaC01g37820D                                        60.5    9e-08   
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.8    9e-08   
ref|XP_007048866.1|  Uncharacterized protein TCM_001879               60.8    9e-08   
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...  60.8    1e-07   
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...  60.8    1e-07   
ref|XP_006437175.1|  hypothetical protein CICLE_v10033869mg           60.8    1e-07   
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...  60.8    1e-07   
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...  60.5    1e-07   
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...  60.5    1e-07   
ref|XP_007025176.1|  Uncharacterized protein TCM_029557               60.5    1e-07   
gb|AFW83477.1|  putative DUF1296 domain containing family protein     59.3    2e-07   
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...  60.1    2e-07   
emb|CDX94662.1|  BnaC07g09960D                                        60.1    2e-07   
ref|XP_002300395.2|  hypothetical protein POPTR_0001s37980g           60.1    2e-07   
ref|XP_002870069.1|  predicted protein                                59.7    2e-07   
ref|XP_006484855.1|  PREDICTED: uncharacterized protein LOC102628...  59.7    2e-07   
ref|XP_006484854.1|  PREDICTED: uncharacterized protein LOC102628...  59.7    2e-07   
ref|XP_002317304.2|  kinase-related family protein                    59.7    2e-07   
ref|NP_193549.5|  uncharacterized protein                             59.7    2e-07   
gb|KHN48057.1|  hypothetical protein glysoja_015527                   59.7    2e-07   
gb|AFW81251.1|  putative DUF1296 domain containing family protein     59.7    2e-07   
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g           59.3    3e-07   
gb|AAF79311.1|AC002304_4  F14J16.6                                    59.3    3e-07   
ref|XP_002893558.1|  hypothetical protein ARALYDRAFT_473146           59.3    3e-07   
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...  58.9    3e-07   
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...  59.3    3e-07   
ref|NP_001146586.1|  uncharacterized protein LOC100280182             58.9    3e-07   
gb|AFW81248.1|  putative DUF1296 domain containing family protein     58.9    3e-07   
ref|XP_010549430.1|  PREDICTED: uncharacterized protein LOC104820614  58.9    3e-07   



>ref|XP_008228221.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X6 [Prunus mume]
Length=829

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  460  RNALPGTGVSR  492
            R+ + GTG+SR
Sbjct  117  RSGVTGTGISR  127



>ref|XP_008228216.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X1 
[Prunus mume]
Length=853

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  460  RNALPGTGVSR  492
            R+ + GTG+SR
Sbjct  117  RSGVTGTGISR  127



>ref|XP_008228217.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X2 
[Prunus mume]
Length=852

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  460  RNALPGTGVSR  492
            R+ + GTG+SR
Sbjct  117  RSGVTGTGISR  127



>ref|XP_008228219.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X4 
[Prunus mume]
Length=851

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FH VKR+RD++KE      V+  + G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKE------VSSNSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  114

Query  460  RNALPGTGVSR  492
            R+ + GTG+SR
Sbjct  115  RSGVTGTGISR  125



>ref|XP_008228218.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X3 [Prunus mume]
Length=851

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  460  RNALPGTGVSR  492
            R+ +  TG+SR
Sbjct  117  RSGV--TGISR  125



>ref|XP_008228220.1| PREDICTED: probable secreted beta-glucosidase adg3 isoform X5 
[Prunus mume]
Length=850

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ +S GVR TI+++KE+ + HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGTQIISAGVRKTIQSIKEIVRNHSDIDIYWALKETDMDPNETTQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FH VKR+RD++KE       N+Q+ G+    E R+ FE A   +KS T ++  +RRG Y 
Sbjct  61   FHLVKRKRDKRKEV----SSNLQSMGHTVSVEPRRHFESAGQGLKSNTSSDRNVRRGGYA  116

Query  460  RNALPGTGVSR  492
            R+ +  TG+SR
Sbjct  117  RSGV--TGISR  125



>ref|XP_010261965.1| PREDICTED: uncharacterized protein LOC104600611 isoform X1 [Nelumbo 
nucifera]
Length=851

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 87/131 (66%), Gaps = 12/131 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            M +GS+ +GGTQ LS  VR TI+++KE+ + HS+ADIY  LKESNMDPNET QKL +QD 
Sbjct  1    MNSGSRLDGGTQILSARVRKTIQSIKEIVQNHSDADIYVMLKESNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FHEVKR+RD+KKE +N          YR   D +++ E    A KS T ++   RRG Y 
Sbjct  61   FHEVKRKRDKKKENIN----------YRGSIDPKRQSEHLGQAAKSHTFSDRNARRGGYV  110

Query  460  RNALPGTGVSR  492
            RN LP  G+SR
Sbjct  111  RNVLPDAGISR  121



>ref|XP_010273948.1| PREDICTED: uncharacterized protein LOC104609354 isoform X2 [Nelumbo 
nucifera]
Length=857

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 15/132 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ +GGTQ L   VR TI+++KE+   HSEADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSGSRPDGGTQILPARVRKTIQSIKEIVGNHSEADIYVMLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYR-TEEDRKEFEPANLAVKSKTHNNLIRR--GPY  456
            FHEVKRRRD++KE          NTGY+ + E RK  E      KS T ++ + R  G Y
Sbjct  61   FHEVKRRRDKRKE----------NTGYKVSTEPRKPIERIGQGTKSHTFSDRVARRGGGY  110

Query  457  KRNALPGTGVSR  492
             RNAL  +G+SR
Sbjct  111  SRNAL--SGISR  120



>ref|XP_010273947.1| PREDICTED: uncharacterized protein LOC104609354 isoform X1 [Nelumbo 
nucifera]
Length=873

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 15/132 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ +GGTQ L   VR TI+++KE+   HSEADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSGSRPDGGTQILPARVRKTIQSIKEIVGNHSEADIYVMLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYR-TEEDRKEFEPANLAVKSKTHNNLIRR--GPY  456
            FHEVKRRRD++KE          NTGY+ + E RK  E      KS T ++ + R  G Y
Sbjct  61   FHEVKRRRDKRKE----------NTGYKVSTEPRKPIERIGQGTKSHTFSDRVARRGGGY  110

Query  457  KRNALPGTGVSR  492
             RNAL  +G+SR
Sbjct  111  SRNAL--SGISR  120



>ref|XP_010654471.1| PREDICTED: uncharacterized protein LOC100248075 isoform X4 [Vitis 
vinifera]
Length=819

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 85/137 (62%), Gaps = 25/137 (18%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  286  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  441
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  442  RRGPYKRNALPGTGVSR  492
            RRG Y R+ +P  G+ R
Sbjct  104  RRGGYSRSTVPDAGIGR  120



>ref|XP_010654468.1| PREDICTED: uncharacterized protein LOC100248075 isoform X1 [Vitis 
vinifera]
Length=855

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 85/137 (62%), Gaps = 25/137 (18%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  286  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  441
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  442  RRGPYKRNALPGTGVSR  492
            RRG Y R+ +P  G+ R
Sbjct  104  RRGGYSRSTVPDAGIGR  120



>ref|XP_009757816.1| PREDICTED: uncharacterized protein LOC104210585 isoform X1 [Nicotiana 
sylvestris]
Length=834

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 85/135 (63%), Gaps = 16/135 (12%)
 Frame = +1

Query  106  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  447
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH N  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVNRNIRR  110

Query  448  GPYKRNALPGTGVSR  492
            G Y + ALP  G++R
Sbjct  111  GSYSQTALPDAGLTR  125



>ref|XP_009757817.1| PREDICTED: uncharacterized protein LOC104210585 isoform X2 [Nicotiana 
sylvestris]
Length=833

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 85/135 (63%), Gaps = 16/135 (12%)
 Frame = +1

Query  106  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  447
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH N  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVNRNIRR  110

Query  448  GPYKRNALPGTGVSR  492
            G Y + ALP  G++R
Sbjct  111  GSYSQTALPDAGLTR  125



>ref|XP_009599552.1| PREDICTED: uncharacterized protein LOC104095192 isoform X1 [Nicotiana 
tomentosiformis]
Length=833

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 85/135 (63%), Gaps = 16/135 (12%)
 Frame = +1

Query  106  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  447
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH +  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVDRNIRR  110

Query  448  GPYKRNALPGTGVSR  492
            G Y R ALP  G++R
Sbjct  111  GSYSRTALPDAGLTR  125



>ref|XP_010654470.1| PREDICTED: uncharacterized protein LOC100248075 isoform X3 [Vitis 
vinifera]
Length=853

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 25/134 (19%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  286  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  441
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  442  RRGPYKRNALPGTG  483
            RRG Y R+ +PG G
Sbjct  104  RRGGYSRSTVPGIG  117



>ref|XP_009599553.1| PREDICTED: uncharacterized protein LOC104095192 isoform X2 [Nicotiana 
tomentosiformis]
Length=832

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 85/135 (63%), Gaps = 16/135 (12%)
 Frame = +1

Query  106  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  447
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH +  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVDRNIRR  110

Query  448  GPYKRNALPGTGVSR  492
            G Y R ALP  G++R
Sbjct  111  GSYSRTALPDAGLTR  125



>ref|XP_006361345.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Solanum 
tuberosum]
Length=839

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 83/133 (62%), Gaps = 14/133 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+ SK E GT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKPESGTHVLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRRGP  453
            FHEVKR+RDRKKE          N GY++    E+    E     ++  TH N+ IRRG 
Sbjct  61   FHEVKRKRDRKKE----------NHGYKSSTAPENGSHSEHGAQEMRVNTHINHNIRRGS  110

Query  454  YKRNALPGTGVSR  492
            Y R ALP  G +R
Sbjct  111  YNRTALPDAGFTR  123



>ref|XP_006361346.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Solanum 
tuberosum]
Length=838

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 83/133 (62%), Gaps = 14/133 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+ SK E GT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKPESGTHVLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRRGP  453
            FHEVKR+RDRKKE          N GY++    E+    E     ++  TH N+ IRRG 
Sbjct  61   FHEVKRKRDRKKE----------NHGYKSSTAPENGSHSEHGAQEMRVNTHINHNIRRGS  110

Query  454  YKRNALPGTGVSR  492
            Y R ALP  G +R
Sbjct  111  YNRTALPDAGFTR  123



>ref|XP_010261966.1| PREDICTED: uncharacterized protein LOC104600611 isoform X2 [Nelumbo 
nucifera]
Length=849

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            M +GS+ +GGTQ LS  VR TI+++KE+ + HS+ADIY  LKESNMDPNET QKL +QD 
Sbjct  1    MNSGSRLDGGTQILSARVRKTIQSIKEIVQNHSDADIYVMLKESNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FHEVKR+RD+KKE +N          YR   D +++ E    A KS T ++   RRG Y 
Sbjct  61   FHEVKRKRDKKKENIN----------YRGSIDPKRQSEHLGQAAKSHTFSDRNARRGGYV  110

Query  460  RNALPG  477
            RN LPG
Sbjct  111  RNVLPG  116



>ref|XP_006361347.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Solanum 
tuberosum]
Length=837

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 81/128 (63%), Gaps = 14/128 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+ SK E GT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKPESGTHVLSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRRGP  453
            FHEVKR+RDRKKE          N GY++    E+    E     ++  TH N+ IRRG 
Sbjct  61   FHEVKRKRDRKKE----------NHGYKSSTAPENGSHSEHGAQEMRVNTHINHNIRRGS  110

Query  454  YKRNALPG  477
            Y R ALPG
Sbjct  111  YNRTALPG  118



>ref|XP_010062690.1| PREDICTED: uncharacterized protein LOC104450008 isoform X2 [Eucalyptus 
grandis]
Length=863

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 82/124 (66%), Gaps = 11/124 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV  SK EGGTQ L P VR TI+T+KEV K +S+ADIYA LKES+MDPNET QKL +QD 
Sbjct  1    MVTASKAEGGTQVLPPRVRSTIQTIKEVVKNYSDADIYAALKESDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVK-SKTHNNLIRRGPYKR  462
            FHEVKR++DRKKE+          TG    E RK FE      K S   ++ IR+G Y R
Sbjct  61   FHEVKRKKDRKKES-------TAQTG--PTEQRKHFENVGQVRKFSPQVDHGIRKG-YTR  110

Query  463  NALP  474
            NALP
Sbjct  111  NALP  114



>ref|XP_010062689.1| PREDICTED: uncharacterized protein LOC104450008 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69815.1| hypothetical protein EUGRSUZ_F03171 [Eucalyptus grandis]
Length=866

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 82/124 (66%), Gaps = 11/124 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV  SK EGGTQ L P VR TI+T+KEV K +S+ADIYA LKES+MDPNET QKL +QD 
Sbjct  1    MVTASKAEGGTQVLPPRVRSTIQTIKEVVKNYSDADIYAALKESDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVK-SKTHNNLIRRGPYKR  462
            FHEVKR++DRKKE+          TG    E RK FE      K S   ++ IR+G Y R
Sbjct  61   FHEVKRKKDRKKES-------TAQTG--PTEQRKHFENVGQVRKFSPQVDHGIRKG-YTR  110

Query  463  NALP  474
            NALP
Sbjct  111  NALP  114



>ref|XP_009757818.1| PREDICTED: uncharacterized protein LOC104210585 isoform X3 [Nicotiana 
sylvestris]
Length=832

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 82/130 (63%), Gaps = 16/130 (12%)
 Frame = +1

Query  106  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  447
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH N  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVNRNIRR  110

