BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016E13

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAV88068.1|  NBS-LRR protein                                         112   6e-25   Ipomoea batatas [batate]
gb|AAV88065.1|  leucine-rich repeat protein                             101   5e-22   Ipomoea batatas [batate]
gb|AAV88066.1|  NBS-LRR protein                                         100   9e-21   Ipomoea batatas [batate]
gb|AAV88067.1|  NBS-LRR protein                                       92.4    3e-18   Ipomoea batatas [batate]



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 115/171 (67%), Gaps = 21/171 (12%)
 Frame = +2

Query  2    VDCVALASLIATIKLEFLQPFPRIPLHHQE-PIIHSFLQMISSLQAFLKESRAAAAIKDL  178
            + CVAL SL+ATI+L+FL+  PR+ +   E PI   F + +SSLQAFL++   + AI+DL
Sbjct  1    MGCVALTSLMATIELQFLRSIPRVSILDDELPI--KFFEKLSSLQAFLQQK--SGAIRDL  56

Query  179  EIEIRDFALKAEDNIEIQLSNFVLAKDKEDEEKasqqlhqalqeaaesasellsIIDKVS  358
            EI+IRDFAL AED IEIQLSNF+LAK++ED++KA+Q+LHQ L EAAE+A+     + K+S
Sbjct  57   EIQIRDFALDAEDRIEIQLSNFLLAKNREDQQKAAQKLHQTLIEAAENAAH----LLKIS  112

Query  359  NEADDEENEIQPSIHHWLKRSYSEFENDKFDGSSPCFPELVGGKMVGRXHD  511
            NE+DDE NE   S+  W             D S    P  + G+MVGR +D
Sbjct  113  NESDDESNECH-SLIPW-----------SLDTSLRLQPPKLEGRMVGRRND  151



>gb|AAV88065.1| leucine-rich repeat protein [Ipomoea batatas]
Length=406

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 112/176 (64%), Gaps = 23/176 (13%)
 Frame = +2

Query  8    CVALASLIATIKLEFLQPF-PRIPLHHQEPI-IHSFLQMISSLQAFLKESRAAAAIKDLE  181
            CVAL SLIAT+KLEFLQP  PR+ L  +  + I S  + +SSLQAF++E    +  ++LE
Sbjct  3    CVALTSLIATMKLEFLQPNNPRVSLDDEASLSIKSLFKKLSSLQAFVQEK---SGTRELE  59

Query  182  IEIRDFALKAEDNIEIQLSNFVLAKDKEDEEKasqqlhqalqeaaesasellsIIDKVSN  361
            ++IRDFAL+AED IEIQLSNFVLA + ED++KA Q+LH  LQEAAE+A+ELL +   +S 
Sbjct  60   MKIRDFALEAEDRIEIQLSNFVLANNAEDQQKACQKLHHILQEAAENAAELLKLSSSISK  119

Query  362  EADDEENEIQPSIHHWLKR-SYSEFENDKFDGSSPCFPELVGGKMVGRXHDREXII  526
            EA       + S+  WLK  S SE  N                 MVGR HDR+ I+
Sbjct  120  EAVKNARS-EGSVISWLKHDSASEPSN----------------VMVGRRHDRKVIM  158



>gb|AAV88066.1| NBS-LRR protein [Ipomoea batatas]
Length=846

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 105/181 (58%), Gaps = 29/181 (16%)
 Frame = +2

Query  8    CVALASLIATIKLEFLQPFPRIPLHHQEPIIHSFLQMISSLQAFLKE---SRAAAAIKDL  178
            CVAL SL+ATIKLEFLQP PR+ L  +   + SF + +SSLQ F++E   +R   AI+ L
Sbjct  3    CVALTSLMATIKLEFLQPNPRVVLDDEA--MESFYEKLSSLQGFVQEKSGARGGTAIRHL  60

Query  179  EIEIRDFALKAEDNIEIQLSNFVLA-KDKEDEEKasqqlhqalqeaaesasellsIIDKV  355
            EI+IRDFAL+AED IE QLSNF+LA K+ ED++K      Q LQ   E+A     +++K 
Sbjct  61   EIQIRDFALEAEDRIETQLSNFLLAIKNPEDQQK--AYQQQLLQTLGEAAQNAAKLVEK-  117

Query  356  SNEADDEENEIQPS---IHHWLKR-SYSEFENDKFDGSSPCFPELVGGKMVGRXHDREXI  523
            S E DD++  +  S   +  WLK  S SE  N                 MVGR  DR  I
Sbjct  118  SKETDDDKEVVNISGGPVIPWLKHDSASEPSN----------------VMVGRGRDRMLI  161

Query  524  I  526
            I
Sbjct  162  I  162



>gb|AAV88067.1| NBS-LRR protein [Ipomoea batatas]
Length=779

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 7/97 (7%)
 Frame = +2

Query  8    CVALASLIATIKLEFLQPF-PRIPLHHQEPI-IHSFLQMISSLQAFLKESRAA----AAI  169
            CVAL SL+ATI+LEF+QP   R+PL  +  I I+S  + +SSLQ F+++   A     AI
Sbjct  3    CVALTSLMATIQLEFVQPNNGRVPLDDEASISINSLFEKLSSLQGFVQQKSGAKGRGTAI  62

Query  170  KDLEIEIRDFALKAEDNIEIQLSNFVLA-KDKEDEEK  277
            + LEIEIRDFAL AED IEIQLSNF+LA K+ ED++K
Sbjct  63   RHLEIEIRDFALDAEDRIEIQLSNFLLAIKNPEDQQK  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720