BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016D14

Length=386
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004139346.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    174   4e-48   Cucumis sativus [cucumbers]
ref|XP_004164759.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    174   4e-48   
ref|XP_008458462.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    173   9e-48   Cucumis melo [Oriental melon]
gb|ADU15551.1|  MFP                                                     171   3e-47   Gossypium hirsutum [American cotton]
ref|XP_002284283.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    170   1e-46   Vitis vinifera
gb|KJB27143.1|  hypothetical protein B456_004G280500                    168   5e-46   Gossypium raimondii
ref|XP_010089224.1|  Peroxisomal fatty acid beta-oxidation multif...    165   4e-45   
ref|XP_010100830.1|  Peroxisomal fatty acid beta-oxidation multif...    166   9e-45   
ref|XP_002324426.2|  hypothetical protein POPTR_0018s08940g             163   4e-44   
ref|XP_011048390.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    162   5e-44   Populus euphratica
ref|XP_011048389.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    162   5e-44   Populus euphratica
ref|XP_009409458.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    162   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008645490.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    152   7e-44   
ref|XP_009608928.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    162   9e-44   Nicotiana tomentosiformis
ref|XP_009803575.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    162   1e-43   Nicotiana sylvestris
ref|XP_002514279.1|  3-hydroxyacyl-CoA dehyrogenase, putative           159   1e-42   Ricinus communis
gb|KDO42234.1|  hypothetical protein CISIN_1g004726mg                   157   2e-42   Citrus sinensis [apfelsine]
gb|KDO42233.1|  hypothetical protein CISIN_1g004726mg                   156   4e-42   Citrus sinensis [apfelsine]
ref|XP_008337363.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    157   4e-42   
ref|XP_006451189.1|  hypothetical protein CICLE_v10007590mg             156   6e-42   
gb|KDO42231.1|  hypothetical protein CISIN_1g004726mg                   156   8e-42   Citrus sinensis [apfelsine]
ref|XP_006451188.1|  hypothetical protein CICLE_v10007590mg             156   8e-42   Citrus clementina [clementine]
ref|XP_006475648.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    156   9e-42   Citrus sinensis [apfelsine]
gb|KDO42228.1|  hypothetical protein CISIN_1g004726mg                   156   9e-42   Citrus sinensis [apfelsine]
ref|XP_004287395.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    156   9e-42   Fragaria vesca subsp. vesca
gb|KDO42229.1|  hypothetical protein CISIN_1g004726mg                   156   1e-41   Citrus sinensis [apfelsine]
gb|KDO42232.1|  hypothetical protein CISIN_1g004726mg                   156   1e-41   Citrus sinensis [apfelsine]
emb|CAN66465.1|  hypothetical protein VITISV_006222                     157   1e-41   Vitis vinifera
ref|XP_011078309.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    155   1e-41   Sesamum indicum [beniseed]
ref|XP_007013128.1|  Enoyl-CoA hydratase/isomerase family               155   2e-41   
ref|XP_010541187.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    155   3e-41   
ref|XP_006353465.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    155   3e-41   Solanum tuberosum [potatoes]
ref|XP_004251613.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    154   4e-41   Solanum lycopersicum
ref|XP_010047906.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    154   8e-41   Eucalyptus grandis [rose gum]
emb|CDX97462.1|  BnaC08g13270D                                          154   9e-41   
ref|XP_008679760.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    152   2e-40   
ref|NP_001148087.1|  LOC100281695                                       152   3e-40   
ref|XP_010915852.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    152   3e-40   Elaeis guineensis
ref|XP_009109066.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    152   4e-40   Brassica rapa
ref|XP_002451943.1|  hypothetical protein SORBIDRAFT_04g010370          152   4e-40   Sorghum bicolor [broomcorn]
ref|XP_010688243.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    151   6e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007204255.1|  hypothetical protein PRUPE_ppa002052mg             151   8e-40   Prunus persica
ref|XP_008242673.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   9e-40   Prunus mume [ume]
ref|XP_003528905.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   1e-39   Glycine max [soybeans]
ref|XP_010254066.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006352155.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   1e-39   Solanum tuberosum [potatoes]
ref|XP_007152846.1|  hypothetical protein PHAVU_004G164800g             150   1e-39   Phaseolus vulgaris [French bean]
ref|XP_006352154.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   1e-39   Solanum tuberosum [potatoes]
ref|XP_009595622.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    150   2e-39   Nicotiana tomentosiformis
ref|XP_009129069.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    149   5e-39   Brassica rapa
emb|CDY35240.1|  BnaA01g07910D                                          148   7e-39   Brassica napus [oilseed rape]
ref|XP_009766308.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    148   7e-39   Nicotiana sylvestris
ref|XP_010925875.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    148   7e-39   Elaeis guineensis
ref|XP_004242934.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    148   8e-39   Solanum lycopersicum
emb|CDY06852.1|  BnaC01g09510D                                          148   8e-39   
ref|XP_003620604.1|  Peroxisomal fatty acid beta-oxidation multif...    147   1e-38   Medicago truncatula
dbj|BAD94583.1|  AIM1 protein                                           144   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412890.1|  hypothetical protein EUTSA_v10024533mg             147   2e-38   Eutrema salsugineum [saltwater cress]
gb|KHN20673.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    147   2e-38   Glycine soja [wild soybean]
gb|KFK29448.1|  hypothetical protein AALP_AA7G135800                    147   3e-38   Arabis alpina [alpine rockcress]
emb|CDM81268.1|  unnamed protein product                                146   3e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010447902.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    146   4e-38   Camelina sativa [gold-of-pleasure]
gb|AFS41246.1|  cinnamoyl-CoA hydratase-dehydrogenase                   146   4e-38   Petunia x hybrida [garden petunia]
ref|XP_008775812.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    146   4e-38   Phoenix dactylifera
gb|EMT19952.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    146   5e-38   
gb|EMS66784.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    145   5e-38   Triticum urartu
ref|XP_004952203.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    146   5e-38   Setaria italica
ref|XP_010438362.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    146   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010433148.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    146   6e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009371440.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    145   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_003572416.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    145   8e-38   Brachypodium distachyon [annual false brome]
ref|XP_006833340.1|  hypothetical protein AMTR_s00109p00083880          145   1e-37   Amborella trichopoda
ref|XP_004952202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    145   1e-37   
gb|EYU29809.1|  hypothetical protein MIMGU_mgv1a002065mg                145   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_009413814.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    145   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800762.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    145   1e-37   Phoenix dactylifera
ref|XP_004512984.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    145   2e-37   Cicer arietinum [garbanzo]
gb|KCW79923.1|  hypothetical protein EUGRSUZ_C01265                     144   2e-37   Eucalyptus grandis [rose gum]
ref|NP_194630.1|  fatty acid beta-oxidation multifunctional prote...    144   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867428.1|  hypothetical protein ARALYDRAFT_491857             143   4e-37   
ref|XP_003534202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    143   6e-37   Glycine max [soybeans]
gb|KHN45635.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    143   6e-37   Glycine soja [wild soybean]
gb|EEE56719.1|  hypothetical protein OsJ_06221                          140   8e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283211.1|  hypothetical protein CARUB_v10004242mg             142   1e-36   Capsella rubella
gb|EYU32938.1|  hypothetical protein MIMGU_mgv1a002041mg                142   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_008354516.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    139   3e-36   
gb|ABR18131.1|  unknown                                                 140   4e-36   Picea sitchensis
ref|XP_006647155.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    140   5e-36   Oryza brachyantha
gb|AAL35606.1|AF442962_1  peroxisomal multifunctional protein           140   7e-36   Oryza sativa [red rice]
gb|EEC72899.1|  hypothetical protein OsI_06722                          140   7e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001046536.1|  Os02g0274100                                       140   7e-36   
gb|EMT05771.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    139   8e-36   
ref|XP_008344094.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    138   9e-36   
dbj|BAK04391.1|  predicted protein                                      138   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93145.1|  predicted protein                                      138   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008390228.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    138   3e-35   
gb|KDP33693.1|  hypothetical protein JCGZ_07264                         137   6e-35   Jatropha curcas
ref|XP_009371482.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    135   6e-35   
ref|XP_010089223.1|  Peroxisomal fatty acid beta-oxidation multif...    137   1e-34   Morus notabilis
gb|AAQ13901.1|  multifunctional protein                                 137   1e-34   Oryza sativa [red rice]
ref|XP_009374040.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    135   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_006833339.1|  hypothetical protein AMTR_s00109p00082150          135   5e-34   Amborella trichopoda
ref|XP_007013129.1|  Enoyl-CoA hydratase/isomerase family               134   1e-33   
emb|CDP03312.1|  unnamed protein product                                131   1e-32   Coffea canephora [robusta coffee]
gb|KJB07187.1|  hypothetical protein B456_001G006400                    131   1e-32   Gossypium raimondii
gb|KJB07188.1|  hypothetical protein B456_001G006400                    131   1e-32   Gossypium raimondii
ref|XP_004952201.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    130   2e-32   
ref|XP_004515676.1|  PREDICTED: phosphopantothenate--cysteine lig...    125   6e-32   
ref|XP_008646894.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    129   9e-32   
ref|XP_006354399.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    127   3e-31   Solanum tuberosum [potatoes]
gb|KHG01746.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    125   1e-30   Gossypium arboreum [tree cotton]
gb|KJB64948.1|  hypothetical protein B456_010G073100                    125   1e-30   Gossypium raimondii
ref|XP_002978003.1|  hypothetical protein SELMODRAFT_176660             124   4e-30   Selaginella moellendorffii
ref|XP_002966745.1|  hypothetical protein SELMODRAFT_168461             124   4e-30   Selaginella moellendorffii
gb|KHG02088.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    115   5e-30   Gossypium arboreum [tree cotton]
ref|XP_010325170.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    123   1e-29   Solanum lycopersicum
gb|EMS59767.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    122   3e-29   Triticum urartu
dbj|BAG80663.1|  multifunctional protein                                121   4e-29   Nicotiana tabacum [American tobacco]
ref|XP_009787311.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    121   4e-29   Nicotiana sylvestris
ref|XP_009604119.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    121   4e-29   Nicotiana tomentosiformis
ref|XP_001773623.1|  predicted protein                                  120   9e-29   
ref|XP_011010197.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    120   1e-28   Populus euphratica
ref|XP_006654304.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    120   1e-28   Oryza brachyantha
ref|XP_002516946.1|  conserved hypothetical protein                     112   2e-28   
ref|XP_007154174.1|  hypothetical protein PHAVU_003G096400g             120   2e-28   Phaseolus vulgaris [French bean]
ref|XP_002270067.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    119   2e-28   Vitis vinifera
ref|XP_002314377.1|  MULTIFUNCTIONAL family protein                     119   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006365183.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    119   3e-28   Solanum tuberosum [potatoes]
ref|XP_007035631.1|  Multifunctional protein 2                          118   5e-28   
ref|XP_006349823.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    118   5e-28   Solanum tuberosum [potatoes]
dbj|BAG16526.1|  putative glyoxysomal fatty acid beta-oxidation m...    118   5e-28   Capsicum chinense [bonnet pepper]
ref|NP_001055313.1|  Os05g0362100                                       115   8e-28   
gb|EMT14630.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    115   1e-27   
ref|XP_009622777.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    117   1e-27   Nicotiana tomentosiformis
ref|XP_002439650.1|  hypothetical protein SORBIDRAFT_09g017970          117   1e-27   Sorghum bicolor [broomcorn]
ref|XP_010314711.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    117   1e-27   Solanum lycopersicum
ref|XP_009769326.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    117   1e-27   Nicotiana sylvestris
ref|XP_001765398.1|  predicted protein                                  117   2e-27   
ref|XP_004252912.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    116   2e-27   Solanum lycopersicum
ref|XP_003529561.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    116   3e-27   Glycine max [soybeans]
gb|EEE63425.1|  hypothetical protein OsJ_18237                          116   3e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ABK24476.1|  unknown                                                 116   3e-27   Picea sitchensis
gb|KHN02955.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    115   4e-27   Glycine soja [wild soybean]
dbj|BAJ85471.1|  predicted protein                                      115   4e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001234975.1|  peroxisomal fatty acid beta-oxidation multif...    115   4e-27   
gb|EEC79068.1|  hypothetical protein OsI_19644                          115   4e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001054687.1|  Os05g0155000                                       115   4e-27   
gb|AAV32217.1|  putative fatty acid beta-oxidation multifunctiona...    115   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784761.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    115   6e-27   Phoenix dactylifera
ref|XP_008784760.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    115   7e-27   Phoenix dactylifera
ref|XP_004962329.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    115   9e-27   Setaria italica
ref|XP_004962328.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    114   1e-26   