Query  448  GPYKRNALPG  477
            G Y + ALPG
Sbjct  111  GSYSQTALPG  120



>emb|CBI35892.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 25/132 (19%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +QD 
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQDP  60

Query  286  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  441
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  442  RRGPYKRNALPG  477
            RRG Y R+ +PG
Sbjct  104  RRGGYSRSTVPG  115



>ref|XP_009599554.1| PREDICTED: uncharacterized protein LOC104095192 isoform X3 [Nicotiana 
tomentosiformis]
Length=831

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 82/130 (63%), Gaps = 16/130 (12%)
 Frame = +1

Query  106  MVAGS--KFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV+GS  K +GGT  LS GVR  +E++KEV   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVSGSNSKADGGTHILSAGVREILESIKEVVGNHSDADIYVALKETNMDPNETAQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRR  447
            D FHEVKRRRDRKKE          N GYR+    E+    E     ++  TH +  IRR
Sbjct  61   DPFHEVKRRRDRKKE----------NHGYRSSTAPENGSYSEHGTQEMRVNTHVDRNIRR  110

Query  448  GPYKRNALPG  477
            G Y R ALPG
Sbjct  111  GSYSRTALPG  120



>ref|XP_006426627.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
 gb|ESR39867.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
Length=867

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 14/138 (10%)
 Frame = +1

Query  88   RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  267
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  268  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTHN--NL  438
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  439  IRRGPYKRNALPGTGVSR  492
             RRG Y RNALP  G++R
Sbjct  117  RRRG-YNRNALPDAGINR  133



>ref|XP_006465941.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=862

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 14/138 (10%)
 Frame = +1

Query  88   RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  267
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  268  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTH--NNL  438
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  439  IRRGPYKRNALPGTGVSR  492
             RRG Y RNALP  G++R
Sbjct  117  RRRG-YNRNALPDAGINR  133



>ref|XP_006426626.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
 gb|ESR39866.1| hypothetical protein CICLE_v10024871mg [Citrus clementina]
Length=866

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 14/138 (10%)
 Frame = +1

Query  88   RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  267
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  268  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTHN--NL  438
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  439  IRRGPYKRNALPGTGVSR  492
             RRG Y RNALP  G++R
Sbjct  117  RRRG-YNRNALPDAGINR  133



>ref|XP_010936968.1| PREDICTED: uncharacterized protein LOC105056461 isoform X1 [Elaeis 
guineensis]
Length=863

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 80/127 (63%), Gaps = 12/127 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV  S+ +GGTQ +S  VR TI+++KE+   HS+ADIYA L+E+ MDPNET QKL +QD 
Sbjct  1    MVLASRLDGGTQTISFRVRKTIQSIKEIVGNHSDADIYAVLRETGMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL---IRRGPY  456
            FHEVKR+RDRKKE         QNTGYR   D +     +   K K+  +     +RG Y
Sbjct  61   FHEVKRKRDRKKEP--------QNTGYRASVDTR-IRTVHKIQKEKSQASWGQNAKRGSY  111

Query  457  KRNALPG  477
             RN +PG
Sbjct  112  PRNPVPG  118



>ref|XP_010314322.1| PREDICTED: uncharacterized protein LOC101258733 isoform X2 [Solanum 
lycopersicum]
Length=833

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 79/130 (61%), Gaps = 8/130 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+ SK E GT  +S GVR  +E++KEV   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKSESGTHVISVGVREILESIKEVVGNHSDADIYVTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTH-NNLIRRGPYKR  462
            FH+VKR+ DR+KE            G   E D  E       ++  TH N  IRRG Y R
Sbjct  61   FHKVKRKGDRRKENHGYKSSTAPENGNYLEHDAHE-------MRINTHINRNIRRGSYNR  113

Query  463  NALPGTGVSR  492
             ALP  G++R
Sbjct  114  TALPDAGLTR  123



>ref|XP_004252392.1| PREDICTED: uncharacterized protein LOC101258733 isoform X1 [Solanum 
lycopersicum]
Length=834

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 79/130 (61%), Gaps = 8/130 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+ SK E GT  +S GVR  +E++KEV   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKSESGTHVISVGVREILESIKEVVGNHSDADIYVTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTH-NNLIRRGPYKR  462
            FH+VKR+ DR+KE            G   E D  E       ++  TH N  IRRG Y R
Sbjct  61   FHKVKRKGDRRKENHGYKSSTAPENGNYLEHDAHE-------MRINTHINRNIRRGSYNR  113

Query  463  NALPGTGVSR  492
             ALP  G++R
Sbjct  114  TALPDAGLTR  123



>gb|KDO65081.1| hypothetical protein CISIN_1g040475mg [Citrus sinensis]
Length=861

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 14/133 (11%)
 Frame = +1

Query  88   RSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQK  267
            R H       ++ EGGTQ LS G+R TI+T+KE+   HS+ADIY TLK+SNMDPNET QK
Sbjct  7    RGHPTATSKTTRIEGGTQILSAGMRNTIQTIKEIVGNHSDADIYFTLKDSNMDPNETAQK  66

Query  268  LYHQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSKTH--NNL  438
            L +QD F EVKRRRD+KKE          N  Y++ EE RK  E     ++ +T+   N 
Sbjct  67   LLNQDPFLEVKRRRDKKKE----------NMSYKSLEEPRKNSEIFGKTMRIRTYADRNA  116

Query  439  IRRGPYKRNALPG  477
             RRG Y RNALPG
Sbjct  117  RRRG-YNRNALPG  128



>gb|EYU21338.1| hypothetical protein MIMGU_mgv1a001286mg [Erythranthe guttata]
Length=847

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 14/131 (11%)
 Frame = +1

Query  112  AGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFH  291
            +GS+ EGG   +S GVR TI+++KE+   HS+ADIYA L+++NMDPNET QK+ +QD FH
Sbjct  4    SGSRTEGGPLVISAGVRRTIQSIKEIVGNHSDADIYAVLQDTNMDPNETAQKMLNQDPFH  63

Query  292  EVKRRRDRKKEALNVPKVNIQNTGYRT---EEDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
            EVKR+RDRK+E           +GY++    + +K  +PA++ VK   +++   RRG   
Sbjct  64   EVKRKRDRKREI----------SGYKSYIAADPKKSADPAHMPVKFSAYSDRNTRRGVST  113

Query  460  RNALPGTGVSR  492
            RNA P  G +R
Sbjct  114  RNAAPDAGANR  124



>ref|XP_010936970.1| PREDICTED: uncharacterized protein LOC105056461 isoform X2 [Elaeis 
guineensis]
Length=861

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 79/127 (62%), Gaps = 14/127 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV  S+ +GGTQ +S  VR TI+++KE+   HS+ADIYA L+E+ MDPNET QKL +QD 
Sbjct  1    MVLASRLDGGTQTISFRVRKTIQSIKEIVGNHSDADIYAVLRETGMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL---IRRGPY  456
            FHEVKR+RDRKKE          NTGYR   D +     +   K K+  +     +RG Y
Sbjct  61   FHEVKRKRDRKKE----------NTGYRASVDTR-IRTVHKIQKEKSQASWGQNAKRGSY  109

Query  457  KRNALPG  477
             RN +PG
Sbjct  110  PRNPVPG  116



>ref|XP_007024588.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY27210.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=842

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 13/130 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  462
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  463  NALPGTGVSR  492
            N LP  GV+R
Sbjct  109  NTLPDAGVNR  118



>ref|XP_007024585.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY27207.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=852

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 84/130 (65%), Gaps = 13/130 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  462
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  463  NALPGTGVSR  492
            N LP  GV+R
Sbjct  109  NTLPDAGVNR  118



>ref|XP_010314323.1| PREDICTED: uncharacterized protein LOC101258733 isoform X3 [Solanum 
lycopersicum]
Length=832

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 80/128 (63%), Gaps = 14/128 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+ SK E GT  +S GVR  +E++KEV   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSSSKSESGTHVISVGVREILESIKEVVGNHSDADIYVTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTH-NNLIRRGP  453
            FH+VKR+ DR+KE          N GY++    E+    E     ++  TH N  IRRG 
Sbjct  61   FHKVKRKGDRRKE----------NHGYKSSTAPENGNYLEHDAHEMRINTHINRNIRRGS  110

Query  454  YKRNALPG  477
            Y R ALPG
Sbjct  111  YNRTALPG  118



>ref|XP_006583149.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Glycine 
max]
Length=830

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 80/129 (62%), Gaps = 11/129 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV GS+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTEGGTGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE---PANLAVKSKTHNNLIRRG  450
            D FHEVKRRRDRKKE  NV      N G  + + R+  E      +   + +  N +RR 
Sbjct  61   DPFHEVKRRRDRKKETQNV-----GNKGQPSADSRRSSENNSGQGMKFNAPSERN-VRRT  114

Query  451  PYKRNALPG  477
             Y RN LPG
Sbjct  115  NYSRNTLPG  123



>ref|XP_003528451.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 gb|KHN01390.1| hypothetical protein glysoja_009596 [Glycine soja]
Length=863

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 80/129 (62%), Gaps = 11/129 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV GS+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTEGGTGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE---PANLAVKSKTHNNLIRRG  450
            D FHEVKRRRDRKKE  NV      N G  + + R+  E      +   + +  N +RR 
Sbjct  61   DPFHEVKRRRDRKKETQNV-----GNKGQPSADSRRSSENNSGQGMKFNAPSERN-VRRT  114

Query  451  PYKRNALPG  477
             Y RN LPG
Sbjct  115  NYSRNTLPG  123



>ref|XP_006583148.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
Length=855

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 80/129 (62%), Gaps = 11/129 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV GS+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTEGGTGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE---PANLAVKSKTHNNLIRRG  450
            D FHEVKRRRDRKKE  NV      N G  + + R+  E      +   + +  N +RR 
Sbjct  61   DPFHEVKRRRDRKKETQNV-----GNKGQPSADSRRSSENNSGQGMKFNAPSERN-VRRT  114

Query  451  PYKRNALPG  477
             Y RN LPG
Sbjct  115  NYSRNTLPG  123



>ref|XP_010654469.1| PREDICTED: uncharacterized protein LOC100248075 isoform X2 [Vitis 
vinifera]
Length=855

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 78/137 (57%), Gaps = 25/137 (18%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            M   S+ EGG Q L P V  TI+ +KE+   HS+ADIY  L+E NMDPNET QKL +QD 
Sbjct  1    MAFDSRMEGGMQILPPQVHKTIQLIKEIVGNHSDADIYVALREMNMDPNETVQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNV-----PKVNIQNTG---YRTEEDRKEFEPANLAVKSKTHNNLI  441
            FHEVKR+RD+KKE+        P++ I+N G   +R+  DR                  +
Sbjct  61   FHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKFRSFPDRN-----------------V  103

Query  442  RRGPYKRNALPGTGVSR  492
            RRG Y R+ +P  G+ R
Sbjct  104  RRGGYSRSTVPDAGIGR  120



>ref|XP_008797669.1| PREDICTED: uncharacterized protein LOC103712805 isoform X2 [Phoenix 
dactylifera]
Length=861

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 80/127 (63%), Gaps = 14/127 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV  SK +GGTQ +S  VR TI+++KE+   HS+ADIYA L+E+ MDPNET QKL +QDT
Sbjct  1    MVLASKLDGGTQTISFRVRKTIQSIKEIVGNHSDADIYAVLRETGMDPNETAQKLLNQDT  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL---IRRGPY  456
            FHEVKR+RDRKKE+          TGYR   D +     +   + K+  +     +RG Y
Sbjct  61   FHEVKRKRDRKKES----------TGYRASVDTR-IRTVHKIQREKSQASWGQNAKRGGY  109

Query  457  KRNALPG  477
             R+ +PG
Sbjct  110  PRSPVPG  116



>ref|XP_007024587.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY27209.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=849

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 81/126 (64%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  462
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  463  NALPGT  480
            N LPG 
Sbjct  109  NTLPGV  114



>ref|XP_007024589.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOY27211.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=839

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 81/126 (64%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  462
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  463  NALPGT  480
            N LPG 
Sbjct  109  NTLPGV  114



>gb|EPS69388.1| hypothetical protein M569_05379, partial [Genlisea aurea]
Length=160

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  112  AGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFH  291
            +GS+ EGG Q LS GVR TI+++KEV   HS+ADIY  LKE+NMDPNET  KL  QD FH
Sbjct  1    SGSRIEGGPQVLSAGVRRTIQSIKEVFGSHSDADIYVALKEANMDPNETAHKLLIQDPFH  60

Query  292  EVKRRRDRKKE  324
            EVKR+RDRKKE
Sbjct  61   EVKRKRDRKKE  71



>ref|XP_007024584.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY27206.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=883

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 81/126 (64%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV G++ EG   ++S  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVNGARIEG---DISAPVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYKR  462
            FHEV+R+RDRKKE++   KV++        + RK  E     +K + +     RRG Y R
Sbjct  58   FHEVRRKRDRKKESIEY-KVSL--------DSRKRSENVGQGMKFRPYPERGSRRGSYTR  108

Query  463  NALPGT  480
            N LPG 
Sbjct  109  NTLPGV  114



>ref|XP_009339841.1| PREDICTED: uncharacterized protein LOC103932015 isoform X3 [Pyrus 
x bretschneideri]
Length=848

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 86/160 (54%), Gaps = 37/160 (23%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +Q+ 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQEP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  426
            FH VKR+RD++KE      V+  + G    + R+ FE A    KS T             
Sbjct  61   FHIVKRKRDKRKE------VSSNSNGLVPVDARRHFESAGQGPKSNTSSDRPPSQNTTSD  114

Query  427  --------------HNNL----IRRGPYKRNALPGTGVSR  492
                          HN      +RRG Y R    GTG+SR
Sbjct  115  RPSSHSTFSDRPSSHNTFSDRNVRRGGYARGGSTGTGISR  154



>ref|XP_009339824.1| PREDICTED: uncharacterized protein LOC103932015 isoform X1 [Pyrus 
x bretschneideri]
Length=877

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 86/160 (54%), Gaps = 37/160 (23%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +Q+ 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQEP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  426
            FH VKR+RD++KE      V+  + G    + R+ FE A    KS T             
Sbjct  61   FHIVKRKRDKRKE------VSSNSNGLVPVDARRHFESAGQGPKSNTSSDRPPSQNTTSD  114

Query  427  --------------HNNL----IRRGPYKRNALPGTGVSR  492
                          HN      +RRG Y R    GTG+SR
Sbjct  115  RPSSHSTFSDRPSSHNTFSDRNVRRGGYARGGSTGTGISR  154



>ref|XP_009372373.1| PREDICTED: uncharacterized protein LOC103961534 isoform X1 [Pyrus 
x bretschneideri]
Length=900

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 7/108 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKT  426
            FH VKR+RD++KE      V+  + G++  ED R+ FE A    K  T
Sbjct  61   FHVVKRKRDKRKE------VSSNSNGHKVPEDARRHFESAGQGPKPNT  102



>ref|XP_007135474.1| hypothetical protein PHAVU_010G132600g [Phaseolus vulgaris]
 gb|ESW07468.1| hypothetical protein PHAVU_010G132600g [Phaseolus vulgaris]
Length=864

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 74/129 (57%), Gaps = 13/129 (10%)
 Frame = +1

Query  106  MVAGSKFEG--GTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV GS+ E   GT  LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPGSRTESATGTHLLSARVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL---IRRG  450
            D FHEVKRRRDRKKE         QN G     D +     N     K H      +RR 
Sbjct  61   DPFHEVKRRRDRKKEP--------QNVGNNGSADSRRPSENNSGQGVKFHTPSERNVRRA  112

Query  451  PYKRNALPG  477
             Y RN LPG
Sbjct  113  NYSRNTLPG  121



>gb|KHG27656.1| ATP-dependent zinc metalloprotease FtsH [Gossypium arboreum]
Length=853

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 84/131 (64%), Gaps = 15/131 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  459
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  460  RNALPGTGVSR  492
            RNALP   V+R
Sbjct  108  RNALPDARVNR  118



>ref|XP_004141213.1| PREDICTED: uncharacterized protein LOC101203238 [Cucumis sativus]
Length=740

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRVDGGTHVLPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  460  RNALPG  477
            +++ PG
Sbjct  111  KSSWPG  116



>ref|XP_008338694.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Malus 
domestica]
Length=876

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 85/160 (53%), Gaps = 37/160 (23%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  426
            FH VKR+RD++KE  +       + G    + R+ FE A     S T             
Sbjct  61   FHVVKRKRDKRKEVFS------NSNGQVPVDARRHFESAGQGPTSNTSSDRPPSQNTTSD  114

Query  427  ----HNNL--------------IRRGPYKRNALPGTGVSR  492
                H+                +RRG Y R +  GTG+SR
Sbjct  115  RPSSHSTFSDRPPYRNTFSDRNVRRGGYARGSSTGTGISR  154



>ref|XP_008338695.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Malus 
domestica]
Length=875

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 85/160 (53%), Gaps = 37/160 (23%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT-------------  426
            FH VKR+RD++KE  +       + G    + R+ FE A     S T             
Sbjct  61   FHVVKRKRDKRKEVFS------NSNGQVPVDARRHFESAGQGPTSNTSSDRPPSQNTTSD  114

Query  427  ----HNNL--------------IRRGPYKRNALPGTGVSR  492
                H+                +RRG Y R +  GTG+SR
Sbjct  115  RPSSHSTFSDRPPYRNTFSDRNVRRGGYARGSSTGTGISR  154



>ref|XP_008464007.1| PREDICTED: uncharacterized protein LOC103501996 isoform X2 [Cucumis 
melo]
Length=846

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRIDGGTHILPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  460  RNALPG  477
            +++ PG
Sbjct  111  KSSWPG  116



>ref|XP_008464006.1| PREDICTED: uncharacterized protein LOC103501996 isoform X1 [Cucumis 
melo]
Length=850

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRIDGGTHILPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  460  RNALPG  477
            +++ PG
Sbjct  111  KSSWPG  116



>ref|XP_011467415.1| PREDICTED: uncharacterized protein LOC101293990 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=913

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 18/128 (14%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGG Q +S GVR TI+T+KE+   HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGNQIISAGVRKTIQTIKEIVGNHSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKE---------ALNVPKVNIQNTGY---------RTEEDRKEFEPANLA  411
            FHEVKR+RD+KKE          L  P+ ++++ G          R  E ++ FE A   
Sbjct  61   FHEVKRKRDKKKEVPPKSIGQKVLTEPRRHVESAGQGPRSNTTSERVVEPKRHFETAVQG  120

Query  412  VKSKTHNN  435
             +S T+++
Sbjct  121  PRSNTNSD  128



>ref|XP_004303676.1| PREDICTED: uncharacterized protein LOC101293990 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=915

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 18/128 (14%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+ EGG Q +S GVR TI+T+KE+   HS+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVSGSRIEGGNQIISAGVRKTIQTIKEIVGNHSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKE---------ALNVPKVNIQNTGY---------RTEEDRKEFEPANLA  411
            FHEVKR+RD+KKE          L  P+ ++++ G          R  E ++ FE A   
Sbjct  61   FHEVKRKRDKKKEVPPKSIGQKVLTEPRRHVESAGQGPRSNTTSERVVEPKRHFETAVQG  120

Query  412  VKSKTHNN  435
             +S T+++
Sbjct  121  PRSNTNSD  128



>ref|XP_009372374.1| PREDICTED: uncharacterized protein LOC103961534 isoform X2 [Pyrus 
x bretschneideri]
Length=896

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 11/108 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKT  426
            FH VKR+RD++KE+           G++  ED R+ FE A    K  T
Sbjct  61   FHVVKRKRDKRKES----------NGHKVPEDARRHFESAGQGPKPNT  98



>ref|XP_004163891.1| PREDICTED: uncharacterized protein LOC101226902 [Cucumis sativus]
Length=846

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRVDGGTHVLPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  460  RNALPG  477
            +++ PG
Sbjct  111  KSSWPG  116



>gb|KGN59790.1| hypothetical protein Csa_3G846060 [Cucumis sativus]
Length=855

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G + +GGT  L   VR TI+++KE+   HS+ADIY TLKE+NMDPNET QKL +QD 
Sbjct  1    MVSGLRVDGGTHVLPARVRKTIQSIKEIVGNHSDADIYTTLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            F EVKRRRD+KKE          N GY+   D ++  E      K  T ++  +RRG Y 
Sbjct  61   FREVKRRRDKKKE----------NVGYKGSLDAQRNSEDVRQGTKVYTLSDRNVRRGAYA  110

Query  460  RNALPG  477
            +++ PG
Sbjct  111  KSSWPG  116



>ref|XP_010087685.1| hypothetical protein L484_013447 [Morus notabilis]
 gb|EXB29673.1| hypothetical protein L484_013447 [Morus notabilis]
Length=854

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 79/134 (59%), Gaps = 13/134 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+ S+ +GG Q LS GVR TI+++KE+   HS+ DIY  LKE+NMDPNET QKL +QD 
Sbjct  1    MVSASRIDGGPQILSAGVRKTIQSIKEIVGNHSDIDIYLALKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRN  465
            FHEV+R+RD+KKE+         N          E +     V + +  N  RRG Y RN
Sbjct  61   FHEVRRKRDKKKESAG-------NDSSTDPRGHSEVKGQGSKVNTFSDRN-ARRGGYARN  112

Query  466  ALPG-----TGVSR  492
            +LP       GVSR
Sbjct  113  SLPDRIMLHAGVSR  126



>ref|XP_010685333.1| PREDICTED: uncharacterized protein LOC104899768 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=796

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 81/130 (62%), Gaps = 11/130 (8%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV   K EGGTQ +S  V+ TI+++KE+   HS+++IY TL+ESNMDPNET QKL +QD 
Sbjct  1    MVTLLKTEGGTQIVSAKVQKTIQSIKEIVGNHSDSEIYNTLQESNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNLIRRGPYKR  462
            FHEV+RRRD+KKE          N GY    E RK  E  +  VK    +  + RG YKR
Sbjct  61   FHEVRRRRDKKKE----------NAGYNDHFEPRKRSEYTSQGVKLYGSDRNVHRGGYKR  110

Query  463  NALPGTGVSR  492
            + +   G+S+
Sbjct  111  SPVNDAGMSQ  120



>ref|XP_010685331.1| PREDICTED: uncharacterized protein LOC104899768 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=825

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 81/130 (62%), Gaps = 11/130 (8%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV   K EGGTQ +S  V+ TI+++KE+   HS+++IY TL+ESNMDPNET QKL +QD 
Sbjct  1    MVTLLKTEGGTQIVSAKVQKTIQSIKEIVGNHSDSEIYNTLQESNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNLIRRGPYKR  462
            FHEV+RRRD+KKE          N GY    E RK  E  +  VK    +  + RG YKR
Sbjct  61   FHEVRRRRDKKKE----------NAGYNDHFEPRKRSEYTSQGVKLYGSDRNVHRGGYKR  110

Query  463  NALPGTGVSR  492
            + +   G+S+
Sbjct  111  SPVNDAGMSQ  120



>gb|KJB70100.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=853

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 15/131 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  459
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  460  RNALPGTGVSR  492
            RN LP   V+R
Sbjct  108  RNTLPDARVNR  118



>gb|KJB70099.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=852

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 15/131 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  459
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  460  RNALPGTGVSR  492
            RN LP   V+R
Sbjct  108  RNTLPDARVNR  118



>gb|KJB70101.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=843

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 15/131 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  459
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  460  RNALPGTGVSR  492
            RN LP   V+R
Sbjct  108  RNTLPDARVNR  118



>gb|KJB70102.1| hypothetical protein B456_011G058000 [Gossypium raimondii]
Length=854

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 15/131 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+G++ EG   ++S  V  TI+++KE+   HS+ DIY  LKE+NMDPNET QKL HQDT
Sbjct  1    MVSGARTEG---HISARVSKTIQSIKEIVGNHSDDDIYVALKEANMDPNETAQKLLHQDT  57

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEF-EPANLAVKSKTHNNL-IRRGPYK  459
            FH V+R+RDRKKE++          GY+   D ++F E A   +K +T+     RRG Y 
Sbjct  58   FHLVRRKRDRKKESI----------GYQGSMDPRKFSENAGQVMKFRTYPERGSRRGGYS  107

Query  460  RNALPGTGVSR  492
            RN LP   V+R
Sbjct  108  RNTLPDARVNR  118



>ref|XP_006849609.1| hypothetical protein AMTR_s00024p00205340 [Amborella trichopoda]
 gb|ERN11190.1| hypothetical protein AMTR_s00024p00205340 [Amborella trichopoda]
Length=158

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 79/127 (62%), Gaps = 13/127 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV+G + E  T ++ P  V+ TI+++KE+   HS+  IY TLKESNMDPNET QKL +QD
Sbjct  1    MVSGPRAETETSDILPAKVQRTIQSIKEIVGNHSDEYIYVTLKESNMDPNETAQKLLNQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRT-EEDRKEFEPANLAVKSK-THNNLIRRGPY  456
             FHEVKR+RD+KKE+          T +++  E R+  EP    V++    +   RRG Y
Sbjct  61   PFHEVKRKRDKKKES----------TLHKSPPEIRRRPEPTGQVVRTHMVWDQNARRGGY  110

Query  457  KRNALPG  477
             RN LPG
Sbjct  111  ARNKLPG  117



>gb|KEH18456.1| plant/MDC16-11 protein [Medicago truncatula]
Length=1006

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 74/113 (65%), Gaps = 8/113 (7%)
 Frame = +1

Query  106  MVAGSKFEG----GTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLY  273
            MV  S+ EG    GT  LS  VR TI+++KE+   HSEADIY  LKE+NMDPNET QKL 
Sbjct  1    MVPASRTEGAGGTGTHLLSAKVRKTIQSIKEIVGNHSEADIYVALKETNMDPNETTQKLL  60

Query  274  HQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHN  432
            +QD FHEVKRRRDRKKE  N    N+ N G  + E R+  +  N   ++++HN
Sbjct  61   NQDPFHEVKRRRDRKKENQNHVNQNVGNRG--SSEPRRHSD--NGGQRAQSHN  109



>ref|XP_009339833.1| PREDICTED: uncharacterized protein LOC103932015 isoform X2 [Pyrus 
x bretschneideri]
Length=875

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 6/107 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +Q+ 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQEP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT  426
            FH VKR+RD++KE      V+  + G    + R+ FE A    KS T
Sbjct  61   FHIVKRKRDKRKE------VSSNSNGLVPVDARRHFESAGQGPKSNT  101



>ref|XP_010685332.1| PREDICTED: uncharacterized protein LOC104899768 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=823