ref|XP_004508202.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    114   1e-26   Cicer arietinum [garbanzo]
gb|KDP27817.1|  hypothetical protein JCGZ_18897                         114   2e-26   Jatropha curcas
emb|CDO98847.1|  unnamed protein product                                114   2e-26   Coffea canephora [robusta coffee]
gb|AES91892.2|  glyoxysomal fatty acid beta-oxidation MFP-A protein     113   2e-26   Medicago truncatula
ref|XP_003609695.1|  Glyoxysomal fatty acid beta-oxidation multif...    113   3e-26   
ref|XP_004171035.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    107   3e-26   
ref|XP_009352290.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    113   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_003569321.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    113   4e-26   Brachypodium distachyon [annual false brome]
ref|XP_009381090.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    112   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931678.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    112   6e-26   Elaeis guineensis
ref|XP_010693603.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    112   6e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004296857.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    112   6e-26   Fragaria vesca subsp. vesca
ref|XP_010921650.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    112   7e-26   Elaeis guineensis
ref|XP_008458439.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    112   8e-26   Cucumis melo [Oriental melon]
ref|XP_006380154.1|  MULTIFUNCTIONAL family protein                     112   9e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010105147.1|  Glyoxysomal fatty acid beta-oxidation multif...    112   9e-26   Morus notabilis
ref|XP_006380155.1|  hypothetical protein POPTR_0008s22410g             112   1e-25   
gb|KJB72709.1|  hypothetical protein B456_011G191800                    111   1e-25   Gossypium raimondii
gb|KJB72711.1|  hypothetical protein B456_011G191800                    111   1e-25   Gossypium raimondii
ref|XP_006600114.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    111   2e-25   Glycine max [soybeans]
gb|KHN03349.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...    111   2e-25   Glycine soja [wild soybean]
gb|KJB72706.1|  hypothetical protein B456_011G191800                    111   2e-25   Gossypium raimondii
ref|XP_008810214.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    111   2e-25   Phoenix dactylifera
gb|AFW77663.1|  hypothetical protein ZEAMMB73_186479                    108   2e-25   
gb|KJB72707.1|  hypothetical protein B456_011G191800                    111   2e-25   Gossypium raimondii
ref|XP_011071437.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    111   2e-25   Sesamum indicum [beniseed]
ref|XP_006419532.1|  hypothetical protein CICLE_v10004429mg             110   2e-25   Citrus clementina [clementine]
ref|XP_003550336.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    110   2e-25   Glycine max [soybeans]
gb|AIL29217.1|  fatty acid beta-oxidation multifunctional protein       110   3e-25   Camellia oleifera [abura-tsubaki]
ref|XP_010259502.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    110   3e-25   Nelumbo nucifera [Indian lotus]
gb|KJB34649.1|  hypothetical protein B456_006G076600                    110   3e-25   Gossypium raimondii
ref|XP_006489051.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    110   3e-25   
ref|XP_004168411.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    110   3e-25   
ref|XP_004148210.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ...    110   3e-25   
ref|XP_010024717.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    110   4e-25   Eucalyptus grandis [rose gum]
gb|KCW61185.1|  hypothetical protein EUGRSUZ_H039482                    110   4e-25   Eucalyptus grandis [rose gum]
ref|XP_008390640.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    110   4e-25   
gb|KGN47371.1|  hypothetical protein Csa_6G306330                       110   4e-25   Cucumis sativus [cucumbers]
ref|XP_004168410.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    110   4e-25   
ref|XP_008649524.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    109   9e-25   Zea mays [maize]
ref|XP_008649523.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    109   9e-25   Zea mays [maize]
gb|KHG21889.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    109   1e-24   Gossypium arboreum [tree cotton]
gb|KHG21753.1|  Peroxisomal fatty acid beta-oxidation multifuncti...    108   2e-24   Gossypium arboreum [tree cotton]
ref|XP_011003910.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    108   2e-24   Populus euphratica
ref|XP_007012079.1|  Enoyl-CoA hydratase/isomerase family isoform 2     107   4e-24   
ref|XP_007012081.1|  Enoyl-CoA hydratase/isomerase family, putati...    107   4e-24   
ref|XP_007012078.1|  Peroxisomal fatty acid beta-oxidation multif...    107   4e-24   
ref|XP_008340793.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    107   5e-24   
ref|XP_006342814.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    107   5e-24   
emb|CDX92908.1|  BnaC07g41660D                                          107   6e-24   
ref|XP_004487834.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    107   6e-24   Cicer arietinum [garbanzo]
gb|KGN47431.1|  hypothetical protein Csa_6G319770                       106   7e-24   Cucumis sativus [cucumbers]
ref|XP_008458418.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    106   8e-24   Cucumis melo [Oriental melon]
ref|XP_009623955.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    106   9e-24   Nicotiana tomentosiformis
gb|EYU45545.1|  hypothetical protein MIMGU_mgv1a002038mg                106   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_009393205.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    106   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH37224.1|  glyoxysomal fatty acid beta-oxidation MFP-A protein     105   2e-23   Medicago truncatula
ref|XP_010321770.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    105   2e-23   
ref|XP_007154175.1|  hypothetical protein PHAVU_003G096500g             104   4e-23   Phaseolus vulgaris [French bean]
ref|XP_007221966.1|  hypothetical protein PRUPE_ppa002036mg             103   6e-23   Prunus persica
ref|XP_008223215.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    102   2e-22   Prunus mume [ume]
ref|XP_007050970.1|  Multifunctional protein 2, putative isoform 1      101   5e-22   
ref|XP_007050971.1|  Multifunctional protein 2, putative isoform 2      101   5e-22   
ref|XP_006840485.1|  hypothetical protein AMTR_s00045p00190660          101   5e-22   
gb|AAT38103.1|  putative glyoxysomal fatty acid beta-oxidation mu...    101   6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009134933.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    101   6e-22   Brassica rapa
ref|XP_010524718.1|  PREDICTED: peroxisomal fatty acid beta-oxida...    101   7e-22   Tarenaya hassleriana [spider flower]
emb|CDX74076.1|  BnaA03g29710D                                          100   7e-22   
ref|XP_009124621.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...    100   8e-22   Brassica rapa
emb|CBI22983.3|  unnamed protein product                                100   1e-21   Vitis vinifera
ref|XP_009147124.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  99.4    3e-21   Brassica rapa
emb|CDY24662.1|  BnaA05g30610D                                        99.4    3e-21   Brassica napus [oilseed rape]
sp|O49809.2|MFPA_BRANA  RecName: Full=Glyoxysomal fatty acid beta...  99.4    3e-21   Brassica napus [oilseed rape]
emb|CDY34924.1|  BnaA01g32550D                                        99.0    4e-21   Brassica napus [oilseed rape]
ref|XP_004240549.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  98.6    6e-21   Solanum lycopersicum
gb|KFK38149.1|  hypothetical protein AALP_AA3G075600                  98.2    7e-21   Arabis alpina [alpine rockcress]
ref|XP_010464276.1|  PREDICTED: peroxisomal fatty acid beta-oxida...  98.2    8e-21   Camelina sativa [gold-of-pleasure]
emb|CDY05296.1|  BnaC05g45070D                                        97.8    1e-20   
gb|ACL53557.1|  unknown                                               92.4    2e-20   Zea mays [maize]
emb|CDY08028.1|  BnaC03g34950D                                        96.7    2e-20   Brassica napus [oilseed rape]
ref|XP_010547011.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  96.7    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_010445530.1|  PREDICTED: peroxisomal fatty acid beta-oxida...  96.7    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006297065.1|  hypothetical protein CARUB_v10013066mg           96.7    3e-20   Capsella rubella
ref|XP_010486216.1|  PREDICTED: peroxisomal fatty acid beta-oxida...  96.3    4e-20   Camelina sativa [gold-of-pleasure]
gb|AAL32728.1|  fatty acid multifunctional protein (AtMFP2)           93.6    5e-20   Arabidopsis thaliana [mouse-ear cress]
gb|EMT31909.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...  94.7    1e-19   
ref|XP_006407895.1|  hypothetical protein EUTSA_v10020152mg           94.7    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_011082447.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  94.4    1e-19   Sesamum indicum [beniseed]
ref|XP_011082449.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  94.4    1e-19   Sesamum indicum [beniseed]
ref|XP_011082448.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  94.4    2e-19   Sesamum indicum [beniseed]
ref|XP_006355813.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  93.6    3e-19   Solanum tuberosum [potatoes]
ref|NP_187342.1|  fatty acid beta-oxidation multifunctional prote...  93.6    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968710.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  93.2    4e-19   Setaria italica
ref|XP_006355812.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  93.2    4e-19   Solanum tuberosum [potatoes]
ref|XP_006355814.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  92.8    5e-19   Solanum tuberosum [potatoes]
ref|NP_001042973.1|  Os01g0348600                                     92.8    5e-19   
ref|XP_009137821.1|  PREDICTED: peroxisomal fatty acid beta-oxida...  92.4    6e-19   Brassica rapa
ref|NP_001152306.1|  glyoxysomal fatty acid beta-oxidation multif...  92.4    7e-19   Zea mays [maize]
gb|ACN35901.1|  unknown                                               92.4    7e-19   Zea mays [maize]
ref|XP_006644156.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  92.4    8e-19   Oryza brachyantha
gb|EMS51968.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...  92.0    1e-18   Triticum urartu
emb|CDY35130.1|  BnaA06g11400D                                        87.4    1e-18   Brassica napus [oilseed rape]
ref|XP_005643487.1|  putative glyoxysomal fatty acid beta-oxidati...  90.9    3e-18   Coccomyxa subellipsoidea C-169
dbj|BAJ86175.1|  predicted protein                                    90.5    4e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001780666.1|  predicted protein                                89.7    7e-18   
gb|EMS65926.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...  89.4    8e-18   Triticum urartu
emb|CDM81353.1|  unnamed protein product                              88.6    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002882497.1|  hypothetical protein ARALYDRAFT_478006           88.6    2e-17   
ref|XP_003054896.1|  predicted protein                                88.2    2e-17   Micromonas pusilla CCMP1545
emb|CDX72488.1|  BnaC07g45100D                                        84.0    4e-17   
ref|XP_003578000.1|  PREDICTED: glyoxysomal fatty acid beta-oxida...  87.0    5e-17   Brachypodium distachyon [annual false brome]
ref|XP_009413815.1|  PREDICTED: peroxisomal fatty acid beta-oxida...  85.9    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE59589.1|  hypothetical protein OsJ_11897                        84.0    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005844329.1|  hypothetical protein CHLNCDRAFT_59763            84.0    7e-16   Chlorella variabilis
ref|XP_010039870.1|  PREDICTED: peroxisomal fatty acid beta-oxida...  83.6    8e-16   Eucalyptus grandis [rose gum]
ref|XP_002966785.1|  hypothetical protein SELMODRAFT_439712           82.8    2e-15   Selaginella moellendorffii
gb|KJB49894.1|  hypothetical protein B456_008G144100                  81.6    4e-15   Gossypium raimondii
ref|WP_039577596.1|  3-hydroxyacyl-CoA dehydrogenase                  81.6    4e-15   Sphingopyxis fribergensis
ref|XP_003078359.1|  putative tetrafunct (ISS)                        82.0    5e-15   
gb|EPS73418.1|  hypothetical protein M569_01334                       80.9    7e-15   Genlisea aurea
ref|XP_005703692.1|  peroxisomal fatty acid beta-oxidation multif...  81.3    7e-15   Galdieria sulphuraria
emb|CEF97273.1|  6-phosphogluconate dehydrogenase,C-terminal-like     79.7    2e-14   Ostreococcus tauri
ref|WP_037553105.1|  3-hydroxyacyl-CoA dehydrogenase                  79.3    2e-14   Sphingopyxis sp. LC363
ref|WP_009176396.1|  3-hydroxyacyl-CoA dehydrogenase                  79.0    3e-14   
gb|ENZ90334.1|  3-hydroxyacyl-CoA dehydrogenase                       79.0    4e-14   
ref|WP_040642947.1|  3-hydroxyacyl-CoA dehydrogenase                  79.0    4e-14   
ref|WP_035960286.1|  3-hydroxyacyl-CoA dehydrogenase                  78.6    4e-14   Caballeronia grimmiae
gb|EMS61353.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...  78.2    6e-14   
ref|XP_010210503.1|  PREDICTED: peroxisomal bifunctional enzyme       77.8    9e-14   
ref|XP_002977962.1|  hypothetical protein SELMODRAFT_176615           77.4    1e-13   
ref|WP_041115048.1|  enoyl-CoA hydratase                              74.3    1e-13   
ref|WP_034279724.1|  enoyl-CoA hydratase                              74.3    2e-13   
dbj|GAF50259.1|  enoyl-CoA hydratase                                  74.3    2e-13   
ref|WP_041086537.1|  enoyl-CoA hydratase                              73.9    2e-13   
gb|EAY97723.1|  hypothetical protein OsI_19646                        71.2    2e-13   
ref|WP_024423220.1|  enoyl-CoA hydratase                              73.9    2e-13   
ref|XP_007512071.1|  predicted protein                                76.6    2e-13   
ref|WP_011543334.1|  3-hydroxyacyl-CoA dehydrogenase                  76.6    2e-13   
ref|WP_039180497.1|  enoyl-CoA hydratase                              73.9    2e-13   
ref|WP_037243312.1|  3-hydroxyacyl-CoA dehydrogenase                  73.9    2e-13   
ref|WP_037512659.1|  3-hydroxyacyl-CoA dehydrogenase                  76.3    3e-13   
ref|XP_001417042.1|  predicted protein                                76.3    3e-13   
ref|WP_003041363.1|  3-hydroxyacyl-CoA dehydrogenase                  76.3    3e-13   
ref|WP_033074471.1|  3-hydroxyacyl-CoA dehydrogenase                  75.9    4e-13   
ref|XP_002504050.1|  predicted protein                                75.9    5e-13   
ref|WP_041107175.1|  enoyl-CoA hydratase                              72.8    5e-13   
ref|WP_012010824.1|  enoyl-CoA hydratase                              72.8    5e-13   
ref|WP_011537708.1|  3-hydroxyacyl-CoA dehydrogenase                  75.5    6e-13   
ref|WP_034661776.1|  enoyl-CoA hydratase                              72.4    7e-13   
ref|WP_003216795.1|  enoyl-CoA hydratase                              72.4    8e-13   
gb|ACY02892.1|  predicted CoA hydratase                               72.0    1e-12   
ref|WP_025092456.1|  MULTISPECIES: enoyl-CoA hydratase                72.0    1e-12   
ref|WP_024427174.1|  enoyl-CoA hydratase                              72.0    1e-12   
gb|EYU42227.1|  hypothetical protein MIMGU_mgv1a002069mg              74.3    1e-12   
ref|WP_029968385.1|  3-hydroxyacyl-CoA dehydrogenase                  74.3    1e-12   
ref|WP_019744091.1|  enoyl-CoA hydratase                              71.6    1e-12   
ref|WP_009816151.1|  3-hydroxypropionyl-CoA dehydratase               71.6    2e-12   
ref|WP_035701941.1|  enoyl-CoA hydratase                              71.6    2e-12   