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 11/125 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV   K EGGTQ +S  V+ TI+++KE+   HS+++IY TL+ESNMDPNET QKL +QD 
Sbjct  1    MVTLLKTEGGTQIVSAKVQKTIQSIKEIVGNHSDSEIYNTLQESNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTE-EDRKEFEPANLAVKSKTHNNLIRRGPYKR  462
            FHEV+RRRD+KKE          N GY    E RK  E  +  VK    +  + RG YKR
Sbjct  61   FHEVRRRRDKKKE----------NAGYNDHFEPRKRSEYTSQGVKLYGSDRNVHRGGYKR  110

Query  463  NALPG  477
            + + G
Sbjct  111  SPVNG  115



>ref|XP_008338696.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Malus 
domestica]
Length=874

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 6/110 (5%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDFDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNN  435
            FH VKR+RD++KE  +       + G    + R+ FE A     S T ++
Sbjct  61   FHVVKRKRDKRKEVFS------NSNGQVPVDARRHFESAGQGPTSNTSSD  104



>ref|XP_004510436.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=889

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 59/79 (75%), Gaps = 2/79 (3%)
 Frame = +1

Query  106  MVAGSKFEGGTQN--LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV  S+ EGGT    LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +Q
Sbjct  1    MVPSSRTEGGTGTHLLSAKVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNV  336
            D FHEVKRRRDRKKE  NV
Sbjct  61   DPFHEVKRRRDRKKENQNV  79



>ref|XP_008391371.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Malus 
domestica]
Length=898

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 7/108 (6%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKT  426
            FH VKR+RD++KE      V+  + G++   D R+  E A    K  T
Sbjct  61   FHVVKRKRDKRKE------VSSNSNGHKVSVDARRHSESAGQGPKPNT  102



>ref|XP_008391372.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X2 [Malus 
domestica]
Length=894

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MVAGS+ EGGTQ +S GVR TI+++KE+   +S+ DIY  LKE++MDPNET QKL +QD 
Sbjct  1    MVAGSRIEGGTQIISAGVRKTIQSIKEIVGNYSDIDIYWALKETDMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEA  327
            FH VKR+RD++KE+
Sbjct  61   FHVVKRKRDKRKES  74



>gb|KHN39644.1| hypothetical protein glysoja_020722 [Glycine soja]
Length=860

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = +1

Query  106  MVAGSKFEGGTQN----LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLY  273
            MV GSK EGG       LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL 
Sbjct  1    MVPGSKTEGGGTGTTHLLSARVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLL  60

Query  274  HQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE-PANLAVKSKTHNNL-IRR  447
            +QD FHEVKRRRDRKKE  NV      N G  + + R+  E  +   +K  TH+   +RR
Sbjct  61   NQDPFHEVKRRRDRKKETQNV-----GNRGQPSADSRRPSENNSGQGMKFHTHSERNVRR  115

Query  448  GPYKRNALPG  477
              Y R+  PG
Sbjct  116  TNYSRSTFPG  125



>ref|XP_006598817.1| PREDICTED: putative uncharacterized protein DDB_G0277255-like 
[Glycine max]
Length=852

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = +1

Query  106  MVAGSKFEGGTQN----LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLY  273
            MV GSK EGG       LS  VR TI+++KE+   HS+ADIY  LKE+NMDPNET QKL 
Sbjct  1    MVPGSKTEGGGTGTTHLLSARVRKTIQSIKEIVGNHSDADIYVALKEANMDPNETTQKLL  60

Query  274  HQDTFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFE-PANLAVKSKTHNNL-IRR  447
            +QD FHEVKRRRDRKKE  NV      N G  + + R+  E  +   +K  TH+   +RR
Sbjct  61   NQDPFHEVKRRRDRKKETQNV-----GNRGQPSADSRRPSENNSGQGMKFHTHSERNVRR  115

Query  448  GPYKRNALPG  477
              Y R+  PG
Sbjct  116  TNYSRSTFPG  125



>ref|XP_009391448.1| PREDICTED: uncharacterized protein LOC103977608 [Musa acuminata 
subsp. malaccensis]
Length=857

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 12/125 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV GS  +GG Q +   ++ TI+++KE+   HS+ADIYA LKE+NMDPNET QKL +QD 
Sbjct  1    MVMGSGVDGGGQVVPLRIQKTIQSIKEIVGNHSDADIYAVLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTH-NNLIRRGPYK  459
            FHEVKR+RDRKKE           TGYR   D R+  EP     K  T  +  + +G Y 
Sbjct  61   FHEVKRKRDRKKEP----------TGYRGLADTRRHVEPNVQWAKPLTSWDQNMHKGDYT  110

Query  460  RNALP  474
            RN++P
Sbjct  111  RNSVP  115



>ref|XP_011072651.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157853 
[Sesamum indicum]
Length=859

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 72/113 (64%), Gaps = 14/113 (12%)
 Frame = +1

Query  166  TIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNVPKV  345
            TI+++KE+   HS+ADIY  LKE+NMDPNET QKL +QD FHEVKR+RDRKKE       
Sbjct  27   TIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLNQDPFHEVKRKRDRKKE-------  79

Query  346  NIQNTGYR---TEEDRKEFEPANLAVKSKTHNNL-IRRGPYKRNALPGTGVSR  492
               N+GY+     E RK  E A + VK+ T+++   RRG   RN    TG SR
Sbjct  80   ---NSGYKNYVAAEPRKNTELARMPVKNSTYSDRNSRRGGSGRNIASDTGASR  129



>ref|XP_010917132.1| PREDICTED: uncharacterized protein LOC105041803 isoform X1 [Elaeis 
guineensis]
Length=861

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 12/129 (9%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV GS+ +G +Q +S  +R TI+++KE+    S+ DIYA LKE+NMDPNET QKL +QD 
Sbjct  1    MVLGSRLDGESQIVSVPIRKTIQSIKEIVGNQSDTDIYAMLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FHEVKR+RD+KKE          +TGY+   D  K  E      KS T  +   RRG + 
Sbjct  61   FHEVKRKRDKKKE----------HTGYKGSGDTNKRIEHNVQWTKSHTSGDRNARRGGFT  110

Query  460  RNALPGTGV  486
            R   P  G+
Sbjct  111  RKPAPDAGI  119



>ref|XP_010917133.1| PREDICTED: uncharacterized protein LOC105041803 isoform X2 [Elaeis 
guineensis]
Length=859

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 76/126 (60%), Gaps = 12/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV GS+ +G +Q +S  +R TI+++KE+    S+ DIYA LKE+NMDPNET QKL +QD 
Sbjct  1    MVLGSRLDGESQIVSVPIRKTIQSIKEIVGNQSDTDIYAMLKETNMDPNETAQKLLNQDP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYK  459
            FHEVKR+RD+KKE          +TGY+   D  K  E      KS T  +   RRG + 
Sbjct  61   FHEVKRKRDKKKE----------HTGYKGSGDTNKRIEHNVQWTKSHTSGDRNARRGGFT  110

Query  460  RNALPG  477
            R   PG
Sbjct  111  RKPAPG  116



>gb|KDP40717.1| hypothetical protein JCGZ_24716 [Jatropha curcas]
Length=866

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 78/124 (63%), Gaps = 17/124 (14%)
 Frame = +1

Query  136  TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDR  315
            T  LS  VR TI+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEV+R+RD+
Sbjct  20   THTLSARVRKTIQSIKEIVGNFSDADIYMALKETNMDPNETAQKLLNQDPFHEVRRKRDK  79

Query  316  KKEALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKT---HNNLIRRGPYKRNALPG-T  480
            KKE++          GYR   D RK  E  NL   +KT    +   R+G Y RNA+PG  
Sbjct  80   KKESM----------GYRVAVDSRKNSE--NLGQGAKTRIFSDRNARQGGYMRNAVPGNA  127

Query  481  GVSR  492
            G++R
Sbjct  128  GMNR  131



>ref|XP_010932459.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Elaeis guineensis]
Length=861

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 10/95 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV GS+ +GG+Q +S  +R TI+++KE+   HS++DIYA L+E+NMDPNET Q L +Q  
Sbjct  1    MVLGSRLDGGSQIVSVRIRKTIQSIKEIVGDHSDSDIYAMLQETNMDPNETAQNLLNQGP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE  390
            FHEVKRRRD++KE          +TGY    D K+
Sbjct  61   FHEVKRRRDKRKE----------HTGYGGSGDTKK  85



>ref|XP_006296970.1| hypothetical protein CARUB_v10012965mg [Capsella rubella]
 gb|EOA29868.1| hypothetical protein CARUB_v10012965mg [Capsella rubella]
Length=850

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 70/131 (53%), Gaps = 11/131 (8%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMDP+E  QKL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDPDEAVQKLIHQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPYK  459
             FHEVKR+RDRKKE   V               +K  E     VK +T     +RRG Y 
Sbjct  61   PFHEVKRKRDRKKEDTVV---------VEPANRKKPLESVTSEVKVRTQPEYNVRRGGYH  111

Query  460  RNALPGTGVSR  492
            RN +P     R
Sbjct  112  RNFVPRNAAQR  122



>emb|CAN69468.1| hypothetical protein VITISV_042555 [Vitis vinifera]
Length=914

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 76/157 (48%), Gaps = 50/157 (32%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETF--------  261
            M   S+ EGG Q L P V  TI+ +KE+   HS+ADIY  L+E NMDPNET         
Sbjct  1    MAFDSRMEGGMQILPPQVHKTIQLIKEIVGNHSDADIYVALREMNMDPNETVQKLLNQDL  60

Query  262  -----------------QKLYHQDTFHEVKRRRDRKKEALNV-----PKVNIQNTG---Y  366
                             QKL +QD FHEVKR+RD+KKE+        P++ I+N G   +
Sbjct  61   DIHVMLREMNMDPNEVAQKLLNQDPFHEVKRKRDKKKESTGYKRPTEPRIYIENVGQGKF  120

Query  367  RTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRNALPG  477
            R+  DR                  +RRG Y R+ +PG
Sbjct  121  RSFPDRN-----------------VRRGGYSRSTVPG  140



>ref|XP_009117284.1| PREDICTED: uncharacterized protein LOC103842413 isoform X1 [Brassica 
rapa]
Length=871

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 67/110 (61%), Gaps = 16/110 (15%)
 Frame = +1

Query  160  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE-ALNV  336
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKKE A+ V
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  337  PKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPYKRNALPG  477
               N+          +K  E     VK +T   HN  +RRG Y RNA PG
Sbjct  82   EPANV----------KKPLESVTSEVKVRTQPEHN--VRRGGYSRNAFPG  119



>ref|XP_009117292.1| PREDICTED: uncharacterized protein LOC103842413 isoform X2 [Brassica 
rapa]
Length=862

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 67/110 (61%), Gaps = 16/110 (15%)
 Frame = +1

Query  160  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE-ALNV  336
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKKE A+ V
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  337  PKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPYKRNALPG  477
               N+          +K  E     VK +T   HN  +RRG Y RNA PG
Sbjct  82   EPANV----------KKPLESVTSEVKVRTQPEHN--VRRGGYSRNAFPG  119



>ref|XP_002521347.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41015.1| conserved hypothetical protein [Ricinus communis]
Length=864

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 74/119 (62%), Gaps = 13/119 (11%)
 Frame = +1

Query  145  LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            LS  VR TI+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEVKR+RD+KKE
Sbjct  21   LSATVRKTIQSIKEIVGNFSDADIYMALKETNMDPNETAQKLLNQDPFHEVKRKRDKKKE  80

Query  325  ALNVPKVNIQNTGYRTEED-RKEFEPANLAVKSKTHNNL-IRRGPYKRNALPG-TGVSR  492
            ++           YR   D RK  E      K +T ++   R+G Y R A+PG  G++R
Sbjct  81   SM----------AYRGSLDSRKNPENMGQGTKFRTFSDRNTRQGGYIRAAVPGNAGINR  129



>ref|XP_002445374.1| hypothetical protein SORBIDRAFT_07g013800 [Sorghum bicolor]
 gb|EES14869.1| hypothetical protein SORBIDRAFT_07g013800 [Sorghum bicolor]
Length=70

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R T+  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTVADIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLEDTFHEVKRKR  63

Query  310  DRKKE  324
            D+KKE
Sbjct  64   DKKKE  68



>ref|XP_010465276.1| PREDICTED: uncharacterized protein LOC104745669 isoform X1 [Camelina 
sativa]
Length=853

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 72/132 (55%), Gaps = 13/132 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKEDTVPVEPANI----------KKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  457  KRNALPGTGVSR  492
             RN  P   V R
Sbjct  111  NRNFFPRNAVQR  122



>ref|XP_010465278.1| PREDICTED: uncharacterized protein LOC104745669 isoform X3 [Camelina 
sativa]
Length=852

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 72/132 (55%), Gaps = 13/132 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKEDTVPVEPANI----------KKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  457  KRNALPGTGVSR  492
             RN  P   V R
Sbjct  111  NRNFFPRNAVQR  122



>ref|XP_010465277.1| PREDICTED: uncharacterized protein LOC104745669 isoform X2 [Camelina 
sativa]
Length=852

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 72/132 (55%), Gaps = 13/132 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKEDTVPVEPANI----------KKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  457  KRNALPGTGVSR  492
             RN  P   V R
Sbjct  111  NRNFFPRNAVQR  122



>ref|XP_010542407.1| PREDICTED: uncharacterized protein LOC104815628 isoform X3 [Tarenaya 
hassleriana]
Length=860

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  106  MVAGSKFEGGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV+GS+  G +   +  GVR TI++++EV   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MVSGSRTGGSSATGIDEGVRKTIKSIQEVLGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  283  TFHEVKRRRDRKKE  324
            TFHEVKRRRDRKKE
Sbjct  61   TFHEVKRRRDRKKE  74



>ref|XP_010542406.1| PREDICTED: uncharacterized protein LOC104815628 isoform X2 [Tarenaya 
hassleriana]
Length=860

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  106  MVAGSKFEGGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV+GS+  G +   +  GVR TI++++EV   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MVSGSRTGGSSATGIDEGVRKTIKSIQEVLGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  283  TFHEVKRRRDRKKE  324
            TFHEVKRRRDRKKE
Sbjct  61   TFHEVKRRRDRKKE  74



>ref|XP_010542405.1| PREDICTED: uncharacterized protein LOC104815628 isoform X1 [Tarenaya 
hassleriana]
Length=861

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  106  MVAGSKFEGGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV+GS+  G +   +  GVR TI++++EV   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MVSGSRTGGSSATGIDEGVRKTIKSIQEVLGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  283  TFHEVKRRRDRKKE  324
            TFHEVKRRRDRKKE
Sbjct  61   TFHEVKRRRDRKKE  74



>ref|XP_008784271.1| PREDICTED: uncharacterized protein LOC103703266 isoform X2 [Phoenix 
dactylifera]
Length=861

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 56/132 (42%), Positives = 81/132 (61%), Gaps = 16/132 (12%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV GS+ +GG+Q +S  +R TI+++KE+   HS++DIYA L+E+NMDPNET QKL +Q  
Sbjct  1    MVLGSRLDGGSQIVSVRIRKTIQSIKEIVGDHSDSDIYAMLQETNMDPNETAQKLLNQGP  60

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPYKRN  465
            FHEVKR+RD++KE          +TGY    D K     N+   +K+H +  R    +R+
Sbjct  61   FHEVKRKRDKRKE----------HTGYMGSGDTKTSVEHNVQW-TKSHASWDRNA--RRD  107

Query  466  ALPGT---GVSR  492
               G    G+SR
Sbjct  108  GFTGKLAPGISR  119



>emb|CDY33258.1| BnaC01g37310D [Brassica napus]
Length=871

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 66/109 (61%), Gaps = 16/109 (15%)
 Frame = +1

Query  160  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE-ALNV  336
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKKE A+ V
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  337  PKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPYKRNALP  474
               N+          +K  E A   VK +T   HN  +RRG Y RN  P
Sbjct  82   EPANV----------KKPLESATSEVKVRTQPEHN--VRRGGYSRNIFP  118



>emb|CDY39087.1| BnaA01g29690D [Brassica napus]
Length=873

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 66/109 (61%), Gaps = 16/109 (15%)
 Frame = +1

Query  160  RMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE-ALNV  336
            R  IE++KE+   HS+ADIY  LKES+M+ +E  QKL HQD FHEVKRR+DRKKE A+ V
Sbjct  22   RKVIESIKEIVGNHSDADIYTALKESDMNADEAVQKLIHQDPFHEVKRRKDRKKEDAVLV  81

Query  337  PKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPYKRNALP  474
               N+          +K  E     VK +T   HN  +RRG Y RNA P
Sbjct  82   EPANV----------KKPLESVTSEVKIRTQPEHN--VRRGGYSRNAFP  118



>ref|XP_009146426.1| PREDICTED: uncharacterized protein LOC103870075 isoform X4 [Brassica 
rapa]
Length=892

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 73/132 (55%), Gaps = 15/132 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPY  456
            FH VKRRRDRKKE   +             +++K  E     V  +T   HN   RRG Y
Sbjct  60   FHVVKRRRDRKKEVAVL---------VEPADEKKPLESVTSEVNVRTQPEHN--ARRGGY  108

Query  457  KRNALPGTGVSR  492
             RN  P     R
Sbjct  109  SRNVFPRNAAPR  120



>ref|XP_009146423.1| PREDICTED: uncharacterized protein LOC103870075 isoform X1 [Brassica 
rapa]
Length=903

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 73/132 (55%), Gaps = 15/132 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPY  456
            FH VKRRRDRKKE   +             +++K  E     V  +T   HN   RRG Y
Sbjct  60   FHVVKRRRDRKKEVAVL---------VEPADEKKPLESVTSEVNVRTQPEHN--ARRGGY  108

Query  457  KRNALPGTGVSR  492
             RN  P     R
Sbjct  109  SRNVFPRNAAPR  120



>ref|XP_009146425.1| PREDICTED: uncharacterized protein LOC103870075 isoform X3 [Brassica 
rapa]
Length=902

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 73/132 (55%), Gaps = 15/132 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPY  456
            FH VKRRRDRKKE   +             +++K  E     V  +T   HN   RRG Y
Sbjct  60   FHVVKRRRDRKKEVAVL---------VEPADEKKPLESVTSEVNVRTQPEHN--ARRGGY  108

Query  457  KRNALPGTGVSR  492
             RN  P     R
Sbjct  109  SRNVFPRNAAPR  120



>ref|XP_009146424.1| PREDICTED: uncharacterized protein LOC103870075 isoform X2 [Brassica 
rapa]
Length=902

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 73/132 (55%), Gaps = 15/132 (11%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPY  456
            FH VKRRRDRKKE   +             +++K  E     V  +T   HN   RRG Y
Sbjct  60   FHVVKRRRDRKKEVAVL---------VEPADEKKPLESVTSEVNVRTQPEHN--ARRGGY  108

Query  457  KRNALPGTGVSR  492
             RN  P     R
Sbjct  109  SRNVFPRNAAPR  120



>dbj|BAB02329.1| unnamed protein product [Arabidopsis thaliana]
Length=870

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 72/134 (54%), Gaps = 17/134 (13%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L    +  I+++KEV   HS+ADIY  LKE+NMD NE  +KL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDEAKKMIQSIKEVVDSHSDADIYTALKEANMDANEAVEKLIHQD  60

Query  283  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  450
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEDTVFVEPANI----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  451  PYKRNALPGTGVSR  492
             Y RN  P     R
Sbjct  109  GYSRNFFPRNAAQR  122



>emb|CDX97535.1| BnaA05g25440D [Brassica napus]
Length=863

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (59%), Gaps = 15/123 (12%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+  GG + +  G R  IE+++E+   H++ADIYA LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDGDRKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDP  59

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPY  456
            FHEVKRRRDRKKE   +             +++K  E     V  +T   HN   RRG Y
Sbjct  60   FHEVKRRRDRKKEVAVL---------VEPADEKKPLESVTSEVNVRTQPEHN--ARRGGY  108

Query  457  KRN  465
             RN
Sbjct  109  SRN  111



>ref|NP_001078149.1| kinase-related protein [Arabidopsis thaliana]
 dbj|BAE99198.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75449.1| uncharacterized protein AT3G13990 [Arabidopsis thaliana]
Length=847

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 72/134 (54%), Gaps = 17/134 (13%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L    +  I+++KEV   HS+ADIY  LKE+NMD NE  +KL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDEAKKMIQSIKEVVDSHSDADIYTALKEANMDANEAVEKLIHQD  60

Query  283  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  450
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEDTVFVEPANI----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  451  PYKRNALPGTGVSR  492
             Y RN  P     R
Sbjct  109  GYSRNFFPRNAAQR  122



>ref|NP_188015.2| kinase-related protein [Arabidopsis thaliana]
 gb|AAM83252.1| AT3g13990/MDC16_11 [Arabidopsis thaliana]
 gb|AAN18205.1| At3g13990/MDC16_11 [Arabidopsis thaliana]
 gb|AEE75448.1| uncharacterized protein AT3G13990 [Arabidopsis thaliana]
Length=848

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 72/134 (54%), Gaps = 17/134 (13%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L    +  I+++KEV   HS+ADIY  LKE+NMD NE  +KL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDEAKKMIQSIKEVVDSHSDADIYTALKEANMDANEAVEKLIHQD  60

Query  283  TFHEVKRRRDRKKE-ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  450
             FHEVKR+RDRKKE  + V   NI          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEDTVFVEPANI----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  451  PYKRNALPGTGVSR  492
             Y RN  P     R
Sbjct  109  GYSRNFFPRNAAQR  122



>gb|AES98495.2| MLP3.11 protein [Medicago truncatula]
Length=868

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +1

Query  109  VAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTF  288
            ++GS F+    N    V+ TI+ +KE+   HS+ DIYA LKE +MDPNET QKL  QDTF
Sbjct  1    MSGSGFKASIPN---SVKKTIQNIKEITGNHSDEDIYAMLKECSMDPNETTQKLLLQDTF  57

Query  289  HEVKRRRDRKKEALN  333
            HEVKR++DRKKE LN
Sbjct  58   HEVKRKKDRKKEILN  72



>ref|XP_003615537.1| hypothetical protein MTR_5g069290 [Medicago truncatula]
Length=924

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +1

Query  109  VAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTF  288
            ++GS F+    N    V+ TI+ +KE+   HS+ DIYA LKE +MDPNET QKL  QDTF
Sbjct  1    MSGSGFKASIPN---SVKKTIQNIKEITGNHSDEDIYAMLKECSMDPNETTQKLLLQDTF  57

Query  289  HEVKRRRDRKKEALN  333
            HEVKR++DRKKE LN
Sbjct  58   HEVKRKKDRKKEILN  72



>ref|XP_010487182.1| PREDICTED: uncharacterized protein LOC104765203 isoform X1 [Camelina 
sativa]
Length=855

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 72/132 (55%), Gaps = 13/132 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE          +T      DRK+  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  457  KRNALPGTGVSR  492
             RN  P   V R
Sbjct  111  NRNFFPRNAVQR  122



>ref|XP_010487183.1| PREDICTED: uncharacterized protein LOC104765203 isoform X2 [Camelina 
sativa]
Length=854

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 72/132 (55%), Gaps = 13/132 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE          +T      DRK+  E     VK +T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVRTQPEYNVRRGGY  110

Query  457  KRNALPGTGVSR  492
             RN  P   V R
Sbjct  111  NRNFFPRNAVQR  122



>ref|XP_010534929.1| PREDICTED: uncharacterized protein LOC104810364 isoform X1 [Tarenaya 
hassleriana]
Length=836

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 73/126 (58%), Gaps = 16/126 (13%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            M +GS+  G     +  GVR TI+++KE+   HS+ADIYA LKE+NMD +ET Q+L  QD
Sbjct  1    MASGSRTSGNPAAGIDDGVRKTIQSIKEIVGNHSDADIYAALKEANMDADETAQRLLLQD  60

Query  283  TFHEVKRRRDRKKE--ALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRRGPY  456
             FHEVKRRR+RKKE    + P    +++   T E + + +P             +RRG Y
Sbjct  61   PFHEVKRRRERKKEDAVFDRPVSGEKSSDDVTREVKFQVQP-------------VRRGGY  107

Query  457  KRNALP  474
             R+  P
Sbjct  108  SRSYFP  113



>gb|EEE65290.1| hypothetical protein OsJ_20522 [Oryza sativa Japonica Group]
Length=861

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN-  333
            ++ TI+++KEV  GHS+ADIYA L+E NMDPNET QKL +QD FHEVKR+RD+K+E+   
Sbjct  22   IQSTIQSIKEVVGGHSDADIYAALRECNMDPNETTQKLLNQDPFHEVKRKRDKKRESAGQ  81

Query  334  --VPKVNIQ  354
              VP  + Q
Sbjct  82   KTVPDASAQ  90



>gb|EEC80202.1| hypothetical protein OsI_22088 [Oryza sativa Indica Group]
Length=861

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN-  333
            ++ TI+++KEV  GHS+ADIYA L+E NMDPNET QKL +QD FHEVKR+RD+K+E+   
Sbjct  22   IQSTIQSIKEVVGGHSDADIYAALRECNMDPNETTQKLLNQDPFHEVKRKRDKKRESAGQ  81

Query  334  --VPKVNIQ  354
              VP  + Q
Sbjct  82   KTVPDASAQ  90



>ref|NP_001057094.1| Os06g0206100 [Oryza sativa Japonica Group]
 dbj|BAD35846.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAD36202.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAF19008.1| Os06g0206100 [Oryza sativa Japonica Group]
 dbj|BAH00409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=854

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN-  333
            ++ TI+++KEV  GHS+ADIYA L+E NMDPNET QKL +QD FHEVKR+RD+K+E+   
Sbjct  22   IQSTIQSIKEVVGGHSDADIYAALRECNMDPNETTQKLLNQDPFHEVKRKRDKKRESAGQ  81

Query  334  --VPKVNIQ  354
              VP  + Q
Sbjct  82   KTVPDASAQ  90



>ref|XP_010227879.1| PREDICTED: uncharacterized protein LOC100833454 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  148  SPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            +P +  TI+++KEV  GHS+ADIY  L+ESNMDPNET QKL +QD FHEVKR+RD+K+E+
Sbjct  21   APTIHSTIQSIKEVVGGHSDADIYDALRESNMDPNETAQKLLNQDPFHEVKRKRDKKRES  80



>ref|XP_010227878.1| PREDICTED: uncharacterized protein LOC100833454 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  148  SPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            +P +  TI+++KEV  GHS+ADIY  L+ESNMDPNET QKL +QD FHEVKR+RD+K+E+
Sbjct  21   APTIHSTIQSIKEVVGGHSDADIYDALRESNMDPNETAQKLLNQDPFHEVKRKRDKKRES  80



>ref|XP_010088349.1| hypothetical protein L484_004857 [Morus notabilis]
 gb|EXB34467.1| hypothetical protein L484_004857 [Morus notabilis]
Length=651