gb|EET49139.1|  3-hydroxyacyl-CoA dehydrogenase NAD-binding           73.9    2e-12   
ref|WP_040819962.1|  hypothetical protein                             73.9    2e-12   
ref|WP_008345984.1|  enoyl-CoA hydratase                              71.2    2e-12   
ref|WP_017358245.1|  MULTISPECIES: enoyl-CoA hydratase                71.2    2e-12   
ref|WP_027798746.1|  3-hydroxyacyl-CoA dehydrogenase                  73.9    2e-12   
gb|EMI12521.1|  enoyl- hydratase                                      71.2    2e-12   
ref|WP_040955172.1|  enoyl-CoA hydratase                              71.2    2e-12   
ref|WP_039964089.1|  enoyl-CoA hydratase                              71.2    2e-12   
ref|WP_025599515.1|  3-hydroxyacyl-CoA dehydrogenase                  73.6    2e-12   
ref|WP_034320867.1|  enoyl-CoA hydratase                              70.9    2e-12   
ref|WP_026094877.1|  3-hydroxyacyl-CoA dehydrogenase                  73.2    3e-12   
ref|WP_041745287.1|  3-hydroxyacyl-CoA dehydrogenase                  73.2    3e-12   
ref|WP_008355972.1|  enoyl-CoA hydratase                              70.5    3e-12   
ref|XP_008561787.1|  PREDICTED: peroxisomal bifunctional enzyme-like  69.7    3e-12   
gb|AFT85774.1|  3-hydroxyacyl-CoA dehydrogenase                       73.2    3e-12   
ref|WP_003327703.1|  MULTISPECIES: enoyl-CoA hydratase                70.5    3e-12   
ref|XP_003412946.1|  PREDICTED: peroxisomal bifunctional enzyme       73.2    4e-12   
emb|CDQ36924.1|  putative enoyl-CoA hydratase                         70.5    4e-12   
ref|WP_035477678.1|  3-hydroxyacyl-CoA dehydrogenase                  73.2    4e-12   
ref|WP_026684261.1|  enoyl-CoA hydratase                              70.5    4e-12   
ref|WP_013588352.1|  3-hydroxyacyl-CoA dehydrogenase                  72.8    4e-12   
gb|AAI02239.1|  Enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzym...  70.1    4e-12   
ref|WP_043343707.1|  enoyl-CoA hydratase                              70.1    4e-12   
ref|WP_028363172.1|  3-hydroxyacyl-CoA dehydrogenase                  72.8    4e-12   
gb|EMT06606.1|  Glyoxysomal fatty acid beta-oxidation multifuncti...  72.8    4e-12   
ref|WP_028754287.1|  3-hydroxybutyryl-CoA dehydratase                 70.1    4e-12   
ref|WP_016558323.1|  3-hydroxyacyl-CoA dehydrogenase                  72.8    5e-12   
ref|WP_019376761.1|  hypothetical protein                             70.1    5e-12   
ref|WP_035175435.1|  enoyl-CoA hydratase                              70.1    5e-12   
ref|XP_010559455.1|  PREDICTED: peroxisomal bifunctional enzyme       72.4    6e-12   
ref|WP_027211229.1|  3-hydroxyacyl-CoA dehydrogenase                  72.4    6e-12   
ref|WP_007439195.1|  enoyl-CoA hydratase                              69.7    6e-12   
ref|WP_007181989.1|  3-hydroxyacyl-CoA dehydrogenase                  72.4    7e-12   
ref|XP_004675113.1|  PREDICTED: peroxisomal bifunctional enzyme       72.4    7e-12   
ref|WP_043346634.1|  3-hydroxyacyl-CoA dehydrogenase                  72.0    7e-12   
ref|WP_028196571.1|  3-hydroxyacyl-CoA dehydrogenase                  72.0    7e-12   
ref|WP_017223848.1|  3-hydroxyacyl-CoA dehydrogenase                  72.0    7e-12   
ref|WP_043363487.1|  enoyl-CoA hydratase                              69.7    7e-12   
ref|WP_042420298.1|  enoyl-CoA hydratase                              69.3    8e-12   
ref|WP_027718207.1|  3-hydroxybutyryl-CoA dehydrogenase               69.3    9e-12   
ref|XP_004003128.1|  PREDICTED: peroxisomal bifunctional enzyme       72.0    9e-12   
ref|WP_035867724.1|  3-hydroxyacyl-CoA dehydrogenase                  72.0    9e-12   
ref|WP_027778362.1|  3-hydroxyacyl-CoA dehydrogenase                  72.0    9e-12   
ref|WP_020065922.1|  3-hydroxyacyl-CoA dehydrogenase                  72.0    9e-12   
dbj|BAJ91250.1|  predicted protein                                    71.6    1e-11   
ref|XP_007233843.1|  PREDICTED: peroxisomal bifunctional enzyme-like  71.6    1e-11   
ref|WP_006160676.1|  3-hydroxyacyl-CoA dehydrogenase                  71.6    1e-11   
ref|WP_014096874.1|  crotonase                                        68.9    1e-11   
dbj|GAF23789.1|  LOW QUALITY PROTEIN: enoyl-CoA hydratase             68.9    1e-11   
ref|WP_019963865.1|  hypothetical protein                             71.2    1e-11   
ref|WP_013339215.1|  3-hydroxyacyl-CoA dehydrogenase                  71.2    1e-11   
ref|WP_042223291.1|  enoyl-CoA hydratase                              68.9    1e-11   
ref|XP_002716515.1|  PREDICTED: peroxisomal bifunctional enzyme       71.2    1e-11   
ref|WP_020452500.1|  MULTISPECIES: enoyl-CoA hydratase/3-hydroxya...  68.6    2e-11   
ref|WP_025917594.1|  3-hydroxyacyl-CoA dehydrogenase                  71.2    2e-11   
gb|ETO25452.1|  Enoyl-CoA hydratase/isomerase                         67.8    2e-11   
gb|EOB37266.1|  3-hydroxyisobutyryl-CoA hydrolase                     68.6    2e-11   
ref|XP_005981597.1|  PREDICTED: peroxisomal bifunctional enzyme       70.9    2e-11   
ref|WP_035079765.1|  3-hydroxyacyl-CoA dehydrogenase                  70.9    2e-11   
ref|XP_005903446.1|  PREDICTED: peroxisomal bifunctional enzyme       70.9    2e-11   
ref|XP_006160841.1|  PREDICTED: peroxisomal bifunctional enzyme       70.9    2e-11   
ref|WP_024573674.1|  MULTISPECIES: 3-hydroxybutyryl-CoA dehydratase   68.2    2e-11   
ref|WP_021028703.1|  enoyl-CoA hydratase                              68.2    2e-11   
ref|XP_010852168.1|  PREDICTED: peroxisomal bifunctional enzyme       70.9    2e-11   
ref|NP_001069248.2|  peroxisomal bifunctional enzyme                  70.9    2e-11   
ref|WP_025727768.1|  enoyl-CoA hydratase                              68.2    2e-11   
ref|XP_001498786.1|  PREDICTED: peroxisomal bifunctional enzyme       70.5    2e-11   
ref|WP_035352601.1|  enoyl-CoA hydratase                              68.2    2e-11   
emb|CAG09301.1|  unnamed protein product                              67.4    3e-11   
ref|WP_003292715.1|  enoyl-CoA hydratase                              70.5    3e-11   
ref|WP_026244479.1|  acetyl-CoA synthetase                            70.9    3e-11   
ref|XP_008304884.1|  PREDICTED: peroxisomal bifunctional enzyme-like  66.2    3e-11   
ref|XP_003358782.2|  PREDICTED: uncharacterized protein LOC448846     69.7    3e-11   
ref|XP_005308713.1|  PREDICTED: peroxisomal bifunctional enzyme i...  70.1    3e-11   
ref|WP_006048962.1|  3-hydroxyacyl-CoA dehydrogenase                  70.1    3e-11   
ref|WP_009942008.1|  enoyl-CoA hydratase/isomerase family/3-hydro...  65.9    3e-11   
ref|XP_005308712.1|  PREDICTED: peroxisomal bifunctional enzyme i...  70.1    3e-11   
ref|XP_005308711.1|  PREDICTED: peroxisomal bifunctional enzyme i...  70.5    3e-11   
ref|WP_013744287.1|  3-hydroxyacyl-CoA dehydrogenase                  70.1    3e-11   
ref|WP_018314180.1|  enoyl-CoA hydratase                              67.8    3e-11   
ref|WP_030103147.1|  3-hydroxyacyl-CoA dehydrogenase                  70.1    3e-11   
ref|WP_033447413.1|  hypothetical protein                             66.2    4e-11   
ref|WP_038481753.1|  enoyl-CoA hydratase                              67.4    4e-11   
ref|WP_044792930.1|  enoyl-CoA hydratase                              67.4    4e-11   
ref|WP_035550268.1|  3-hydroxyacyl-CoA dehydrogenase                  70.1    4e-11   
ref|XP_001699366.1|  hypothetical protein CHLREDRAFT_132158           70.1    4e-11   
ref|WP_039072905.1|  enoyl-CoA hydratase                              67.4    4e-11   
ref|XP_004038196.1|  PREDICTED: peroxisomal bifunctional enzyme-like  65.9    4e-11   
ref|XP_005800750.1|  PREDICTED: peroxisomal bifunctional enzyme-like  69.7    5e-11   
ref|XP_005143152.1|  PREDICTED: peroxisomal bifunctional enzyme       69.7    5e-11   
ref|WP_037538090.1|  3-hydroxyacyl-CoA dehydrogenase                  69.7    5e-11   
ref|WP_006576135.1|  3-hydroxyacyl-CoA dehydrogenase                  69.7    5e-11   
ref|WP_011488318.1|  3-hydroxyacyl-CoA dehydrogenase                  69.7    5e-11   
ref|WP_014643952.1|  enoyl-CoA hydratase                              67.4    5e-11   
ref|WP_017875631.1|  3-hydroxyacyl-CoA dehydrogenase                  69.7    5e-11   
ref|XP_007570360.1|  PREDICTED: peroxisomal bifunctional enzyme       69.7    6e-11   
ref|XP_008402173.1|  PREDICTED: peroxisomal bifunctional enzyme       69.7    6e-11   
ref|XP_422690.2|  PREDICTED: peroxisomal bifunctional enzyme isof...  69.7    6e-11   
ref|WP_040038802.1|  3-hydroxyacyl-CoA dehydrogenase                  69.7    6e-11   
ref|WP_008919161.1|  3-hydroxyacyl-CoA dehydrogenase                  69.7    6e-11   
ref|XP_005101104.1|  PREDICTED: peroxisomal bifunctional enzyme-like  69.7    6e-11   
ref|WP_020857626.1|  enoyl-CoA hydratase/3,2-trans-enoyl-CoA isom...  69.7    6e-11   
gb|EEK78376.1|  Enoyl-CoA hydratase(3-hydroxybutyryl-CoA dehydrat...  67.0    6e-11   
ref|WP_009929895.1|  enoyl-CoA hydratase/isomerase family/3-hydro...  66.2    6e-11   
ref|WP_020033825.1|  hypothetical protein                             69.3    6e-11   
ref|WP_026569762.1|  MULTISPECIES: enoyl-CoA hydratase                67.0    6e-11   
ref|WP_001105338.1|  MULTISPECIES: crotonase                          67.0    6e-11   
gb|EEL16463.1|  Enoyl-CoA hydratase(3-hydroxybutyryl-CoA dehydrat...  67.0    6e-11   
ref|WP_001105340.1|  crotonase                                        67.0    6e-11   
ref|WP_042314165.1|  3-hydroxyacyl-CoA dehydrogenase                  69.3    7e-11   
ref|WP_040981752.1|  enoyl-CoA hydratase                              67.0    7e-11   
ref|WP_042323645.1|  3-hydroxyacyl-CoA dehydrogenase                  69.3    7e-11   
ref|WP_020201606.1|  3-hydroxyacyl-CoA dehydrogenase                  69.3    7e-11   
ref|WP_043790371.1|  3-hydroxyacyl-CoA dehydrogenase                  69.3    7e-11   
ref|WP_035545064.1|  enoyl-CoA hydratase                              66.6    7e-11   
ref|WP_016452907.1|  3-hydroxyacyl-CoA dehydrogenase                  69.3    7e-11   
ref|WP_013802769.1|  3-hydroxyacyl-CoA dehydrogenase                  69.3    7e-11   
ref|WP_017251082.1|  enoyl-CoA hydratase                              66.6    7e-11   
ref|WP_012205151.1|  3-hydroxyacyl-CoA dehydrogenase                  69.3    8e-11   
ref|WP_010789416.1|  Enoyl-CoA hydratase                              66.6    8e-11   
ref|WP_014827297.1|  enoyl-CoA hydratase                              66.6    8e-11   
ref|WP_027838940.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    8e-11   
gb|KJF70317.1|  3-hydroxybutyryl-CoA dehydratase                      66.6    8e-11   
gb|ELU09146.1|  hypothetical protein CAPTEDRAFT_228818                68.6    9e-11   
ref|WP_010397962.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    9e-11   
ref|WP_041604808.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    9e-11   
ref|WP_028040680.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    9e-11   
ref|WP_022544255.1|  MULTISPECIES: enoyl-CoA hydratase                66.6    9e-11   
ref|WP_043822732.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    9e-11   
gb|AFK52471.1|  peroxisomal bifunctional enzyme                       68.9    9e-11   
ref|WP_016446754.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    1e-10   
emb|CCF19966.1|  3-hydroxybutyryl-CoA dehydratase                     66.2    1e-10   
ref|WP_034598824.1|  enoyl-CoA hydratase                              66.6    1e-10   
ref|WP_017405242.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    1e-10   
ref|WP_007733208.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    1e-10   
ref|WP_039013746.1|  3-hydroxyacyl-CoA dehydrogenase                  68.9    1e-10   
ref|WP_003325180.1|  MULTISPECIES: enoyl-CoA hydratase                66.2    1e-10   
ref|WP_007585928.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
ref|XP_005050952.1|  PREDICTED: peroxisomal bifunctional enzyme       68.6    1e-10   
ref|WP_022912310.1|  enoyl-CoA hydratase                              66.2    1e-10   
ref|WP_011801233.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
ref|XP_004473791.1|  PREDICTED: peroxisomal bifunctional enzyme       68.6    1e-10   
ref|WP_011297574.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
gb|AEG69095.1|  fused 3-hydroxybutyryl-CoA epimerase                  68.9    1e-10   
ref|WP_007722416.1|  enoyl-CoA hydratase                              66.2    1e-10   
ref|WP_009329335.1|  MULTISPECIES: enoyl-CoA hydratase                66.2    1e-10   
ref|WP_010335214.1|  enoyl-CoA hydratase                              66.2    1e-10   
ref|WP_037081213.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
ref|WP_001105337.1|  MULTISPECIES: crotonase                          66.2    1e-10   
gb|EJZ34217.1|  3-hydroxyacyl-CoA dehydrogenase                       64.3    1e-10   
ref|WP_028040627.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
ref|WP_012959975.1|  enoyl-CoA hydratase                              65.9    1e-10   
ref|WP_022628804.1|  enoyl-CoA hydratase                              65.9    1e-10   
ref|WP_019051910.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
ref|WP_035188322.1|  enoyl-CoA hydratase                              65.9    1e-10   
ref|XP_006201076.1|  PREDICTED: peroxisomal bifunctional enzyme       68.6    1e-10   
ref|WP_038714669.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
ref|WP_009820735.1|  3-hydroxyacyl-CoA dehydrogenase                  68.6    1e-10   
ref|WP_020296039.1|  fatty oxidation complex, alpha subunit           65.1    1e-10   
ref|WP_024576579.1|  MULTISPECIES: 3-hydroxybutyryl-CoA dehydratase   65.9    1e-10   
ref|WP_006577820.1|  NAD-binding 3-hydroxyacyl-CoA dehydrogenase      68.2    1e-10   
ref|WP_012685391.1|  enoyl-CoA hydratase                              65.9    1e-10   
ref|WP_028879689.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    1e-10   
ref|WP_009911986.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    2e-10   
ref|WP_034784615.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    2e-10   
ref|WP_010114902.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    2e-10   
ref|WP_038216456.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    2e-10   
ref|WP_016724583.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    2e-10   
ref|XP_005675232.1|  PREDICTED: peroxisomal bifunctional enzyme       68.2    2e-10   
ref|XP_004424682.1|  PREDICTED: peroxisomal bifunctional enzyme       68.2    2e-10   
gb|EIP89082.1|  fatty oxidation complex, alpha subunit, putative      68.2    2e-10   
ref|WP_013172330.1|  enoyl-CoA hydratase [                            65.9    2e-10   
ref|WP_029994025.1|  enoyl-CoA hydratase                              67.8    2e-10   
ref|WP_009522672.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    2e-10   
ref|WP_028225050.1|  3-hydroxyacyl-CoA dehydrogenase                  68.2    2e-10   
ref|WP_011951855.1|  enoyl-CoA hydratase/isomerase                    67.8    2e-10   
ref|WP_022985129.1|  3-hydroxyacyl-CoA dehydrogenase                  67.8    2e-10   
ref|XP_002936579.1|  PREDICTED: peroxisomal bifunctional enzyme       67.8    2e-10   
ref|XP_009087519.1|  PREDICTED: peroxisomal bifunctional enzyme       67.8    2e-10   
ref|XP_005529601.1|  PREDICTED: peroxisomal bifunctional enzyme       67.8    2e-10   
ref|WP_002161313.1|  crotonase                                        65.5    2e-10   
ref|WP_036831319.1|  enoyl-CoA hydratase                              65.5    2e-10   
ref|XP_006884150.1|  PREDICTED: peroxisomal bifunctional enzyme       67.8    2e-10   
ref|WP_025936714.1|  3-hydroxyacyl-CoA dehydrogenase                  67.8    2e-10   
ref|WP_040601127.1|  hypothetical protein                             67.8    2e-10   
ref|WP_035498671.1|  3-hydroxyacyl-CoA dehydrogenase                  67.8    2e-10   
gb|AHG64571.1|  putative fatty acid oxidation complex subunit alpha   67.8    2e-10   
ref|WP_025373213.1|  3-hydroxyacyl-CoA dehydrogenase                  67.8    2e-10   
ref|WP_034392698.1|  3-hydroxyacyl-CoA dehydrogenase                  67.8    2e-10   
ref|WP_027735671.1|  enoyl-CoA hydratase                              65.5    2e-10   