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ LKE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR+KE +N
Sbjct  14   VRKTIQNLKEIAGNHSDDEIYAMLKECSMDPNETAQKLLLQDTFHEVKRKRDRRKENVN  72



>ref|XP_009765586.1| PREDICTED: mucin-5AC-like [Nicotiana sylvestris]
Length=500

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_003544279.1| PREDICTED: cell wall protein AWA1-like [Glycine max]
Length=878

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE DIYA LKE +MDPNET QKL  QDTFHEVKR++DR+KE LN
Sbjct  14   VRRTIQNIKEITGNHSEEDIYAMLKECSMDPNETTQKLLLQDTFHEVKRKKDRRKENLN  72



>emb|CDP14411.1| unnamed protein product [Coffea canephora]
Length=867

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR  I+++KE+   HSE DIYA LKE +MDPNET QKL  QDTFHEV+R+RDRKKE LN
Sbjct  27   VRKIIQSIKEITGNHSEEDIYAMLKECSMDPNETTQKLLLQDTFHEVRRKRDRKKENLN  85



>ref|XP_009610071.1| PREDICTED: uncharacterized protein LOC104103838 isoform X4 [Nicotiana 
tomentosiformis]
Length=888

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_002885002.1| hypothetical protein ARALYDRAFT_478805 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61261.1| hypothetical protein ARALYDRAFT_478805 [Arabidopsis lyrata subsp. 
lyrata]
Length=852

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 71/128 (55%), Gaps = 17/128 (13%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L    +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL HQD
Sbjct  1    MVTGSRTSGNRGVGLDDESKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIHQD  60

Query  283  TFHEVKRRRDRKKEA-LNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRG  450
             FHEVKR+RDRKKE  + V   N+          +K  E     VK +T   HN  +RRG
Sbjct  61   PFHEVKRKRDRKKEGTVFVEPANV----------KKPLENVTSEVKVRTQPEHN--VRRG  108

Query  451  PYKRNALP  474
             Y RN  P
Sbjct  109  GYSRNFFP  116



>ref|XP_009610070.1| PREDICTED: uncharacterized protein LOC104103838 isoform X3 [Nicotiana 
tomentosiformis]
Length=889

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_009610068.1| PREDICTED: uncharacterized protein LOC104103838 isoform X1 [Nicotiana 
tomentosiformis]
Length=893

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_009610069.1| PREDICTED: uncharacterized protein LOC104103838 isoform X2 [Nicotiana 
tomentosiformis]
Length=892

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDR++E LN
Sbjct  22   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRRRENLN  80



>ref|XP_002301574.2| hypothetical protein POPTR_0002s22320g [Populus trichocarpa]
 gb|EEE80847.2| hypothetical protein POPTR_0002s22320g [Populus trichocarpa]
Length=886

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +1

Query  130  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  306
            GG +   PG VR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL +QD FHEVKR+
Sbjct  4    GGVRVSIPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLYQDPFHEVKRK  63

Query  307  RDRKKEALN  333
            RDRKKE +N
Sbjct  64   RDRKKENMN  72



>gb|KHN46209.1| hypothetical protein glysoja_039933 [Glycine soja]
Length=884

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE D+YA LKE +MDPNET QKL  QDTFHEVKR++DR+KE LN
Sbjct  14   VRRTIQNIKEITGNHSEEDVYAMLKECSMDPNETTQKLLLQDTFHEVKRKKDRRKENLN  72



>ref|XP_006575395.1| PREDICTED: cell wall protein AWA1-like [Glycine max]
Length=884

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE D+YA LKE +MDPNET QKL  QDTFHEVKR++DR+KE LN
Sbjct  14   VRRTIQNIKEITGNHSEEDVYAMLKECSMDPNETTQKLLLQDTFHEVKRKKDRRKENLN  72



>ref|XP_004964933.1| PREDICTED: uncharacterized protein LOC101755132 isoform X1 [Setaria 
italica]
Length=852

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  26   IQSTIQSIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_004964934.1| PREDICTED: uncharacterized protein LOC101755132 isoform X2 [Setaria 
italica]
Length=847

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  26   IQSTIQSIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_009589264.1| PREDICTED: protein PRRC2B-like isoform X6 [Nicotiana tomentosiformis]
Length=887

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_009589263.1| PREDICTED: protein PRRC2B-like isoform X5 [Nicotiana tomentosiformis]
Length=889

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_010501500.1| PREDICTED: uncharacterized protein LOC104778757 isoform X1 [Camelina 
sativa]
Length=852

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE          +T      DRK+  E     VK  T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVHTQPEYNVRRGGY  110

Query  457  KRNALP  474
             RN +P
Sbjct  111  NRNFVP  116



>gb|EPS69701.1| hypothetical protein M569_05071, partial [Genlisea aurea]
Length=120

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +1

Query  82   LLRSHSGEMVAGSKFEGGTQNLSPGVRMTIETLKEV-AKGHSEADIYATLKESNMDPNET  258
            L R    +M +G K      ++  GV+ TIE +KE+    HSE +IYA LKE  MDPNET
Sbjct  5    LFRGLLKKMNSGVKGSTTRVSIPIGVKKTIENIKEITGNNHSEDEIYAMLKECAMDPNET  64

Query  259  FQKLYHQDTFHEVKRRRDRKKEALN  333
              KL H DTFHEVKR+RDRKKE  N
Sbjct  65   TDKLLHLDTFHEVKRKRDRKKENPN  89



>ref|XP_010501510.1| PREDICTED: uncharacterized protein LOC104778757 isoform X3 [Camelina 
sativa]
Length=851

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE          +T      DRK+  E     VK  T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVHTQPEYNVRRGGY  110

Query  457  KRNALP  474
             RN +P
Sbjct  111  NRNFVP  116



>ref|XP_010501505.1| PREDICTED: uncharacterized protein LOC104778757 isoform X2 [Camelina 
sativa]
Length=851

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE          +T      DRK+  E     VK  T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVHTQPEYNVRRGGY  110

Query  457  KRNALP  474
             RN +P
Sbjct  111  NRNFVP  116



>ref|XP_010501517.1| PREDICTED: uncharacterized protein LOC104778757 isoform X4 [Camelina 
sativa]
Length=852

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE          +T      DRK+  E     VK  T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVHTQPEYNVRRGGY  110

Query  457  KRNALP  474
             RN +P
Sbjct  111  NRNFVP  116



>ref|XP_009589259.1| PREDICTED: protein PRRC2B-like isoform X1 [Nicotiana tomentosiformis]
Length=908

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_008658957.1| PREDICTED: uncharacterized protein LOC100501220 isoform X2 [Zea 
mays]
 gb|AFW85391.1| putative DUF1296 domain containing family protein [Zea mays]
Length=852

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_010501523.1| PREDICTED: uncharacterized protein LOC104778757 isoform X5 [Camelina 
sativa]
Length=851

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = +1

Query  106  MVAGSKFEGG-TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            MV GS+  G     L  G +  I+++KE+   HS+ADIY  LKE+NMD +E  QKL +QD
Sbjct  1    MVTGSRTSGNRGVGLDDGAKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIYQD  60

Query  283  TFHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKE-FEPANLAVKSKTHNNL-IRRGPY  456
             FHEVKR+RDRKKE          +T      DRK+  E     VK  T     +RRG Y
Sbjct  61   PFHEVKRKRDRKKE----------DTVLVEPADRKKPLENVTSEVKVHTQPEYNVRRGGY  110

Query  457  KRNALP  474
             RN +P
Sbjct  111  NRNFVP  116



>ref|XP_009589260.1| PREDICTED: uncharacterized protein LOC104086650 isoform X2 [Nicotiana 
tomentosiformis]
Length=907

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_004490553.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=882

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ ++E+   HS+ DIYA LKE +MDPNET QKL  QDTFHEVKR+RDR+KE LN
Sbjct  15   VRKTIQNIREITGNHSDEDIYAMLKECSMDPNETAQKLLLQDTFHEVKRKRDRRKENLN  73



>ref|XP_008658956.1| PREDICTED: uncharacterized protein LOC100501220 isoform X1 [Zea 
mays]
Length=853

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>gb|AFW85392.1| putative DUF1296 domain containing family protein [Zea mays]
Length=830

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_008658959.1| PREDICTED: uncharacterized protein LOC100501220 isoform X4 [Zea 
mays]
Length=851

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_008658958.1| PREDICTED: uncharacterized protein LOC100501220 isoform X3 [Zea 
mays]
Length=852

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_009589262.1| PREDICTED: uncharacterized protein LOC104086650 isoform X4 [Nicotiana 
tomentosiformis]
Length=900

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|NP_001168331.1| uncharacterized protein LOC100382099 [Zea mays]
 gb|ACN27843.1| unknown [Zea mays]
Length=857

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  31   IQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  87



>ref|XP_008648067.1| PREDICTED: uncharacterized protein LOC100382099 isoform X1 [Zea 
mays]
 gb|AFW76656.1| putative DUF1296 domain containing family protein [Zea mays]
Length=858

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  31   IQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  87



>ref|XP_009782966.1| PREDICTED: uncharacterized protein LOC104231636 isoform X2 [Nicotiana 
sylvestris]
Length=884

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_009782965.1| PREDICTED: uncharacterized protein LOC104231636 isoform X1 [Nicotiana 
sylvestris]
Length=885

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>ref|XP_009782968.1| PREDICTED: uncharacterized protein LOC104231636 isoform X4 [Nicotiana 
sylvestris]
Length=877

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE  N
Sbjct  25   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKELQN  83



>gb|AFW85393.1| putative DUF1296 domain containing family protein [Zea mays]
Length=625

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_009589261.1| PREDICTED: protein PRRC2B-like isoform X3 [Nicotiana tomentosiformis]
Length=902

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE
Sbjct  25   VRKTIQDIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKE  80



>ref|XP_008229782.1| PREDICTED: putative GPI-anchored protein PB15E9.01c isoform X2 
[Prunus mume]
Length=874

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_008229781.1| PREDICTED: cell wall protein AWA1 isoform X1 [Prunus mume]
Length=875

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_007214926.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
 gb|EMJ16125.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
Length=873

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKENLN  72



>gb|AAT08008.1| unknown [Zea mays]
 gb|AFW85394.1| putative DUF1296 domain containing family protein [Zea mays]
Length=942

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
             ++ TI+++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  25   AIQSTIQSIKEVVVGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  82



>ref|XP_006656745.1| PREDICTED: uncharacterized protein LOC102709938, partial [Oryza 
brachyantha]
Length=1028

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  336
            ++ TI+++KEV  GHS+ADIYA L+E  MDPNET Q+L +QD FHEVKR+RD+K+E+   
Sbjct  5    IQSTIQSIKEVVGGHSDADIYAALRECGMDPNETTQRLLNQDPFHEVKRKRDKKRESAG-  63

Query  337  PKVNIQNTGYRTEEDRKEFEP  399
             + NI +   + E   +  +P
Sbjct  64   -QKNIADASAQVEHSSQWTKP  83



>emb|CAN69467.1| hypothetical protein VITISV_042554 [Vitis vinifera]
Length=108

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD-  282
            MV+GS+ EGGTQ L   VR TI+++KE+   HS+ADIY TL+E+NMDPNET QKL +Q  
Sbjct  1    MVSGSRMEGGTQILPARVRKTIQSIKEIVGNHSDADIYVTLRETNMDPNETTQKLLYQGY  60

Query  283  TFHE  294
            +F E
Sbjct  61   SFFE  64



>ref|XP_009782967.1| PREDICTED: uncharacterized protein LOC104231636 isoform X3 [Nicotiana 
sylvestris]
Length=879

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            VR TI+ +KE+   HSE +IYA LKE +MDPNET QKL  QDTFHEVKR+RDRKKE
Sbjct  25   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKRDRKKE  80



>ref|XP_008342252.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            GVR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  13   GVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>ref|XP_008342251.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X1 [Malus 
domestica]
Length=866

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            GVR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  13   GVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>gb|EMT03241.1| hypothetical protein F775_28234 [Aegilops tauschii]
Length=859

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  151  PGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            P +  TI+++KEV  GHSE DIY  L+ESNMDPNET Q+L +QD FHEV+R+RD+KKE+
Sbjct  24   PAIDSTIKSIKEVVGGHSEDDIYDALRESNMDPNETAQRLLNQDPFHEVRRKRDKKKES  82



>ref|XP_008678496.1| PREDICTED: uncharacterized protein LOC103653346 isoform X3 [Zea 
mays]
Length=774

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>ref|XP_008678497.1| PREDICTED: uncharacterized protein LOC103653346 isoform X4 [Zea 
mays]
Length=756

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>gb|AGT17314.1| Protein of unknown function DUF1296 [Saccharum hybrid cultivar 
R570]
Length=798

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 5/79 (6%)
 Frame = +1

Query  103  EMVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            EM AG +F     ++  G R T+  +KE+A GH++ ++YA L+E NMDPNET Q+L  +D
Sbjct  4    EMAAGGRF-----SIPAGARRTVADIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLED  58

Query  283  TFHEVKRRRDRKKEALNVP  339
            TFHEVKR+RD+KKE    P
Sbjct  59   TFHEVKRKRDKKKEGSKEP  77



>ref|XP_010245042.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X3 [Nelumbo nucifera]
Length=914

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+RD++KE +N
Sbjct  14   VRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKRDKRKENMN  72



>ref|XP_004502111.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=874

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            GVR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL  QDTFHEVKR++D++KE +N
Sbjct  13   GVRKTIQNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLFQDTFHEVKRKKDKRKENVN  72