>ref|XP_004139346.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Cucumis sativus]
Length=724

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P+VTMEVGND VALIT+SNPPVNALA  +F  LK KF EA+RR+DVKA+VLTGKGG 
Sbjct  1    MAEPSVTMEVGNDGVALITMSNPPVNALARSMFPALKSKFEEAMRRNDVKAVVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF+ +H+TGD SLLP+VSVD+  NT+EDAKKP+VAA++GLALG
Sbjct  61   FSGGFDINVFEMIHKTGDTSLLPDVSVDIAVNTMEDAKKPIVAAIEGLALG  111



>ref|XP_004164759.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Cucumis sativus]
Length=719

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P+VTMEVGND VALIT+SNPPVNALA  +F  LK KF EA+RR+DVKA+VLTGKGG 
Sbjct  1    MAEPSVTMEVGNDGVALITMSNPPVNALARSMFPALKSKFEEAMRRNDVKAVVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF+ +H+TGD SLLP+VSVD+  NT+EDAKKP+VAA++GLALG
Sbjct  61   FSGGFDINVFEMIHKTGDTSLLPDVSVDIAVNTMEDAKKPIVAAIEGLALG  111



>ref|XP_008458462.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Cucumis melo]
Length=724

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P++TMEVGND VALIT+SNPPVNALA  +F  +K KF EA+RR+DVKA+VLTGKGG 
Sbjct  1    MAEPSITMEVGNDGVALITMSNPPVNALARSMFPAMKSKFEEAMRRNDVKAVVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF+ +H+TGD SLLP+VSVD+  NT+EDAKKP+VAA++GLALG
Sbjct  61   FSGGFDINVFEMIHKTGDTSLLPDVSVDIAVNTMEDAKKPIVAAIEGLALG  111



>gb|ADU15551.1| MFP [Gossypium hirsutum]
Length=721

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            M+   VTMEVGND VA+ITISNPPVNALA+ I  GLKEKF EA RRDDVKAIVLTGKGG 
Sbjct  1    MSQSKVTMEVGNDGVAVITISNPPVNALAIPIIDGLKEKFAEATRRDDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF KVH TGD S++P+VSVDL++N +ED KKP+VAA++GLALG
Sbjct  61   FSGGFDINVFTKVHGTGDVSIMPDVSVDLVTNAVEDCKKPIVAAVEGLALG  111



>ref|XP_002284283.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Vitis vinifera]
 emb|CBI28049.3| unnamed protein product [Vitis vinifera]
Length=724

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            M+   VTMEVGND VA+IT+SNPPVNALAL I AGLKEK+ EA+RR+DVKAIV+TGKGG 
Sbjct  1    MSKAEVTMEVGNDGVAVITMSNPPVNALALAIIAGLKEKYAEAMRRNDVKAIVVTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF+KVH+T D S LP+ S+DLL NT+EDAKKP VAA++GLALG
Sbjct  61   FSGGFDINVFQKVHKTADISHLPDASIDLLVNTVEDAKKPSVAAVEGLALG  111



>gb|KJB27143.1| hypothetical protein B456_004G280500 [Gossypium raimondii]
Length=724

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            M+   VT+EVGND VA+ITISNPPVNALA+ I  GLKEKF EA RR+DVKAIVLTGKGG 
Sbjct  1    MSQSKVTIEVGNDGVAVITISNPPVNALAIPIIDGLKEKFAEATRRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF KVH TGD S++P+VSVDL++N +ED KKP+VAA++GLALG
Sbjct  61   FSGGFDINVFTKVHGTGDVSIMPDVSVDLVTNAVEDCKKPIVAAVEGLALG  111



>ref|XP_010089224.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB37513.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=702

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  TVTMEVGND VA+I ISNPPVNALA+ I AGLKEKF EA RR+DV+AIVLTGKGG 
Sbjct  1    MARATVTMEVGNDGVAVIAISNPPVNALAIPIIAGLKEKFDEATRRNDVRAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH+TGD SL+P+VSVDL+ N IED+KKP+VAA+
Sbjct  61   FSGGFDINVFEKVHKTGDVSLMPDVSVDLVVNVIEDSKKPIVAAI  105



>ref|XP_010100830.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB84763.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=830

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  TVTMEVGND VA+I ISNPPVNALA+ I AGLKEKF EA RR+DV+AIVLTGKGG 
Sbjct  1    MARATVTMEVGNDGVAVIAISNPPVNALAIPIIAGLKEKFDEATRRNDVRAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH+TGD SL+P+VSVDL+ N IED+KKP+VAA+
Sbjct  61   FSGGFDINVFEKVHKTGDVSLMPDVSVDLVVNVIEDSKKPIVAAI  105



>ref|XP_002324426.2| hypothetical protein POPTR_0018s08940g [Populus trichocarpa]
 gb|EEF02991.2| hypothetical protein POPTR_0018s08940g [Populus trichocarpa]
Length=763

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA++T+ NPPVNALA+ I AGLKEKF EA RR+DVKA+VLTGKGG 
Sbjct  40   MAKPHVTMEVGNDGVAVVTLINPPVNALAIPIIAGLKEKFDEATRRNDVKALVLTGKGGR  99

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD SL+P+VSV+L+ NTIED KKPVVAA+
Sbjct  100  FSGGFDINVFQKVHATGDISLMPDVSVELVVNTIEDCKKPVVAAV  144



>ref|XP_011048390.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 isoform X2 [Populus euphratica]
Length=724

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA++T+ NPPVNALA+ I AGLKEKF EA RR+DVKA+VLTGKGG 
Sbjct  1    MAKPHVTMEVGNDGVAVVTLINPPVNALAIPIIAGLKEKFDEATRRNDVKALVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD SL+P+VSV+L+ NTIED KKPVVAA+
Sbjct  61   FSGGFDINVFQKVHATGDISLVPDVSVELVVNTIEDCKKPVVAAV  105



>ref|XP_011048389.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 isoform X1 [Populus euphratica]
Length=748

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA++T+ NPPVNALA+ I AGLKEKF EA RR+DVKA+VLTGKGG 
Sbjct  1    MAKPHVTMEVGNDGVAVVTLINPPVNALAIPIIAGLKEKFDEATRRNDVKALVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD SL+P+VSV+L+ NTIED KKPVVAA+
Sbjct  61   FSGGFDINVFQKVHATGDISLVPDVSVELVVNTIEDCKKPVVAAV  105



>ref|XP_009409458.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Musa acuminata subsp. malaccensis]
Length=725

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTME+G+D VA+ITI NPPVNALA  I AGLKEK+TEA+ R DVKAIVLTG GG 
Sbjct  1    MAAVRVTMEIGSDGVAVITICNPPVNALAPSIIAGLKEKYTEAMNRSDVKAIVLTGDGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF ++H+TG+ SLLP+VSV+L+ NTIEDA KP VAA+QGLALG
Sbjct  61   FSGGFDINVFTEIHKTGNLSLLPDVSVELVVNTIEDAPKPSVAAIQGLALG  111



>ref|XP_008645490.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Zea mays]
Length=169

 Score =   152 bits (385),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI+NPPVNAL   I AGLK+K+ EA+RRDDVKAIVLTG GG F GGF
Sbjct  8    VTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEAMRRDDVKAIVLTGAGGKFCGGF  67

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD SL+P+VSV+L+SN +E+ KKP VAA+Q
Sbjct  68   DINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQ  108



>ref|XP_009608928.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nicotiana tomentosiformis]
Length=724

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVG+D VA+ITISNPPVNALA+QIFAGLKEK+ EA +R+DVKAIVLTG GG 
Sbjct  1    MAEVKVTMEVGSDGVAVITISNPPVNALAIQIFAGLKEKWNEAAKRNDVKAIVLTGHGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD SLLP VSVDL+ NT+ED KKP VAA+
Sbjct  61   FSGGFDINVFQKVHTTGDISLLPGVSVDLVVNTMEDGKKPAVAAV  105



>ref|XP_009803575.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nicotiana sylvestris]
Length=725

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVG D VA+ITISNPPVNALA+QIFAGLKEK+ EA +R+DVKAIVLTG GG 
Sbjct  1    MAEVKVTMEVGTDGVAVITISNPPVNALAIQIFAGLKEKWNEAAKRNDVKAIVLTGHGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD SLLP VSVDL+ NT+ED KKP VAA+
Sbjct  61   FSGGFDINVFQKVHTTGDISLLPGVSVDLVVNTMEDGKKPAVAAV  105



>ref|XP_002514279.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
 gb|EEF48233.1| 3-hydroxyacyl-CoA dehyrogenase, putative [Ricinus communis]
Length=724

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+I++SNPPVNALA+ I  GLKEKFTEA RR DV+AIVLTGK G 
Sbjct  1    MAKPHVTMEVGNDGVAVISMSNPPVNALAVPIIMGLKEKFTEAARRKDVQAIVLTGKNGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDI+V +KVH+TGD S+LP+VSVDL+ N IED KKPVVAA+
Sbjct  61   FSGGFDISVMQKVHQTGDASILPDVSVDLVVNAIEDCKKPVVAAV  105



>gb|KDO42234.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=539

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>gb|KDO42233.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=589

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>ref|XP_008337363.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=724

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNALA+ I AGLKEKF EA RR+DVKAIVLTG GG 
Sbjct  1    MAKVKVTLEVGNDGVAVITIFNPPVNALAIPIIAGLKEKFEEAGRRNDVKAIVLTGHGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINVF+KVHE+GD S++P+VSVD + NT+ED+ KPVVAA+Q
Sbjct  61   FSGGFDINVFEKVHESGDVSIMPDVSVDFVVNTLEDSXKPVVAAVQ  106



>ref|XP_006451189.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
 gb|ESR64429.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
Length=703

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>gb|KDO42231.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=721

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>ref|XP_006451188.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
 gb|ESR64428.1| hypothetical protein CICLE_v10007590mg [Citrus clementina]
Length=724

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>ref|XP_006475648.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Citrus sinensis]
Length=724

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>gb|KDO42228.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=725

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>ref|XP_004287395.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Fragaria vesca subsp. vesca]
Length=723

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVG+D VA+IT+ NPPVNALA+ I AGLKEKF EA RR+DVKAIV+TG GG 
Sbjct  1    MAKVKVTMEVGSDGVAVITMFNPPVNALAIPILAGLKEKFDEAARRNDVKAIVVTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD SL+P+VSVDL+ NT+ED+KKPVVAA+
Sbjct  61   FSGGFDINVFEKVHATGDVSLMPDVSVDLVVNTVEDSKKPVVAAV  105



>gb|KDO42229.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
 gb|KDO42230.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=724

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>gb|KDO42232.1| hypothetical protein CISIN_1g004726mg [Citrus sinensis]
Length=733

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+IT+ NPPVNALA+ I AGLK+KF EA  RDDVKAIVLTG GG 
Sbjct  1    MAAPRVTMEVGNDGVAIITLINPPVNALAIPIVAGLKDKFEEATSRDDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD SL+P+VSV+L+ N IED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGAGDVSLMPDVSVELVVNLIEDCKKPIVAAV  105



>emb|CAN66465.1| hypothetical protein VITISV_006222 [Vitis vinifera]
Length=859

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 97/131 (74%), Gaps = 20/131 (15%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQ--------------------IFAGLKEKF  172
            M+   VTMEVGND VA+IT+SNPPVNALAL                     + AGLKEK+
Sbjct  1    MSKAEVTMEVGNDGVAVITMSNPPVNALALASTVYISEFLWNFDFGSLILCVIAGLKEKY  60

Query  173  TEALRRDDVKAIVLTGKGGTFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKP  352
             EA+RR+DVKAIV+TGKGG FSGGFDINVF+KVH+T D S LP+ S+DLL NT+EDAKKP
Sbjct  61   AEAMRRNDVKAIVVTGKGGRFSGGFDINVFQKVHKTADISHLPDASIDLLVNTVEDAKKP  120

Query  353  VVAAMQGLALG  385
             VAA++GLALG
Sbjct  121  SVAAVEGLALG  131



>ref|XP_011078309.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Sesamum indicum]
Length=724

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            M    VTMEVG+D VA+IT SNPPVNALAL +F GLKEKF+EA+RRDDVKAIV+TG GG 
Sbjct  1    MKQARVTMEVGSDGVAIITFSNPPVNALALTVFDGLKEKFSEAMRRDDVKAIVVTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+ VH+TGD S+LP+ SVD+ +N +ED KKP VAA+
Sbjct  61   FSGGFDINVFEMVHKTGDISILPDASVDIFTNVVEDGKKPTVAAI  105



>ref|XP_007013128.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
 gb|EOY30747.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
Length=724

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVGND VA+IT+SNPPVNALA+ I +GLKEKF EA RR DVKAIVLTG GG 
Sbjct  1    MAQIRVTMEVGNDGVAVITMSNPPVNALAIPIISGLKEKFDEATRRSDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD S++P+VS+DL+ N +ED KKP+VAA+
Sbjct  61   FSGGFDINVFQKVHGTGDISIMPDVSIDLVVNAMEDCKKPLVAAV  105



>ref|XP_010541187.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Tarenaya hassleriana]
Length=741

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVG+D VA+ITISNPPVN+LA  I +GLKEKF EA++R DVKAIVLTGKGG 
Sbjct  1    MAETRVTIEVGHDGVAVITISNPPVNSLAHPIISGLKEKFREAIQRSDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+K+H++G+ SLLP VSVDL+ N IED+KKPVVAA+
Sbjct  61   FSGGFDINVFQKIHKSGNISLLPEVSVDLVCNLIEDSKKPVVAAV  105



>ref|XP_006353465.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum tuberosum]
Length=724

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVGND VA+IT  NPPVNALA+QIFAGLKEK+ EA  R+DVKAIVLTG GG 
Sbjct  1    MAKAKVTMEVGNDGVAVITFVNPPVNALAIQIFAGLKEKWNEAAMRNDVKAIVLTGYGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH+T D SLLP+VSVDL+ N +ED KKP VAA+
Sbjct  61   FSGGFDINVFEKVHKTDDVSLLPDVSVDLVMNIMEDGKKPAVAAV  105



>ref|XP_004251613.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Solanum lycopersicum]
Length=724

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVGND VA+IT  NPPVNALA+QIFAGLKEK+ EA  R+DVKAIVLTG GG 
Sbjct  1    MAKAKVTMEVGNDGVAVITFVNPPVNALAIQIFAGLKEKWNEAAMRNDVKAIVLTGYGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVA  361
            FSGGFDINVF+KVH+T D SLLP+VSVDL++N +ED KKP VA
Sbjct  61   FSGGFDINVFEKVHKTDDVSLLPDVSVDLVTNIMEDGKKPAVA  103



>ref|XP_010047906.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Eucalyptus grandis]
 gb|KCW79920.1| hypothetical protein EUGRSUZ_C01261 [Eucalyptus grandis]
Length=724

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V MEVG D VA++T+SNPPVNALA+ I +GLKEKF EA+RR+DVKAIVLTG GG 
Sbjct  1    MARIGVAMEVGGDGVAVVTMSNPPVNALAIPILSGLKEKFDEAMRRNDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+K+H+TGD S+LP+VSV+L+ N +EDAKKP+VAA+
Sbjct  61   FSGGFDINVFEKIHKTGDISILPDVSVELVVNRMEDAKKPIVAAV  105



>emb|CDX97462.1| BnaC08g13270D [Brassica napus]
Length=721

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA QI +GLKEKF EA +R DVKAIVLTG GG FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASQIISGLKEKFQEANQRSDVKAIVLTGNGGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSVDL+ N +ED++KP+VAA+
Sbjct  67   DINVFQQVHKTGDISLMPEVSVDLVCNLMEDSRKPLVAAV  106



>ref|XP_008679760.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Zea mays]
Length=731

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI+NPPVNAL   I AGLK+K+ EALRRDDVKAIVLTG GG F GGF
Sbjct  8    VTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEALRRDDVKAIVLTGAGGKFCGGF  67

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD SL+P+VSV+L+SN +E+ KKP VAA+Q
Sbjct  68   DINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQ  108



>ref|NP_001148087.1| LOC100281695 [Zea mays]
 gb|ACG29687.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Zea mays]
Length=727

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI+NPPVNAL   I AGLK+K+ EA+RRDDVKAIVLTG GG F GGF
Sbjct  8    VTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEAMRRDDVKAIVLTGAGGKFCGGF  67

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD SL+P+VSV+L+SN +E+ KKP VAA+Q
Sbjct  68   DINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQ  108



>ref|XP_010915852.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Elaeis guineensis]
Length=725

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V+MEVG+D VA+ITISNPPVNAL  +I AGLKEK+TEA+ RDDVKA+VLTG  G 
Sbjct  1    MAGIWVSMEVGSDGVAVITISNPPVNALHPKIIAGLKEKYTEAMNRDDVKAVVLTGHMGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINVF +VH+TGD S LP+VSV+L+ NT+EDAKKP VAA+Q
Sbjct  61   FSGGFDINVFAEVHKTGDLSRLPDVSVELVVNTVEDAKKPSVAAIQ  106



>ref|XP_009109066.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Brassica rapa]
 emb|CDY66477.1| BnaA08g30740D [Brassica napus]
Length=721

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA QI +GLKEKF +A +R DVKAIVLTG GG FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASQIISGLKEKFQDANQRSDVKAIVLTGNGGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSVDL+ N +ED++KP+VAA+
Sbjct  67   DINVFQQVHKTGDISLMPEVSVDLVCNLMEDSRKPLVAAV  106



>ref|XP_002451943.1| hypothetical protein SORBIDRAFT_04g010370 [Sorghum bicolor]
 gb|EES04919.1| hypothetical protein SORBIDRAFT_04g010370 [Sorghum bicolor]
Length=727

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI+NPPVNAL   I AGLK+K+ EA+RRDDVKAIVLTG GG F GGF
Sbjct  8    VTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEAMRRDDVKAIVLTGAGGKFCGGF  67

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD SL+P+VSV+L+SN +E+ KKP VAA+Q
Sbjct  68   DINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQ  108



>ref|XP_010688243.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Beta vulgaris subsp. vulgaris]
Length=722

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P V+MEVG+D VALIT+SNPPVN+LA+ I  GLKE + EAL+R+DVKAIV+TG+ G 
Sbjct  1    MAKPRVSMEVGHDGVALITLSNPPVNSLAIPIIDGLKELYREALKRNDVKAIVITGESGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINVF+KVH+TGD SLLP+VS DLL  TIED++KP VAA+Q
Sbjct  61   FSGGFDINVFQKVHKTGDVSLLPDVSADLL-GTIEDSRKPSVAAIQ  105



>ref|XP_007204255.1| hypothetical protein PRUPE_ppa002052mg [Prunus persica]
 gb|EMJ05454.1| hypothetical protein PRUPE_ppa002052mg [Prunus persica]
Length=724

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNALA+ + AGLKEKF E  RR+DV+AIVLTG GG 
Sbjct  1    MAKVKVTLEVGNDGVAVITIFNPPVNALAIPLIAGLKEKFDEVARRNDVRAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH++GD SL+P+VSV+ L N +ED+KKPVVAA+
Sbjct  61   FSGGFDINVFEKVHKSGDVSLMPDVSVEFLVNKLEDSKKPVVAAV  105



>ref|XP_008242673.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Prunus mume]
Length=724

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNALA+ I AGLKEKF E  RR+DV+AIVLTG GG 
Sbjct  1    MAKVKVTLEVGNDGVAVITIFNPPVNALAIPIIAGLKEKFDEVARRNDVRAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH++GD SL+P+VSV+ + N +ED+KKPVVAA+
Sbjct  61   FSGGFDINVFEKVHKSGDVSLMPDVSVEFVVNKLEDSKKPVVAAV  105



>ref|XP_003528905.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Glycine max]
Length=724

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA+P V  EVG D VA+IT+ NPPVNALA+ I  GLK +F EA RR+DVKAIVLTGKGG 
Sbjct  1    MALPKVDFEVGTDGVAVITMCNPPVNALAIPIIMGLKNRFDEAARRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDI+V +KVH+TGD+S LP+VSV+L+ N+IED+KKPVVAA+
Sbjct  61   FSGGFDISVMQKVHQTGDSSHLPDVSVELVVNSIEDSKKPVVAAV  105



>ref|XP_010254066.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Nelumbo nucifera]
Length=727

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVG+D VA+IT+ NPPVNALA  I A LKEK+TEA+RR+DVKAIVLTG+GG 
Sbjct  1    MAKVGVTIEVGSDGVAIITMRNPPVNALAPSIIAALKEKYTEAMRRNDVKAIVLTGEGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINVF+ +H+ GD SLLP+VSV+L+ N +EDAKKP VAA+Q
Sbjct  61   FSGGFDINVFQTIHKNGDISLLPDVSVELVVNIMEDAKKPSVAAVQ  106



>ref|XP_006352155.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Solanum tuberosum]
Length=724

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVG D VA+ITI NPPVNALA+ I AGLKEK+TEA  R+DVKAIVLTG GG 
Sbjct  1    MAPVKVTMEVGTDGVAVITIFNPPVNALAIPIIAGLKEKWTEATMRNDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD S +P+VSVDL+ NT+ED KKP VAA+
Sbjct  61   FSGGFDINVFQKVHANGDTSQMPDVSVDLVVNTMEDGKKPAVAAI  105



>ref|XP_007152846.1| hypothetical protein PHAVU_004G164800g [Phaseolus vulgaris]
 gb|ESW24840.1| hypothetical protein PHAVU_004G164800g [Phaseolus vulgaris]
Length=724

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA+P V  EVG D VA+IT+ NPPVNALA+ I  GLK++F EA RR+DVKAIVLTGKGG 
Sbjct  1    MALPKVDFEVGADGVAVITMGNPPVNALAIPIIMGLKDRFDEAARRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDI+V KKVH+TGD+S LP+VSV+L+ N IED+KKPVVAA+
Sbjct  61   FSGGFDISVMKKVHDTGDSSHLPDVSVELVVNAIEDSKKPVVAAV  105



>ref|XP_006352154.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Solanum tuberosum]
Length=749

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVG D VA+ITI NPPVNALA+ I AGLKEK+TEA  R+DVKAIVLTG GG 
Sbjct  1    MAPVKVTMEVGTDGVAVITIFNPPVNALAIPIIAGLKEKWTEATMRNDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH  GD S +P+VSVDL+ NT+ED KKP VAA+
Sbjct  61   FSGGFDINVFQKVHANGDTSQMPDVSVDLVVNTMEDGKKPAVAAI  105



>ref|XP_009595622.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana tomentosiformis]
Length=724

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG+D VA+ITI NPPVNALA+ I AGLKEK+TEA  R+DVKAIVLTG GG FSGGF
Sbjct  6    VTMEVGSDGVAVITIFNPPVNALAIPIIAGLKEKWTEATMRNDVKAIVLTGNGGRFSGGF  65

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF+KVH TGD S +P+VSVDL+ NT+ED KKP VAA+
Sbjct  66   DINVFQKVHGTGDISQMPDVSVDLVVNTMEDGKKPAVAAI  105



>ref|XP_009129069.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Brassica rapa]
Length=722

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA  I +GLKEKF +A +R DVKAIVLTG GG FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFQDANQRSDVKAIVLTGNGGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VS+DL+ N +ED++KP+VAA+
Sbjct  67   DINVFQQVHKTGDISLMPEVSIDLVCNLMEDSRKPLVAAV  106



>emb|CDY35240.1| BnaA01g07910D [Brassica napus]
Length=722

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA  I +GLKEKF +A +R DVKAIVLTG GG FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFKDANQRSDVKAIVLTGNGGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VS+DL+ N +ED++KP+VAA+
Sbjct  67   DINVFQQVHKTGDISLMPEVSIDLVCNLMEDSRKPLVAAV  106



>ref|XP_009766308.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana sylvestris]
Length=724

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG+D VA+ITI NPPVN LA+ I AGLKEK+TEA  R+DVKAIVLTG GG FSGGF
Sbjct  6    VTMEVGSDGVAVITIFNPPVNPLAIPIIAGLKEKWTEATMRNDVKAIVLTGNGGRFSGGF  65

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF+KVH TGD S +P+VSVDL+ NT+ED KKP VAA+
Sbjct  66   DINVFQKVHGTGDISQMPDVSVDLVVNTMEDGKKPAVAAI  105



>ref|XP_010925875.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Elaeis guineensis]
Length=725

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V+MEVG++ VA+IT+SNPPVNAL   I AGLKEK+TEA+ RDDVKAIVLTG  G 
Sbjct  1    MAGIRVSMEVGSEGVAVITMSNPPVNALHPTIIAGLKEKYTEAMNRDDVKAIVLTGDVGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINVF ++H+TGD S LP+VSV+L+ NTIEDAKKP VAA+Q
Sbjct  61   FSGGFDINVFAEIHKTGDLSRLPDVSVELVVNTIEDAKKPSVAAIQ  106



>ref|XP_004242934.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum lycopersicum]
Length=723

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVG D VA+ITI NPPVNALA+ I AGLKEK+TEA  R+DVKAIVLTG GG 
Sbjct  1    MATLKVTMEVGIDGVAVITIFNPPVNALAIPIIAGLKEKWTEATMRNDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD S +P+VSV+L+ N +ED KKP VAA+
Sbjct  61   FSGGFDINVFQKVHATGDTSQMPDVSVNLVVNMMEDGKKPAVAAI  105



>emb|CDY06852.1| BnaC01g09510D [Brassica napus]
Length=722

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA  I +GLKEKF +A +R D+KAIVLTG GG FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFQDANQRSDIKAIVLTGNGGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VS+DL+ N +ED++KP+VAA+
Sbjct  67   DINVFQQVHKTGDISLMPEVSIDLVCNLMEDSRKPLVAAV  106



>ref|XP_003620604.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Medicago truncatula]
 gb|AES76822.1| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=722

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V  EVGND VA+IT+ NPPVNALA+ I  GLK KF EA RR+DVKAIVLTGKGG 
Sbjct  1    MASVKVDFEVGNDGVAVITMCNPPVNALAIPIIRGLKNKFEEAARRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDI+V +KVH+TGD +L+P+VSV+L+ N+IED+KKPVVAA+
Sbjct  61   FSGGFDISVMQKVHQTGDITLVPDVSVELVVNSIEDSKKPVVAAV  105



>dbj|BAD94583.1| AIM1 protein [Arabidopsis thaliana]
Length=399

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA  I +GLKEKF +A +R+DVKAIVL G  G FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFRDANQRNDVKAIVLIGNNGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSV+L+ N +ED++KPVVAA+
Sbjct  67   DINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAV  106



>ref|XP_006412890.1| hypothetical protein EUTSA_v10024533mg [Eutrema salsugineum]
 gb|ESQ54343.1| hypothetical protein EUTSA_v10024533mg [Eutrema salsugineum]
Length=721

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VA+ITISNPPVN+LA  I +GLKEKF +A +R D+KAIVLTG GG FSGGF
Sbjct  7    VTMEVGEDGVAVITISNPPVNSLASPIISGLKEKFQDANQRSDIKAIVLTGNGGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSVDL+ N +ED +KP+VAA+
Sbjct  67   DINVFQQVHKTGDISLMPEVSVDLVCNLMEDCRKPIVAAV  106



>gb|KHN20673.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Glycine soja]
Length=724

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA+P V  EVG D VA+IT+ NP VNALA+ I  GLK +F EA RR+DVKAIVLTGKGG 
Sbjct  1    MALPKVDFEVGTDGVAVITMCNPTVNALAIPIIMGLKNRFDEAARRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDI+V +KVH+TGD+S LP+VSV+L+ N+IED+KKPVVAA+
Sbjct  61   FSGGFDISVMQKVHQTGDSSHLPDVSVELVVNSIEDSKKPVVAAV  105



>gb|KFK29448.1| hypothetical protein AALP_AA7G135800 [Arabis alpina]
Length=721

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA  I +GLK+KF +A +R+DVKAIVL G GG FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASPIISGLKDKFRDANQRNDVKAIVLIGNGGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSVDL+ N +ED++KPVVAA+
Sbjct  67   DINVFQQVHKTGDLSLMPEVSVDLVCNLMEDSRKPVVAAV  106



>emb|CDM81268.1| unnamed protein product [Triticum aestivum]
Length=726

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +2

Query  53   MAVP-TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGG  229
            MA P  VTMEVG D VALITI NPPVNAL   I  GLKEK+ EAL RDDVKAIVLTG  G
Sbjct  1    MAGPIRVTMEVGADGVALITICNPPVNALHPIIIQGLKEKYAEALDRDDVKAIVLTGGSG  60