>ref|XP_010036125.1| PREDICTED: uncharacterized protein LOC104425205 isoform X1 [Eucalyptus 
grandis]
 gb|KCW47652.1| hypothetical protein EUGRSUZ_K01392 [Eucalyptus grandis]
Length=874

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  321
            GVR TI+ +KE+   HSE +IYA L+E +MDPNET QKL  QDTFHEVKR+RDR+K
Sbjct  15   GVRQTIQDIKEITGNHSEEEIYAMLRECSMDPNETAQKLLFQDTFHEVKRKRDRRK  70



>ref|XP_008678494.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Zea mays]
Length=806

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>ref|XP_010036126.1| PREDICTED: uncharacterized protein LOC104425205 isoform X2 [Eucalyptus 
grandis]
 gb|KCW47651.1| hypothetical protein EUGRSUZ_K01392 [Eucalyptus grandis]
Length=840

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  321
            GVR TI+ +KE+   HSE +IYA L+E +MDPNET QKL  QDTFHEVKR+RDR+K
Sbjct  15   GVRQTIQDIKEITGNHSEEEIYAMLRECSMDPNETAQKLLFQDTFHEVKRKRDRRK  70



>ref|XP_002304144.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
 gb|EEE79123.2| hypothetical protein POPTR_0003s06200g [Populus trichocarpa]
Length=858

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  145  LSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            LS  VR  I+++KE+    S+ADIY  LKE+NMDPNET QKL +QD FHEVKR+RD+KKE
Sbjct  30   LSARVRKIIQSIKEIVGNFSDADIYMVLKETNMDPNETVQKLLNQDPFHEVKRKRDKKKE  89

Query  325  ALN  333
            +++
Sbjct  90   SMS  92



>ref|XP_010245043.1| PREDICTED: uncharacterized protein LOC104588700 isoform X4 [Nelumbo 
nucifera]
Length=897

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+RD++KE +N
Sbjct  14   VRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKRDKRKENMN  72



>ref|XP_004973209.1| PREDICTED: flocculation protein FLO11-like [Setaria italica]
Length=829

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  GVR T+  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGVRRTVADIKEIAGGHTDEEVYAMLRECNMDPNETAQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEGSKEP  73



>ref|XP_010245040.1| PREDICTED: uncharacterized protein LOC104588700 isoform X1 [Nelumbo 
nucifera]
Length=952

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+RD++KE +N
Sbjct  14   VRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKRDKRKENMN  72



>ref|XP_010245041.1| PREDICTED: uncharacterized protein LOC104588700 isoform X2 [Nelumbo 
nucifera]
Length=922

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QDTFHEV+R+RD++KE +N
Sbjct  14   VRKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLLQDTFHEVRRKRDKRKENMN  72



>ref|XP_008678495.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Zea mays]
Length=788

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>emb|CDO97864.1| unnamed protein product [Coffea canephora]
Length=849

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 85/135 (63%), Gaps = 18/135 (13%)
 Frame = +1

Query  106  MVAGSKFEGG--TQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ  279
            MV+G++ +GG  TQ +S G+  TI+++KE+   H++ DIYA LKE+NMDPN+  QKL +Q
Sbjct  1    MVSGARIDGGGTTQIVSAGLMKTIQSIKEIVGNHTDGDIYAALKETNMDPNDAAQKLLNQ  60

Query  280  DTFHEVKRRRDRKKEALNVPKVNIQNTGYRTE---EDRKEFEPANLAVKSKTHNNL-IRR  447
            D FHEVKR++D+KKE          N GYR+    E ++  E    AVK  T+++  +RR
Sbjct  61   DPFHEVKRKKDKKKE----------NPGYRSSAAAEPKRYLEHGGQAVKLNTYSDRNMRR  110

Query  448  GPYKRNALPGTGVSR  492
              + RN    +G SR
Sbjct  111  LTHVRNT--SSGFSR  123



>gb|AFW61911.1| putative DUF1296 domain containing family protein [Zea mays]
Length=745

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>gb|AFW61910.1| putative DUF1296 domain containing family protein [Zea mays]
Length=769

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>ref|XP_006353098.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Solanum tuberosum]
Length=876

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            V+ TI  +KE+   HS+ +IYA LKE +MDPNET QKL +QDTFHEVKR+RDR++E LN
Sbjct  21   VKKTIHNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLYQDTFHEVKRKRDRRRENLN  79



>ref|XP_006353099.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Solanum tuberosum]
Length=865

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            V+ TI  +KE+   HS+ +IYA LKE +MDPNET QKL +QDTFHEVKR+RDR++E LN
Sbjct  21   VKKTIHNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLYQDTFHEVKRKRDRRRENLN  79



>ref|XP_008678498.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X5 [Zea mays]
Length=738

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            GG  ++  G R TI  +KE+A GH++ ++YA L+E NMDPNET Q+L  +DTFHEVKR+R
Sbjct  4    GGRVSIPAGARRTIADIKEIAGGHTDEEVYAMLRECNMDPNETVQRLLLEDTFHEVKRKR  63

Query  310  DRKKEALNVP  339
            D+KKE    P
Sbjct  64   DKKKEVSKEP  73



>ref|XP_006857739.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
 gb|ERN19206.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
Length=909

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  109  VAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTF  288
            ++G     G  ++   VR  I+ +KE+A  H + +IYA LKE NMDPNET QKL  QDTF
Sbjct  1    MSGGLHHSGGASIPSSVRKMIQNIKEIAGNHHDDEIYAMLKECNMDPNETTQKLLLQDTF  60

Query  289  HEVKRRRDRKKEALN  333
            HEV+R+RD++KE LN
Sbjct  61   HEVRRKRDKRKENLN  75



>ref|XP_011467310.1| PREDICTED: endochitinase A isoform X3 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE L+
Sbjct  15   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLS  73



>ref|XP_011467309.1| PREDICTED: endochitinase A isoform X2 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE L+
Sbjct  15   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLS  73



>ref|XP_011467308.1| PREDICTED: endochitinase A isoform X1 [Fragaria vesca subsp. 
vesca]
Length=882

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE NMDPNET QKL  QD FHEVKR+RD++KE L+
Sbjct  15   VRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLS  73



>dbj|BAK02193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=876

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            +  T++++KEV  GHSEADI   L+ESNMDPNET QKL +QD FHEVKR+RD+K+E+
Sbjct  24   IDSTVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDKKRES  80



>ref|XP_011100583.1| PREDICTED: uncharacterized protein LOC105178745 [Sesamum indicum]
Length=885

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEV-AKGHSEADIYATLKESNMDPNETFQKLYHQD  282
            M +G K      ++  GV+ TIE +KE+  + HSE +IYA LKE +MDPNET QKL   D
Sbjct  1    MSSGVKGGASRVSIPSGVKKTIEDIKEITGQNHSEDEIYAMLKECSMDPNETTQKLLLLD  60

Query  283  TFHEVKRRRDRKKEALN  333
            TFHEVKR+RDR+KE LN
Sbjct  61   TFHEVKRKRDRRKENLN  77



>ref|XP_009412058.1| PREDICTED: uncharacterized protein LOC103993639 [Musa acuminata 
subsp. malaccensis]
Length=890

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  130  GGTQ-NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  306
            GG++ ++  GVR TI+ +KE+A  HS+ +IYA LK+  MDPNET QKL  QDTFHEV+R+
Sbjct  4    GGSRVSIPAGVRRTIQNIKEIAGNHSDEEIYAMLKDCGMDPNETAQKLLLQDTFHEVRRK  63

Query  307  RDRKKEALNVP  339
            RD++KE +  P
Sbjct  64   RDKRKENVRDP  74



>ref|XP_007049403.1| Cell wall protein AWA1 isoform 1 [Theobroma cacao]
 gb|EOX93560.1| Cell wall protein AWA1 isoform 1 [Theobroma cacao]
Length=885

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD F EVKR+RDRKKE+LN
Sbjct  15   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDRKKESLN  73



>ref|XP_009361530.1| PREDICTED: mucin-12 isoform X2 [Pyrus x bretschneideri]
Length=860

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>ref|XP_009361529.1| PREDICTED: uncharacterized protein LOC103951798 isoform X1 [Pyrus 
x bretschneideri]
Length=861

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +I+A LKE NMDPNET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKENLN  72



>ref|XP_007049405.1| Cell wall protein AWA1 isoform 3 [Theobroma cacao]
 gb|EOX93562.1| Cell wall protein AWA1 isoform 3 [Theobroma cacao]
Length=873

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD F EVKR+RDRKKE+LN
Sbjct  15   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDRKKESLN  73



>ref|XP_002320531.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa]
 gb|EEE98846.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa]
Length=886

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
             R TI+ +KE+A  HS+ +IYA LKE +MDPNET QKL  QD FHEVKR+RDRKKE
Sbjct  14   ARKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRKRDRKKE  69



>ref|XP_008380020.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Malus 
domestica]
Length=866

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +I+A LKE NMDP+ET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPDETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_008380021.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +I+A LKE NMDP+ET QKL  QD FHEVKR+RD++KE LN
Sbjct  14   VRKTIQDIKEITGNHSEEEIHAMLKECNMDPDETAQKLLFQDPFHEVKRKRDKRKENLN  72



>ref|XP_010321075.1| PREDICTED: uncharacterized protein LOC101250117 isoform X1 [Solanum 
lycopersicum]
Length=876

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            V+ TI  +KE+   HS+ +IYA LKE +MDPNET QKL +QDTFHEVKR+ DR++E LN
Sbjct  21   VKKTIHNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLYQDTFHEVKRKHDRRRENLN  79



>ref|XP_010321076.1| PREDICTED: uncharacterized protein LOC101250117 isoform X2 [Solanum 
lycopersicum]
Length=816

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            V+ TI  +KE+   HS+ +IYA LKE +MDPNET QKL +QDTFHEVKR+ DR++E LN
Sbjct  21   VKKTIHNIKEITGNHSDDEIYAMLKECSMDPNETAQKLLYQDTFHEVKRKHDRRRENLN  79



>ref|XP_006357673.1| PREDICTED: flocculation protein FLO11-like isoform X3 [Solanum 
tuberosum]
Length=875

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_006357672.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Solanum 
tuberosum]
Length=876

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_006357671.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Solanum 
tuberosum]
Length=877

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010323917.1| PREDICTED: melanoma-associated antigen C1 isoform X1 [Solanum 
lycopersicum]
Length=876

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010323919.1| PREDICTED: melanoma-associated antigen C1 isoform X3 [Solanum 
lycopersicum]
Length=874

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010323918.1| PREDICTED: melanoma-associated antigen C1 isoform X2 [Solanum 
lycopersicum]
Length=875

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>ref|XP_010323920.1| PREDICTED: melanoma-associated antigen C1 isoform X4 [Solanum 
lycopersicum]
Length=871

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  GVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKE  324
            G+R TI+ +KE+   H E +IYA LKE +MDPNET QKL  QDTFHEVK +RDR+KE
Sbjct  18   GMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74



>emb|CDY65326.1| BnaCnng46620D [Brassica napus]
Length=851

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 15/123 (12%)
 Frame = +1

Query  106  MVAGSKFEGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDT  285
            MV+GS+  GG + +    R  IE+++E+   H++ADI+A LKE++M+ +E  QKL HQD 
Sbjct  1    MVSGSR-TGGNRAMDDEERKLIESIREIVGNHTDADIHAALKEADMNADEAVQKLIHQDP  59

Query  286  FHEVKRRRDRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKT---HNNLIRRGPY  456
            FHEVKRRRDRKKE   +             +++K  E     V  +T   HN   RRG +
Sbjct  60   FHEVKRRRDRKKEVAVL---------VEPADEKKPLESVTSEVNVRTQPEHN--ARRGGH  108

Query  457  KRN  465
             RN
Sbjct  109  SRN  111



>ref|XP_008783017.1| PREDICTED: uncharacterized protein LOC103702379 isoform X8 [Phoenix 
dactylifera]
Length=866

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  336
            VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++KE +  
Sbjct  13   VRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRKENIRE  72

Query  337  P  339
            P
Sbjct  73   P  73



>ref|XP_008783018.1| PREDICTED: uncharacterized protein LOC103702379 isoform X9 [Phoenix 
dactylifera]
Length=865

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  336
            VR TI+ +KE+A  HS+ ++YA LKE  MDPNET Q+L  QDTFHEVKR+RD++KE +  
Sbjct  13   VRKTIQNIKEIAGNHSDEEVYAMLKECAMDPNETAQRLLLQDTFHEVKRKRDKRKENIRE  72

Query  337  P  339
            P
Sbjct  73   P  73



>ref|XP_002964401.1| hypothetical protein SELMODRAFT_438753 [Selaginella moellendorffii]
 gb|EFJ34734.1| hypothetical protein SELMODRAFT_438753 [Selaginella moellendorffii]
Length=822

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +1

Query  160  RMTIETLKEVAK-GHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            R  ++ LKEV   GH E +I+ATLKE NMDPNET Q+L  QDTFHEVKR+RD+KKEA
Sbjct  29   RKVVQNLKEVVGVGHGEEEIFATLKECNMDPNETAQRLMSQDTFHEVKRKRDKKKEA  85



>ref|XP_011007010.1| PREDICTED: uncharacterized protein LOC105112841 isoform X1 [Populus 
euphratica]
Length=893

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  130  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  306
            GG +   PG VR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL  QD FHEVKR+
Sbjct  4    GGVRVSIPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRK  63