Query  230  TFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
             F GGFDINVF KVHETGD S+LP +S +L+SN +ED KKP VAA+Q
Sbjct  61   KFCGGFDINVFSKVHETGDASILPEMSFELVSNMMEDGKKPSVAAIQ  107



>ref|XP_010447902.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Camelina sativa]
Length=721

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITI+NPPVN+LA  I AGLKEKF +A +R+DVKAIVLTG  G FSGGF
Sbjct  7    VTMEVGNDGVAVITITNPPVNSLASPIIAGLKEKFQDANQRNDVKAIVLTGNNGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSV+L+ N +ED++KPVVAA+
Sbjct  67   DINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAV  106



>gb|AFS41246.1| cinnamoyl-CoA hydratase-dehydrogenase [Petunia x hybrida]
Length=724

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTMEVG D VA+ITI NPPVNALA+ I   LKEK+TEA  R+DVKAIVLTG GG 
Sbjct  1    MAQVKVTMEVGTDGVAVITIFNPPVNALAIPIINALKEKWTEATIRNDVKAIVLTGNGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF+KVH TGD S +P+VSVDL+ NT+ED KKP VAA+
Sbjct  61   FSGGFDINVFQKVHGTGDISQMPDVSVDLVVNTMEDCKKPAVAAI  105



>ref|XP_008775812.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Phoenix dactylifera]
Length=725

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V+MEV  D VA+ITISNPPVNAL  +I AGLKEK+ EA+ RDDVKA+VLTG  G 
Sbjct  1    MAGIWVSMEVCGDGVAVITISNPPVNALHPKIIAGLKEKYAEAMNRDDVKAVVLTGYMGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINVF +VH+TGD S LP+VSV+L+ NT+EDAKKP VAA+Q
Sbjct  61   FSGGFDINVFAEVHKTGDLSRLPDVSVELVVNTVEDAKKPSVAAIQ  106



>gb|EMT19952.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Aegilops tauschii]
Length=723

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +2

Query  53   MAVP-TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGG  229
            MA P  VTMEVG D VALITI NPPVNAL   I  GLKEK+ EAL RDDVKAIVLTG  G
Sbjct  1    MAGPIRVTMEVGADGVALITICNPPVNALHPIIIQGLKEKYAEALDRDDVKAIVLTGAAG  60

Query  230  TFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
             F GGFDINVF KVHETGD S+LP +S +L+SN +ED KKP VAA+Q
Sbjct  61   KFCGGFDINVFSKVHETGDVSILPEMSFELVSNLMEDGKKPSVAAIQ  107



>gb|EMS66784.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Triticum urartu]
Length=668

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI NPPVNAL   I  GLKEK+ EAL RDDVKAIVLTG  G F GGF
Sbjct  7    VTMEVGADGVALITICNPPVNALHPIIIEGLKEKYAEALGRDDVKAIVLTGAAGKFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVHETGD S+LP +S +L+SN +ED KKP VAA+Q
Sbjct  67   DINVFSKVHETGDVSILPEMSFELVSNMMEDGKKPSVAAIQ  107



>ref|XP_004952203.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X2 [Setaria italica]
Length=727

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI+NPPVNAL   I AGLK+K+ EA+RRDDV AIVLTG  G F GGF
Sbjct  8    VTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEAMRRDDVVAIVLTGAKGKFCGGF  67

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD SL+P+VSV+L+SN +E+ KKP VAA+Q
Sbjct  68   DINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQ  108



>ref|XP_010438362.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Camelina sativa]
Length=721

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTME+GND VA+ITI+NPPVN+LA  I AGLKEKF +A +R+DVKAIVLTG  G FSGGF
Sbjct  7    VTMEIGNDGVAVITITNPPVNSLASPIIAGLKEKFQDANQRNDVKAIVLTGNNGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSV+L+ N +ED++KPVVAA+
Sbjct  67   DINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAV  106



>ref|XP_010433148.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Camelina sativa]
Length=721

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTME+GND VA+ITI+NPPVN+LA  I AGLKEKF +A +R+DVKAIVLTG  G FSGGF
Sbjct  7    VTMEIGNDGVAVITITNPPVNSLASPIIAGLKEKFQDANQRNDVKAIVLTGNNGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSV+L+ N +ED++KPVVAA+
Sbjct  67   DINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAV  106



>ref|XP_009371440.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Pyrus x bretschneideri]
Length=724

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNALA+ I A LKEKF EA RR+DVKA+VLTG GG 
Sbjct  1    MAKAKVTLEVGNDGVAVITIFNPPVNALAIPIVASLKEKFEEAGRRNDVKAVVLTGSGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FS GFDINVF+KVHE+GD  ++P+VS D + NT+E +KKPVVAAM
Sbjct  61   FSAGFDINVFEKVHESGDVLVMPDVSFDFVLNTLEGSKKPVVAAM  105



>ref|XP_003572416.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein [Brachypodium distachyon]
Length=726

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI NPPVNAL   I  GLKEK+ EA+ RDDVKAIVLTG  G F GGF
Sbjct  7    VTMEVGADGVALITICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAAGKFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVHETGD +L+P+VSV+L+SN +E+ KKP VAA+Q
Sbjct  67   DINVFTKVHETGDVTLMPDVSVELVSNMMEEGKKPSVAAIQ  107



>ref|XP_006833340.1| hypothetical protein AMTR_s00109p00083880 [Amborella trichopoda]
 gb|ERM98618.1| hypothetical protein AMTR_s00109p00083880 [Amborella trichopoda]
Length=721

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            ++ M+VG D VA+ITISNPPVN+LA  I AGLKEK+ EA+RRDDVKAIVL G+GG FSGG
Sbjct  2    SLLMDVGADGVAVITISNPPVNSLATTIIAGLKEKYDEAIRRDDVKAIVLVGEGGKFSGG  61

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FDINV K+V +TGD S+LP+VSV LL++T+E A+KP VAA+Q
Sbjct  62   FDINVMKRVQKTGDKSILPDVSVALLNDTVEAARKPSVAAIQ  103



>ref|XP_004952202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X1 [Setaria italica]
Length=799

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI+NPPVNAL   I AGLK+K+ EA+RRDDV AIVLTG  G F GGF
Sbjct  8    VTMEVGADGVALITIANPPVNALHPIIIAGLKDKYAEAMRRDDVVAIVLTGAKGKFCGGF  67

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD SL+P+VSV+L+SN +E+ KKP VAA+Q
Sbjct  68   DINVFTKVHQTGDVSLMPDVSVELVSNMMEEGKKPSVAAIQ  108



>gb|EYU29809.1| hypothetical protein MIMGU_mgv1a002065mg [Erythranthe guttata]
Length=720

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGNDAVA++TISNPPVN L+  IF  LKE  TEA+ RDDVKA+VL G GG FSGGF
Sbjct  6    VTMEVGNDAVAILTISNPPVNVLSAAIFDRLKELLTEAMGRDDVKAVVLIGNGGKFSGGF  65

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            D+N+F++  + GD S++P+VSV+L  N IEDAKKPVVAA++G  LG
Sbjct  66   DVNIFERAQKAGDISIIPDVSVELFVNVIEDAKKPVVAALEGPVLG  111



>ref|XP_009413814.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VTM+VG+DAVA+ITI NPPVNALAL I AGLKEK+ EA+ R DVKAIVLTG+GG 
Sbjct  1    MAAVRVTMDVGSDAVAVITIRNPPVNALALPIVAGLKEKYAEAMSRSDVKAIVLTGEGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            F GG DIN+F  V +TGD SLLP+ SV+L+ N IEDA KP VAA+Q
Sbjct  61   FCGGLDINIFAAVQKTGDLSLLPDTSVELVVNVIEDAPKPSVAAIQ  106



>ref|XP_008800762.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Phoenix dactylifera]
Length=725

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V+MEVG+D VA+ITISNPPVNAL   I AGLKEK+TEA+ RDDVKAIVLTG  G 
Sbjct  1    MAGIRVSMEVGSDGVAVITISNPPVNALHPMIIAGLKEKYTEAMNRDDVKAIVLTGDVGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINV  ++H+TGD S LP+VSV+L+ N IEDAKKP VAA++
Sbjct  61   FSGGFDINVLAEIHKTGDLSRLPDVSVELVVNIIEDAKKPSVAAIR  106



>ref|XP_004512984.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Cicer arietinum]
Length=724

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V  EVGND VA+IT+ NPPVNALA+ I   LK KF EA RR+DVKAIVLTGKGG 
Sbjct  1    MASAKVDFEVGNDGVAVITMCNPPVNALAVPIIRALKYKFDEAARRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDI+V +KVH+TGD +L+P+VSV+L+ N+IED+KKP+VAA+
Sbjct  61   FSGGFDISVMQKVHQTGDITLVPDVSVELVVNSIEDSKKPIVAAV  105



>gb|KCW79923.1| hypothetical protein EUGRSUZ_C01265 [Eucalyptus grandis]
Length=724

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V M+VG D VA++T+SNPP N L + I +GLKEK  EA+ R+DVKAIVLTG GGT
Sbjct  1    MARIGVAMDVGGDGVAVVTMSNPPANVLTIPILSGLKEKLDEAMSRNDVKAIVLTGNGGT  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGL  376
             SGGFDINVF+K+H+TGD S+ P+VSV+L+ NT+EDAKKP+VAA++G 
Sbjct  61   VSGGFDINVFEKIHKTGDISIFPDVSVELVVNTMEDAKKPIVAAVEGF  108



>ref|NP_194630.1| fatty acid beta-oxidation multifunctional protein AIM1 [Arabidopsis 
thaliana]
 sp|Q9ZPI6.1|AIM1_ARATH RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1; AltName: Full=Protein ABNORMAL INFLORESCENCE 
MERISTEM 1; Short=AtAIM1; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA 
dehydrogenase [Arabidopsis thaliana]
 gb|AAD18041.1| AIM1 protein [Arabidopsis thaliana]
 emb|CAB43915.1| AIM1 protein [Arabidopsis thaliana]
 emb|CAB79659.1| AIM1 protein [Arabidopsis thaliana]
 gb|AAL24297.1| AIM1 protein [Arabidopsis thaliana]
 gb|AAL59895.1| putative AIM1 protein [Arabidopsis thaliana]
 gb|AAM20293.1| putative AIM1 protein [Arabidopsis thaliana]
 gb|AEE85572.1| fatty acid beta-oxidation multifunctional protein AIM1 [Arabidopsis 
thaliana]
Length=721

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+ITISNPPVN+LA  I +GLKEKF +A +R+DVKAIVL G  G FSGGF
Sbjct  7    VTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFRDANQRNDVKAIVLIGNNGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSV+L+ N +ED++KPVVAA+
Sbjct  67   DINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPVVAAV  106



>ref|XP_002867428.1| hypothetical protein ARALYDRAFT_491857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43687.1| hypothetical protein ARALYDRAFT_491857 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTM+VGND VA+ITISNPPVN+LA  I +GLKEKF +A +R+DVKAIVLTG  G FSGGF
Sbjct  7    VTMDVGNDGVAVITISNPPVNSLASPIISGLKEKFRDANQRNDVKAIVLTGNNGRFSGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD SL+P VSV+L+ N +ED++KP+VAA+
Sbjct  67   DINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPLVAAV  106



>ref|XP_003534202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Glycine max]
Length=724

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA+P V  EVG D VA+IT+ NPPVNALA+ I  GLK +F EA RR+DVKAIVLTGKGG 
Sbjct  1    MALPKVDFEVGADGVAVITMCNPPVNALAIPIIMGLKNRFDEAARRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKP  352
            FSGGFDI+V +KVH TGD+S LP+VSV+L+ N+IED+KKP
Sbjct  61   FSGGFDISVMQKVHRTGDSSHLPDVSVELVVNSIEDSKKP  100



>gb|KHN45635.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Glycine soja]
Length=724

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA+P V  EVG D VA+IT+ NPPVNALA+ I  GLK +F EA RR+DVKAIVLTGKGG 
Sbjct  1    MALPKVDFEVGADGVAVITMCNPPVNALAIPIIMGLKNRFDEAARRNDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKP  352
            FSGGFDI+V +KVH TGD+S LP+VSV+L+ N+IED+KKP
Sbjct  61   FSGGFDISVMQKVHRTGDSSHLPDVSVELVVNSIEDSKKP  100



>gb|EEE56719.1| hypothetical protein OsJ_06221 [Oryza sativa Japonica Group]
Length=448

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VA++TI NPPVNAL   I  GLKEK+ EA+ RDDVKAIVLTG GG F GGF
Sbjct  7    VTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGGKFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF +VH+TG+ SL+P+VSV+L+SN +E  KKP VAA+Q
Sbjct  67   DINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQ  107



>ref|XP_006283211.1| hypothetical protein CARUB_v10004242mg [Capsella rubella]
 gb|EOA16109.1| hypothetical protein CARUB_v10004242mg [Capsella rubella]
Length=721

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTM+VGND VA+ITISNPPVN+LA  I AGLKEKF +A +R+DV+AIVLTG  G F GGF
Sbjct  7    VTMDVGNDGVAVITISNPPVNSLASPIIAGLKEKFRDANQRNDVRAIVLTGNNGRFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DINVF++VH+TGD S++P VSVDL+ N +ED++KP+VAA+
Sbjct  67   DINVFQQVHKTGDLSVMPEVSVDLVCNLMEDSRKPLVAAV  106



>gb|EYU32938.1| hypothetical protein MIMGU_mgv1a002041mg [Erythranthe guttata]
Length=723

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEV  D VA++TISNPPVNALAL IF GLKEKF+EA+RRDDVKAIVL G  G FSGGF
Sbjct  6    VTMEV-IDGVAIVTISNPPVNALALTIFDGLKEKFSEAMRRDDVKAIVLAGNAGRFSGGF  64

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVV  358
            DINVF+ VH+TGD S+LP+ S+D+L N IED KKP V
Sbjct  65   DINVFETVHKTGDISVLPDTSIDVLVNVIEDGKKPTV  101



>ref|XP_008354516.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=410

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNAL +   A LKEKF EA+RR+DVKAIVLTG  G 
Sbjct  1    MAKVKVTLEVGNDGVAVITIFNPPVNALDIPTVASLKEKFEEAVRRNDVKAIVLTGNAGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FS GFDINVF KVHE+GD  ++P+VS D + NT+E++KKPVVAA+
Sbjct  61   FSAGFDINVFGKVHESGDVLVMPDVSFDXVLNTLENSKKPVVAAV  105



>gb|ABR18131.1| unknown [Picea sitchensis]
Length=723

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            V+MEVG D VA+I ++NPPVNALA+ + AGLKEK+ EA+RR+DVKAIV+TG GG FSGGF
Sbjct  6    VSMEVGADGVAIIKMTNPPVNALAVTVLAGLKEKYDEAMRRNDVKAIVVTGNGGKFSGGF  65

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINV ++V +TG+ S L  VSVDL+ NTIEDAKKP VAA+Q
Sbjct  66   DINVIQEVQQTGNLSHLGRVSVDLMINTIEDAKKPSVAAIQ  106



>ref|XP_006647155.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Oryza brachyantha]
Length=726

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            V+MEVG D VAL+TI NPPVNAL   I  GLKEK+ EA+ RDDVKAIVLTG GG F GGF
Sbjct  7    VSMEVGADGVALVTICNPPVNALHPIIIKGLKEKYAEAMDRDDVKAIVLTGAGGKFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF +VH+TG+ SL+P+VSV+L+SN +E  KKP VAA+Q
Sbjct  67   DINVFTEVHKTGNVSLMPDVSVELVSNLMEGGKKPSVAAIQ  107



>gb|AAL35606.1|AF442962_1 peroxisomal multifunctional protein [Oryza sativa]
Length=725

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VA++TI NPPVNAL   I  GLKEK+ EA+ RDDVKAIVLTG GG F GGF
Sbjct  7    VTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGGKFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF +VH+TG+ SL+P+VSV+L+SN +E  KKP VAA+Q
Sbjct  67   DINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQ  107



>gb|EEC72899.1| hypothetical protein OsI_06722 [Oryza sativa Indica Group]
Length=726

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VA++TI NPPVNAL   I  GLKEK+ EA+ RDDVKAIVLTG GG F GGF
Sbjct  7    VTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGGKFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF +VH+TG+ SL+P+VSV+L+SN +E  KKP VAA+Q
Sbjct  67   DINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQ  107



>ref|NP_001046536.1| Os02g0274100 [Oryza sativa Japonica Group]
 sp|Q8W1L6.2|MFP_ORYSJ RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein; Short=MFP; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Oryza sativa Japonica Group]
 dbj|BAD21833.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Oryza sativa Japonica Group]
 dbj|BAF08450.1| Os02g0274100 [Oryza sativa Japonica Group]
 gb|AGH17543.1| 3-hydroxyacyl-CoA dehydrogenase [Oryza sativa]
Length=726

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VA++TI NPPVNAL   I  GLKEK+ EA+ RDDVKAIVLTG GG F GGF
Sbjct  7    VTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGGKFCGGF  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF +VH+TG+ SL+P+VSV+L+SN +E  KKP VAA+Q
Sbjct  67   DINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQ  107



>gb|EMT05771.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Aegilops tauschii]
Length=661

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 82/110 (75%), Gaps = 9/110 (8%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALA------LQI---FAGLKEKFTEALRRDDVKAIVLTG  220
            VTMEVG D VALITI NPPVNAL       L +     GLKEK+ EA  RDDVKAIVLTG
Sbjct  7    VTMEVGADGVALITICNPPVNALHPISNALLSVPLGVGGLKEKYAEAADRDDVKAIVLTG  66

Query  221  KGGTFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
              G F GGFDINVF KVHETGD SL+P+VSVDL+SN +ED KKP VAA+Q
Sbjct  67   AAGKFCGGFDINVFTKVHETGDVSLMPDVSVDLVSNMMEDGKKPSVAAIQ  116



>ref|XP_008344094.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=579

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNAL +   A LKEKF EA+RR+DVKAIVLTG  G 
Sbjct  1    MAKVKVTLEVGNDGVAVITIFNPPVNALDIPTVASLKEKFEEAVRRNDVKAIVLTGNAGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FS GFDINVF KVHE+GD  ++P+VS D + NT+E++KKPVVAA+
Sbjct  61   FSAGFDINVFGKVHESGDVLVMPDVSFDXVLNTLENSKKPVVAAV  105



>dbj|BAK04391.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88897.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI NPPVNAL   I  GLK+K+ EA  RDDV+A+VLTG  G F GGF
Sbjct  9    VTMEVGADGVALITICNPPVNALHPIIIQGLKDKYAEAFHRDDVRAVVLTGAVGKFCGGF  68

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD S LP++S +L+SN +ED KKP VAA+Q
Sbjct  69   DINVFSKVHDTGDVSHLPDMSFELVSNMMEDGKKPSVAAIQ  109



>dbj|BAJ93145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI NPPVNAL   I  GLK+K+ EA  RDDV+A+VLTG  G F GGF
Sbjct  9    VTMEVGADGVALITICNPPVNALHPIIIQGLKDKYAEAFHRDDVRAVVLTGAVGKFCGGF  68

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DINVF KVH+TGD S LP++S +L+SN +ED KKP VAA+Q
Sbjct  69   DINVFSKVHDTGDVSHLPDMSFELVSNMMEDGKKPSVAAIQ  109



>ref|XP_008390228.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Malus domestica]
Length=724

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNAL +   A LKEKF EA+RR+DVKAIVLTG  G 
Sbjct  1    MAKVKVTLEVGNDGVAVITIFNPPVNALDIPTVASLKEKFEEAVRRNDVKAIVLTGNAGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FS GFDINVF KVHE+GD  ++P+VS D + NT+E++KKPVVAA+
Sbjct  61   FSAGFDINVFGKVHESGDVLVMPDVSFDXVLNTLENSKKPVVAAV  105



>gb|KDP33693.1| hypothetical protein JCGZ_07264 [Jatropha curcas]
Length=718

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVGND VA+I+ISNPPVNALA  I  GLKEKF E  RR+D++A V+TGK G F GG DI
Sbjct  1    MEVGNDGVAVISISNPPVNALAFPILEGLKEKFQEVARRNDIQAAVVTGKNGKFCGGLDI  60

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            N+ + VH+TG+ S+LP+VSVDLL N +ED KKPVVAA+
Sbjct  61   NIMQTVHQTGNASILPSVSVDLLINLVEDCKKPVVAAV  98



>ref|XP_009371482.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Pyrus x bretschneideri]
Length=479

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   V +EVG D VA+ITI NPPVNALA+   A LKEKF EA RR+DVKA+VLTG  G 
Sbjct  1    MAKAKVNLEVGGDGVAVITIFNPPVNALAIPTVASLKEKFEEAGRRNDVKAVVLTGNAGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FS GFDINVF KVHE+GD  ++P+VS D + NT+E++KKPVVAA+
Sbjct  61   FSAGFDINVFGKVHESGDVLVMPDVSFDFVLNTLENSKKPVVAAV  105



>ref|XP_010089223.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
 gb|EXB37512.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
AIM1 [Morus notabilis]
Length=724

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVG+D +A+I+ISNPPVNALAL IF GL+ KF EA RR+DVKAIVLTGKGG 
Sbjct  1    MARAEVTLEVGDDGIAIISISNPPVNALALSIFVGLQRKFDEAARRNDVKAIVLTGKGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDINVF+K+H+ G+ S LPN S DL+ NTIE+++KP+VAA++GLALG
Sbjct  61   FSGGFDINVFEKIHKNGNISALPNTSFDLILNTIEESEKPIVAAIEGLALG  111



>gb|AAQ13901.1| multifunctional protein [Oryza sativa]
Length=718

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA++TI NPPVNAL   I  GLKEK+ EA+ RDDVKAIVLTG GG F GGFDI
Sbjct  1    MEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGGKFCGGFDI  60

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            NVF +VH+TG+ SL+P+VSV+L+SN +E  KKP VAA+Q
Sbjct  61   NVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQ  99



>ref|XP_009374040.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1 [Pyrus x bretschneideri]
Length=734

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA   VT+EVGND VA+ITI NPPVNALA+ I AGL EKF EA RR+DVKAIVLTG GG 
Sbjct  11   MAKVKVTLEVGNDGVAVITIFNPPVNALAIPIIAGLNEKFEEAGRRNDVKAIVLTGSGGR  70

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDINVF+KVHE+GD S+LP+VSVD + NT+ED+KKPVVAA+Q
Sbjct  71   FSGGFDINVFEKVHESGDVSILPDVSVDFVVNTLEDSKKPVVAAVQ  116



>ref|XP_006833339.1| hypothetical protein AMTR_s00109p00082150 [Amborella trichopoda]
 gb|ERM98617.1| hypothetical protein AMTR_s00109p00082150 [Amborella trichopoda]
Length=721

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            ++ M+VG D VA++TISNPPVN+LA  I AGLKEK+ EA+RRDDVKAIVL G+GG F GG
Sbjct  2    SLLMDVGADGVAVMTISNPPVNSLATTIIAGLKEKYDEAIRRDDVKAIVLVGEGGKFCGG  61

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FDINV ++V +TG+ S  P +SV LL++TIE A+KP VAA+Q
Sbjct  62   FDINVMQRVQKTGERSTPPGISVVLLNDTIEAARKPSVAAIQ  103



>ref|XP_007013129.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
 gb|EOY30748.1| Enoyl-CoA hydratase/isomerase family [Theobroma cacao]
Length=745

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MAV  VTMEVGND VA+I+ISNPP+N L + I A +KEKF+EA RR DVKAIVLTGKGG 
Sbjct  1    MAVTVVTMEVGNDGVAVISISNPPLNVLTVAIIAAMKEKFSEATRRSDVKAIVLTGKGGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIE  337
            FSGGFDI+ F+KVH++GD S  PN S DL+ NTIE
Sbjct  61   FSGGFDISAFQKVHKSGDVSDSPNESFDLIVNTIE  95



>emb|CDP03312.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P VTMEVGND VA+I+I NPPVN+LA+ I AG+KE F EA+RR+DVKA+V+ GKGG 
Sbjct  1    MAKPGVTMEVGNDGVAVISIYNPPVNSLAIPILAGIKEMFDEAVRRNDVKALVVFGKGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDINVF  VH+TGDNS+LP+VS+DLL NTI DAKKP VAA+
Sbjct  61   FSGGFDINVFGNVHKTGDNSVLPDVSIDLLVNTIGDAKKPAVAAV  105



>gb|KJB07187.1| hypothetical protein B456_001G006400 [Gossypium raimondii]
Length=721

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            M+   VTMEVG+D VA+ITI NPP+N +A+ I AGL EKF E  RR+DVKA VLTG GG 
Sbjct  1    MSQIRVTMEVGDDGVAVITIFNPPLNTMAVPIIAGLMEKFDEVSRRNDVKAAVLTGSGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            F GG D+N+ +KVH TGD SL+P+ SVDL    IED KKP+VAA++
Sbjct  61   FCGGLDLNLIQKVHLTGDVSLVPHASVDLALTAIEDCKKPIVAAIK  106



>gb|KJB07188.1| hypothetical protein B456_001G006400 [Gossypium raimondii]
Length=719

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            M+   VTMEVG+D VA+ITI NPP+N +A+ I AGL EKF E  RR+DVKA VLTG GG 
Sbjct  1    MSQIRVTMEVGDDGVAVITIFNPPLNTMAVPIIAGLMEKFDEVSRRNDVKAAVLTGSGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            F GG D+N+ +KVH TGD SL+P+ SVDL    IED KKP+VAA++
Sbjct  61   FCGGLDLNLIQKVHLTGDVSLVPHASVDLALTAIEDCKKPIVAAIK  106



>ref|XP_004952201.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Setaria italica]
Length=727

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALITI NPPVNAL   IF GL EK+ EA+ RDDVKAIVLTG  G F GGF
Sbjct  9    VTMEVGADGVALITICNPPVNALHPAIFDGLSEKYGEAMARDDVKAIVLTGDAGKFCGGF  68

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DIN F ++H+TG+ SLLP+ SV L S+ +E  +KP VAA+Q
Sbjct  69   DINTFARIHQTGNMSLLPD-SVKLASHMMEGGRKPSVAAIQ  108



>ref|XP_004515676.1| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Cicer 
arietinum]
Length=285

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  110  ISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDINVFKKVHETGDN  289
            + NPPVNALA+ I   LK KF EA +R+DVKAIVLTGKGG FSGGFDI+V +KVH+TGD 
Sbjct  1    MCNPPVNALAIPIIWALKYKFDEAAKRNDVKAIVLTGKGGRFSGGFDISVMQKVHQTGDI  60

Query  290  SLLPNVSVDLLSNTIEDAKKPVVAAM  367
            +L+P+VSV+L+ N+IED+KKP+VAA+
Sbjct  61   TLVPDVSVELVVNSIEDSKKPIVAAV  86



>ref|XP_008646894.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein-like [Zea mays]
Length=685

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VALIT+ NPPVNAL   IFAGL E + EA+ RDDVKAIVL G  G F GGF
Sbjct  9    VTMEVGTDGVALITMCNPPVNALHPAIFAGLWENYGEAMARDDVKAIVLKGARGKFCGGF  68

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            DIN F ++H TGD SLLP+ SV   S  +E+ KKP VAA+Q
Sbjct  69   DINTFSQIHRTGDMSLLPD-SVKFASYMMEEGKKPSVAAIQ  108



>ref|XP_006354399.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum tuberosum]
Length=712

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            V+ E+G D +A+I I NPPVNALAL +  GLKE++ EA+ R+DVKAIVLTG    F GG 
Sbjct  8    VSTEIGKDGIAIIRIRNPPVNALALSVIDGLKEQYEEAVERNDVKAIVLTGD-DKFCGGL  66

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            DIN+ +KV + GD S LP+ SV+L+ +TIE+ KKP VAA+QG ALG
Sbjct  67   DINIIQKVQKNGDTSFLPDASVELVIDTIENGKKPSVAAIQGFALG  112



>gb|KHG01746.1| Peroxisomal fatty acid beta-oxidation multifunctional AIM1 -like 
protein [Gossypium arboreum]
Length=723

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+I+ISNPP+N +   + A LKEKF EA RR DVKAIVLTGKGG FSGGF
Sbjct  5    VTMEVGNDGVAVISISNPPLNIINAAMLAALKEKFGEATRRRDVKAIVLTGKGGRFSGGF  64

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DIN F+  + +GD S     S+DL+ NTIED KKPVVAA+
Sbjct  65   DINAFQ--NPSGDTSDRAIESIDLVLNTIEDCKKPVVAAI  102



>gb|KJB64948.1| hypothetical protein B456_010G073100 [Gossypium raimondii]
Length=723

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVGND VA+I+ISNPP+N +   + A LKEKF EA RR DVKAIVLTGKGG FSGGF
Sbjct  5    VTMEVGNDGVAVISISNPPLNIINAAMLAALKEKFGEATRRRDVKAIVLTGKGGRFSGGF  64

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            DIN F+  + +GD S     S+DL+ NTIED KKPVVAA+
Sbjct  65   DINAFQ--NPSGDTSDRTIESIDLVLNTIEDCKKPVVAAI  102



>ref|XP_002978003.1| hypothetical protein SELMODRAFT_176660 [Selaginella moellendorffii]
 gb|EFJ20660.1| hypothetical protein SELMODRAFT_176660 [Selaginella moellendorffii]
Length=721

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P V++EVG D VA+IT+ NPPVNALA+ +  GLKEK+ EA  R+DVKAIV+TG  G 
Sbjct  1    MARPGVSLEVGADKVAVITLRNPPVNALAMPVLWGLKEKYEEACSREDVKAIVVTGANGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDI+  + V  +G+ S L  +SVDL++  IE+A KP VAA+Q
Sbjct  61   FSGGFDISTIQDVQASGNMSALGRISVDLMTKLIEEAGKPSVAAIQ  106