Query  307  RDRKKEALN  333
            RDRKKE +N
Sbjct  64   RDRKKENMN  72



>ref|XP_011007012.1| PREDICTED: uncharacterized protein LOC105112841 isoform X2 [Populus 
euphratica]
Length=888

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  130  GGTQNLSPG-VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  306
            GG +   PG VR TI+ +KE+   HS+ +IYA LKE +MDPNET QKL  QD FHEVKR+
Sbjct  4    GGVRVSIPGNVRKTIQNIKEITGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRK  63

Query  307  RDRKKEALN  333
            RDRKKE +N
Sbjct  64   RDRKKENMN  72



>ref|XP_009407930.1| PREDICTED: uncharacterized protein LOC103990491 [Musa acuminata 
subsp. malaccensis]
Length=895

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  127  EGGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRR  306
            +G   ++  GVR TI+ +KE+A  HS+ +IYA LKE  MDPNET QKL  QD FHEVKR+
Sbjct  4    DGSRVSIPAGVRPTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRK  63

Query  307  RDRKKEALNVP  339
            RDR+KE +  P
Sbjct  64   RDRRKENVREP  74



>ref|XP_002436662.1| hypothetical protein SORBIDRAFT_10g006740 [Sorghum bicolor]
 gb|EER88029.1| hypothetical protein SORBIDRAFT_10g006740 [Sorghum bicolor]
Length=859

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  175  TLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            ++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  37   SIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  87



>gb|AAL68853.1|AF466199_12 gb protein [Sorghum bicolor]
Length=1009

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  175  TLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            ++KEV  GHS+ADI  TL+ESNMDPNET QKL +QD FHEVKR+RD+KKE+
Sbjct  37   SIKEVVGGHSDADILDTLRESNMDPNETAQKLLNQDPFHEVKRKRDKKKES  87



>ref|XP_009391914.1| PREDICTED: uncharacterized protein LOC103977959 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=894

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++  GVR TI+ +KE+A  HS+ +IYA LKE  MDPNET QKL  QD FHEVKR+R
Sbjct  5    GARVSIPAGVRRTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRKR  64

Query  310  DRKKEALNVP  339
            D++KE +  P
Sbjct  65   DKRKETVREP  74



>ref|XP_009391913.1| PREDICTED: uncharacterized protein LOC103977959 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=895

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++  GVR TI+ +KE+A  HS+ +IYA LKE  MDPNET QKL  QD FHEVKR+R
Sbjct  5    GARVSIPAGVRRTIQNIKEIAGNHSDEEIYAMLKECGMDPNETAQKLLLQDPFHEVKRKR  64

Query  310  DRKKEALNVP  339
            D++KE +  P
Sbjct  65   DKRKETVREP  74



>ref|XP_010676081.1| PREDICTED: uncharacterized protein LOC104891984 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=562

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEAL  330
            VR TI+ +KE+   HSE DIYA LK+ +MDPNET Q+L H DTFHEVKR+R ++KE +
Sbjct  29   VRKTIQHIKEITSNHSEDDIYAMLKDCSMDPNETTQRLLHLDTFHEVKRKRVKRKETV  86



>gb|KJB42722.1| hypothetical protein B456_007G165200 [Gossypium raimondii]
Length=845

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD F EVKR+RDRKKE+ N
Sbjct  15   VRKTIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLLQDPFREVKRKRDRKKESSN  73



>ref|XP_010252822.1| PREDICTED: uncharacterized protein LOC104594285 isoform X3 [Nelumbo 
nucifera]
Length=910

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++   VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  4    GSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRKR  63

Query  310  DRKKEALN  333
            D++KE +N
Sbjct  64   DKRKENVN  71



>ref|XP_010252821.1| PREDICTED: uncharacterized protein LOC104594285 isoform X2 [Nelumbo 
nucifera]
Length=912

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++   VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  4    GSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRKR  63

Query  310  DRKKEALN  333
            D++KE +N
Sbjct  64   DKRKENVN  71



>ref|XP_010252820.1| PREDICTED: uncharacterized protein LOC104594285 isoform X1 [Nelumbo 
nucifera]
Length=913

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++   VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  4    GSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRKR  63

Query  310  DRKKEALN  333
            D++KE +N
Sbjct  64   DKRKENVN  71



>ref|XP_010109270.1| hypothetical protein L484_014864 [Morus notabilis]
 gb|EXC21509.1| hypothetical protein L484_014864 [Morus notabilis]
Length=731

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  157  VRMTIETLKEV-AKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI  ++E+  K HS+ +I+A LKE  MDPNET QKL + DTFHEVKRRRDR+KE+LN
Sbjct  16   VRKTIHDIREITGKQHSDDEIFAVLKECAMDPNETAQKLLYLDTFHEVKRRRDRRKESLN  75



>ref|XP_008462126.1| PREDICTED: flocculation protein FLO11 [Cucumis melo]
Length=884

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TIE +KE+   HS+ +IYA LKE +MDPNET QKL  QDTFHEVK +R+R+KE  N
Sbjct  15   VRKTIENIKEITGNHSDDEIYAMLKECSMDPNETAQKLLLQDTFHEVKSKRERRKENAN  73



>ref|XP_010676080.1| PREDICTED: uncharacterized protein LOC104891984 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=716

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEAL  330
            VR TI+ +KE+   HSE DIYA LK+ +MDPNET Q+L H DTFHEVKR+R ++KE +
Sbjct  29   VRKTIQHIKEITSNHSEDDIYAMLKDCSMDPNETTQRLLHLDTFHEVKRKRVKRKETV  86



>ref|XP_010252823.1| PREDICTED: uncharacterized protein LOC104594285 isoform X4 [Nelumbo 
nucifera]
Length=858

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++   VR TI+ +KE+A  HSE ++YA LKE +MDPNET QKL  QDTFHEV+R+R
Sbjct  4    GSRVSIPNNVRKTIQNIKEIAGNHSEEEVYAMLKECSMDPNETAQKLLFQDTFHEVRRKR  63

Query  310  DRKKEALN  333
            D++KE +N
Sbjct  64   DKRKENVN  71



>gb|KDP29958.1| hypothetical protein JCGZ_18527 [Jatropha curcas]
Length=892

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TI+ +KE+   HSE +IYA LK+ +MDPNET QKL  QD F EVKR+RDR+KE +N
Sbjct  14   VRKTIQNIKEITGNHSEDEIYAMLKDCSMDPNETAQKLLSQDPFREVKRKRDRRKENMN  72



>ref|XP_002967632.1| hypothetical protein SELMODRAFT_440086 [Selaginella moellendorffii]
 gb|EFJ30979.1| hypothetical protein SELMODRAFT_440086 [Selaginella moellendorffii]
Length=824

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +1

Query  160  RMTIETLKEVAK-GHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEA  327
            R  ++ LKEV   GH E +I+ATLKE NMDPNET Q+L  QD FHEVKR+RD+KKEA
Sbjct  29   RKVVQNLKEVVGVGHGEEEIFATLKECNMDPNETAQRLMSQDAFHEVKRKRDKKKEA  85



>ref|XP_004144622.1| PREDICTED: uncharacterized protein LOC101212400 [Cucumis sativus]
 gb|KGN43398.1| hypothetical protein Csa_7G031590 [Cucumis sativus]
Length=879

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TIE +KE+   HS+ +I+A LKE +MDPNET QKL  QDTFHEVK +R+R+KE  N
Sbjct  15   VRKTIENIKEITGNHSDDEIFAMLKECSMDPNETAQKLLLQDTFHEVKSKRERRKENAN  73



>ref|XP_004162890.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101212400 
[Cucumis sativus]
Length=879

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR TIE +KE+   HS+ +I+A LKE +MDPNET QKL  QDTFHEVK +R+R+KE  N
Sbjct  15   VRKTIENIKEITGNHSDDEIFAMLKECSMDPNETAQKLLLQDTFHEVKSKRERRKENAN  73



>emb|CDP13693.1| unnamed protein product [Coffea canephora]
Length=816

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  166  TIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALNV  336
            TI+ +KE+A  HS+ DIYA LKE NMDPNET Q+L + DTFHEVK++RD++K  +++
Sbjct  19   TIQDIKEIAGKHSDDDIYAMLKECNMDPNETAQRLLYLDTFHEVKKKRDKRKSNVSI  75



>ref|XP_009396030.1| PREDICTED: uncharacterized protein LOC103981123 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=780

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  310  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  447
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_009396005.1| PREDICTED: uncharacterized protein LOC103981123 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=792

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  310  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  447
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_009396015.1| PREDICTED: uncharacterized protein LOC103981123 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=791

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  310  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  447
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_009396023.1| PREDICTED: uncharacterized protein LOC103981123 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=784

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  310  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  447
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_010929039.1| PREDICTED: uncharacterized protein LOC105050641 isoform X4 [Elaeis 
guineensis]
Length=890

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  321
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  322  EALNVP  339
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_010929038.1| PREDICTED: uncharacterized protein LOC105050641 isoform X3 [Elaeis 
guineensis]
Length=899

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  321
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  322  EALNVP  339
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_010929036.1| PREDICTED: uncharacterized protein LOC105050641 isoform X2 [Elaeis 
guineensis]
Length=899

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  321
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  322  EALNVP  339
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_010929035.1| PREDICTED: uncharacterized protein LOC105050641 isoform X1 [Elaeis 
guineensis]
Length=900

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  NLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKK  321
            ++   VR TI  +KE+A  HS+ ++YA LKE +MDPNET Q+L  QDTFHEVKR+RD+KK
Sbjct  8    SIPSNVRKTIHNIKEIAGNHSDEEVYAMLKECSMDPNETAQRLLLQDTFHEVKRKRDKKK  67

Query  322  EALNVP  339
            E +  P
Sbjct  68   ENIREP  73



>ref|XP_009396039.1| PREDICTED: uncharacterized protein LOC103981123 isoform X5 [Musa 
acuminata subsp. malaccensis]
Length=771

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRR  309
            G   ++ P VR TI+ +KE+A  H++ DIY+ LKE  MDPNET QKL  QDTFHEVKR+R
Sbjct  5    GARVSIPPSVRRTIQNIKEIAGHHTDEDIYSMLKECAMDPNETAQKLLLQDTFHEVKRKR  64

Query  310  DRKKEALNVPKVNIQNTGYRTEEDRKEFEPANLAVKSKTHNNLIRR  447
            D++            N   R   DR+    A        H N   R
Sbjct  65   DKR------------NGNVREHSDRRWRPGALGRGGGGGHQNFSNR  98



>ref|XP_008219419.1| PREDICTED: flocculation protein FLO11-like [Prunus mume]
Length=720

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +1

Query  157  VRMTIETLKEVAK-GHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEAL  330
            V+ TI+ ++E+ K  HS+ +IYA LKE +MDPNET QKL + DTFHEVKRR+DR+KE L
Sbjct  15   VKETIQDIREITKKQHSDDEIYAVLKECSMDPNETAQKLLYLDTFHEVKRRKDRRKELL  73



>ref|XP_001756751.1| predicted protein [Physcomitrella patens]
 gb|EDQ78348.1| predicted protein, partial [Physcomitrella patens]
Length=79

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +1

Query  130  GGTQNLSPGVRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQ-DTFHEVKRR  306
            GG  ++    +  ++ LKEV  G+SE +IYA LKE NMDPNE  Q+L +Q D FHEVKR+
Sbjct  8    GGAVDIPASTKKVVQDLKEVV-GNSEEEIYAMLKECNMDPNEAAQRLLNQGDPFHEVKRK  66

Query  307  RDRKKE  324
            RD+KKE
Sbjct  67   RDKKKE  72



>gb|KDO50974.1| hypothetical protein CISIN_1g006896mg [Citrus sinensis]
Length=627

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            ++  I+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD FHEVKR+RD++KE +N
Sbjct  22   MKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKENVN  80



>ref|XP_006447831.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
 ref|XP_006469424.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform 
X1 [Citrus sinensis]
 gb|ESR61071.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
Length=887

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            ++  I+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD FHEVKR+RD++KE +N
Sbjct  22   MKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKENVN  80



>ref|XP_007142439.1| hypothetical protein PHAVU_008G280600g [Phaseolus vulgaris]
 gb|ESW14433.1| hypothetical protein PHAVU_008G280600g [Phaseolus vulgaris]
Length=768

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  157  VRMTIETLKEV-AKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR  I+ ++E+  K H++ +IYA L+E +MDPNET QKL + DTFHEV+RRRDRKKE L+
Sbjct  18   VRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRDRKKEGLS  77



>ref|XP_006447832.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
 ref|XP_006469425.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform 
X2 [Citrus sinensis]
 gb|ESR61072.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
Length=886

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  157  VRMTIETLKEVAKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            ++  I+ +KE+   HSE +IYA LKE +MDPNET Q+L  QD FHEVKR+RD++KE +N
Sbjct  22   MKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKENVN  80



>ref|XP_004491525.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like [Cicer 
arietinum]
Length=913

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +1

Query  157  VRMTIETLKEV-AKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEAL  330
            VR  I  ++E+  K H++ +IYA LKE +MDPNET QKL + DTFHEV+RRRDRKKE L
Sbjct  16   VRKIIHDIREITGKQHTDEEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRDRKKEGL  74



>ref|XP_006595682.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Glycine max]
Length=773

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  157  VRMTIETLKEV-AKGHSEADIYATLKESNMDPNETFQKLYHQDTFHEVKRRRDRKKEALN  333
            VR  I+ ++E+  K H++ +IYA L+E +MDPNET QKL + DTFHEV+RRRDRKKE L+
Sbjct  19   VRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRDRKKEGLS  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780