>ref|XP_002966745.1| hypothetical protein SELMODRAFT_168461 [Selaginella moellendorffii]
 gb|EFJ32772.1| hypothetical protein SELMODRAFT_168461 [Selaginella moellendorffii]
Length=721

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA P V++EVG D VA+IT+ NPPVNALA+ +  GLKEK+ EA  R+DVKAIV+TG  G 
Sbjct  1    MARPGVSLEVGADKVAVITLRNPPVNALAMPVLWGLKEKYEEACSREDVKAIVVTGANGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQ  370
            FSGGFDI+  + V  +G+ S L  +SVDL++  IE+A KP VAA+Q
Sbjct  61   FSGGFDISTIQDVQASGNMSALGRISVDLMTKLIEEAGKPSVAAIQ  106



>gb|KHG02088.1| Peroxisomal fatty acid beta-oxidation multifunctional AIM1 -like 
protein [Gossypium arboreum]
Length=101

 Score =   115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            M+   V MEVG+D+VA+ITI NPP+N +A+ I AGL EKF E  RR+DVKA VLTG GG 
Sbjct  1    MSQIRVMMEVGDDSVAVITIFNPPLNTMAVSIIAGLMEKFDEVSRRNDVKAAVLTGSGGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIE  337
            F GG D+NV +KVH TGD SL+P  SVDL    IE
Sbjct  61   FCGGLDLNVIQKVHLTGDVSLVPQASVDLALTAIE  95



>ref|XP_010325170.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Solanum lycopersicum]
Length=710

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            ++ ME+GND VA+IT+ NPPVNAL L     LK  + EA+  D+VKAIVLTG  G F GG
Sbjct  6    SINMEIGNDGVAVITMINPPVNALTLSAIEELKRCYQEAIDCDNVKAIVLTGADGRFCGG  65

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+V + VH+ GD SLLP+ S+ L+ N IE+ KKP VAA+QG ALG
Sbjct  66   LDISVMENVHKHGDISLLPDASIGLVVNKIENGKKPSVAAIQGFALG  112



>gb|EMS59767.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
[Triticum urartu]
Length=749

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 82/135 (61%), Gaps = 34/135 (25%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALA------LQI---FAGLKEKFTEALRRDDVKAIVLT-  217
            VTMEVG D VALITI NPPVNAL       L +     GLKEK+ EA  RDDVKAIVLT 
Sbjct  7    VTMEVGADGVALITICNPPVNALHPISNALLSVPFGVGGLKEKYAEAADRDDVKAIVLTV  66

Query  218  --GKGGTFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIE------------------  337
              G  G F GGFDINVF KVHETGD SL+P+VSVDL+SN +E                  
Sbjct  67   FIGAAGKFCGGFDINVFTKVHETGDVSLMPDVSVDLVSNMMEGTSKFVLVSQYLGLTVKT  126

Query  338  ----DAKKPVVAAMQ  370
                D KKP VAA+Q
Sbjct  127  SLHADGKKPSVAAIQ  141



>dbj|BAG80663.1| multifunctional protein [Nicotiana tabacum]
Length=668

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            ++ ME+GND VA+IT+ NPPVNAL L     LK  + EA+  D VKAIVL+G  G F GG
Sbjct  6    SINMEIGNDGVAVITVHNPPVNALTLSALEELKRCYQEAIDSDTVKAIVLSGADGRFCGG  65

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+V + VH+ GD SLLP+ S+ L+ N +E+ KKP VAA+QG ALG
Sbjct  66   LDISVVENVHKHGDISLLPDASIGLVVNKMENGKKPSVAAIQGFALG  112



>ref|XP_009787311.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana sylvestris]
 ref|XP_009787312.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana sylvestris]
Length=710

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            ++ ME+GND VA+IT+ NPPVNAL L     LK  + EA+  D VKAIVL+G  G F GG
Sbjct  6    SINMEIGNDGVAVITVHNPPVNALTLSALEELKRCYQEAIDSDTVKAIVLSGADGRFCGG  65

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+V + VH+ GD SLLP+ S+ L+ N +E+ KKP VAA+QG ALG
Sbjct  66   LDISVVENVHKHGDISLLPDASIGLVVNKMENGKKPSVAAIQGFALG  112



>ref|XP_009604119.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Nicotiana tomentosiformis]
Length=710

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            ++ ME+GND VA+ITI NPPVNAL L     LK  + EA+  D VKAIVL+G  G F GG
Sbjct  6    SINMEIGNDGVAVITILNPPVNALTLSAIEELKRCYQEAIDSDSVKAIVLSGADGRFCGG  65

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+V + VH+ GD SLLP+ S+ L+ N +E+ KKP VAA+QG ALG
Sbjct  66   LDISVVENVHKHGDISLLPDASIGLVVNKMENGKKPSVAAIQGFALG  112



>ref|XP_001773623.1| predicted protein [Physcomitrella patens]
 gb|EDQ61511.1| predicted protein [Physcomitrella patens]
Length=732

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            +V M+VG DAVA+ITI NPPVN+LA+     LKE++ EA  RDDVKAIV+TG  G FSGG
Sbjct  4    SVKMDVGADAVAVITIDNPPVNSLAIPALIALKERYNEANARDDVKAIVVTGANGKFSGG  63

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FDI+VF K+ E G N  L   SVDL+  TIE+A KP VAA+
Sbjct  64   FDISVFPKLQEGGSNGYLNQASVDLMIETIEEASKPTVAAV  104



>ref|XP_011010197.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Populus euphratica]
Length=726

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VALITI NPPVN+L+L +   LK+ F +ALRRDDVKAIV+TG  G FSGGFD
Sbjct  11   TIEVGADGVALITIINPPVNSLSLDVLYSLKDSFEQALRRDDVKAIVITGAKGKFSGGFD  70

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  V     N   P  +SV++LS+T+E AKKP VAA+ GLALG
Sbjct  71   ISSFGGVQGGKSNEPKPGFISVEVLSDTVEAAKKPSVAAIDGLALG  116



>ref|XP_006654304.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Oryza brachyantha]
Length=718

 Score =   120 bits (300),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  + +MEV  D VA+IT+SNPPVNAL+L + A L+  + EALRR DVKAIVLTG  G 
Sbjct  1    MARGSTSMEVRRDGVAVITVSNPPVNALSLDVIASLQRDYEEALRRSDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            F GGFDIN F K  +     LL   S+D L++ +EDA+KP VAA+ G+ALG
Sbjct  61   FCGGFDINAFDKKPKNEKPGLL---SIDFLTDVVEDAQKPSVAAIDGIALG  108



>ref|XP_002516946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45560.1| conserved hypothetical protein [Ricinus communis]
Length=148

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VALITI NPPVN+L+  +   LK+ F +ALRRDDVKAIV+TG  G FSGGFDI
Sbjct  11   IEVGADGVALITIINPPVNSLSFDVLHSLKDSFEQALRRDDVKAIVVTGAKGKFSGGFDI  70

Query  254  NVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  V   T D      +SV+++++T+E A+KP VAA++GLALG
Sbjct  71   SAFGGVQGGTVDQPKPGYISVEIVTDTLEAARKPSVAAIEGLALG  115



>ref|XP_007154174.1| hypothetical protein PHAVU_003G096400g [Phaseolus vulgaris]
 gb|ESW26168.1| hypothetical protein PHAVU_003G096400g [Phaseolus vulgaris]
Length=779

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG+D VA+ITI NPPVN+L+ ++  GLKE F +A++R+DVKAIV+TG  G FSGGFDI
Sbjct  66   MEVGSDGVAVITIVNPPVNSLSFEVLHGLKESFDQAIKRNDVKAIVVTGAKGKFSGGFDI  125

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + E  D      +S++++++TIE A+KP VAA+ GLALG
Sbjct  126  SAFGGIQEAKDRPKPGWISIEIITDTIEAARKPSVAAIDGLALG  169



>ref|XP_002270067.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Vitis vinifera]
Length=724

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VALIT+ NPPVN+L+  +   LKE + EALRRDDVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGADGVALITLINPPVNSLSFDVLNSLKESYEEALRRDDVKAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +   G+ S    VSV++L++T+E A+KP VAA+ GLALG
Sbjct  71   TAFGGIQAGGEVSKPGFVSVEILTDTVEAARKPSVAAIDGLALG  114



>ref|XP_002314377.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
 gb|EEF00548.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
Length=726

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VALITI NPPVN+L+  +   LK+ F +ALRRDDVKAIV+TG  G FSGGFD
Sbjct  11   TIEVGADGVALITIINPPVNSLSFDVLYSLKDSFEQALRRDDVKAIVITGAKGKFSGGFD  70

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  V     N   P  +SV++LS+T+E AKKP VAA+ GLALG
Sbjct  71   ISSFGGVQGGKSNEPKPGFISVEILSDTVEAAKKPSVAAIDGLALG  116



>ref|XP_006365183.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365184.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like isoform X2 [Solanum tuberosum]
Length=710

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            ++ ME+GND VA+IT+ NPPVNAL L     LK  + EA+  D+VKAIVL+G  G F GG
Sbjct  6    SINMEIGNDGVAVITMINPPVNALTLSAIEELKRFYQEAIDCDNVKAIVLSGANGRFCGG  65

Query  245  FDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+V + VH+ GD SLLP+ S+ L+ N IE+  KP VAA+QG ALG
Sbjct  66   LDISVMENVHKHGDISLLPDASIGLVVNKIENGNKPSVAAIQGFALG  112



>ref|XP_007035631.1| Multifunctional protein 2 [Theobroma cacao]
 gb|EOY06557.1| Multifunctional protein 2 [Theobroma cacao]
Length=725

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 5/108 (5%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+IT+ NPPVN+L+L +   LKE F EALRRDDVKAIV+TG  G FSGGFD
Sbjct  10   TVEVGADGVAVITMINPPVNSLSLDVLQSLKESFDEALRRDDVKAIVVTGAKGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F ++   G N   P    +SV++LS+T+E A+KP VAA+ GLALG
Sbjct  70   ITAFGRIQ--GGNVEQPKPGYISVEVLSDTLEAARKPSVAAIDGLALG  115



>ref|XP_006349823.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Solanum tuberosum]
Length=727

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +2

Query  29   SANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAI  208
            S+N  G+       T+EVG D VA+ITI NPPVN+LAL +   LKE + +ALRRDDVKAI
Sbjct  4    SSNPKGR------TTIEVGADGVAVITIINPPVNSLALDVLYSLKENYDQALRRDDVKAI  57

Query  209  VLTGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            V+TG  G FSGGFDI  F K+      S  P  +SV++L++T+E A+KP VAA+ GLALG
Sbjct  58   VVTGANGRFSGGFDIGAFGKLQGGTVESPKPGFISVEILTDTVEAARKPSVAAIDGLALG  117



>dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation multifunctional 
protein [Capsicum chinense]
Length=725

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 85/121 (70%), Gaps = 7/121 (6%)
 Frame = +2

Query  26   LSANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKA  205
            +S+N  G+       T++VG D VA+ITI NPPVN+LAL +   LKE + +ALRRDDVKA
Sbjct  1    MSSNTKGR------TTIDVGADGVAVITIINPPVNSLALDVLYSLKENYEQALRRDDVKA  54

Query  206  IVLTGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLAL  382
            IV+TG  G FSGGFDI+ F K+      S  P  +SV++L++T+E A+KP VAA+ GLAL
Sbjct  55   IVVTGANGKFSGGFDISAFGKLQGGTVESPKPGFISVEILTDTVEAARKPSVAAIDGLAL  114

Query  383  G  385
            G
Sbjct  115  G  115



>ref|NP_001055313.1| Os05g0362100 [Oryza sativa Japonica Group]
 gb|AAV31399.1| putative glyoxysomal fatty acid beta-oxidation multifunctional 
protein [Oryza sativa Japonica Group]
 dbj|BAF17227.1| Os05g0362100 [Oryza sativa Japonica Group]
 dbj|BAG94454.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  + ++EV  D VA+IT+SNPPVNAL+L + A L+  + EALRR DVKAIVLTG  G 
Sbjct  1    MARGSTSVEVRRDGVAVITVSNPPVNALSLDVIASLQRDYGEALRRSDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDIN F K  +      L   S+D L++ +EDA KP VAA+ G+ALG
Sbjct  61   FSGGFDINAFDKKPKNEKPGYL---SIDFLTDIVEDAPKPSVAAIDGVALG  108



>gb|EMT14630.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Aegilops tauschii]
Length=403

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 79/116 (68%), Gaps = 5/116 (4%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA    TMEV +D VA+ITISNPPVNAL+  + A L+  + EALRR+DVKAIVLTG  G 
Sbjct  1    MARGATTMEVRDDGVAVITISNPPVNALSFDVIASLQRNYEEALRRNDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFK----KVHETGDNSLLP-NVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDIN F      V  T   +  P + S+D L+  +EDA+KP VAA+ G+ALG
Sbjct  61   FSGGFDINGFGNKPISVSPTHPENEKPGSFSIDFLTGVVEDAQKPSVAAIDGVALG  116



>ref|XP_009622777.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nicotiana tomentosiformis]
Length=725

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 85/121 (70%), Gaps = 7/121 (6%)
 Frame = +2

Query  26   LSANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKA  205
            +S+N  G+       T+EVG D VA+ITI NPPVN+L+L +   LKE + +AL+RDDVKA
Sbjct  1    MSSNPKGR------TTIEVGADGVAVITIINPPVNSLSLDVLYSLKESYEQALKRDDVKA  54

Query  206  IVLTGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLAL  382
            IV+TG  G FSGGFDI+ F K+      S  P  +SV++L++T+E A+KP VAA+ GLAL
Sbjct  55   IVVTGANGKFSGGFDISAFGKLQGGTVESPKPGFISVEILTDTVEAARKPSVAAIDGLAL  114

Query  383  G  385
            G
Sbjct  115  G  115



>ref|XP_002439650.1| hypothetical protein SORBIDRAFT_09g017970 [Sorghum bicolor]
 gb|EES18080.1| hypothetical protein SORBIDRAFT_09g017970 [Sorghum bicolor]
Length=718

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  T TMEV  D VA+ITISNPPVNAL+L + A L+  +TEAL R+D+KAIVLTG  G 
Sbjct  1    MARGTTTMEVRADGVAVITISNPPVNALSLDVIASLQRNYTEALSRNDIKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            F GGFDI+ F K      N    ++S+D L++ +EDA KP VAA+ G+ALG
Sbjct  61   FCGGFDISAFGK---KPKNEKPGSMSIDFLTDIVEDAHKPSVAAIDGIALG  108



>ref|XP_010314711.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a isoform X2 [Solanum lycopersicum]
Length=726

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = +2

Query  29   SANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAI  208
            S+N  G+       T+EVG D VA+ITI NPPVN+LAL +   LKE + +ALRRDDVKAI
Sbjct  4    SSNPKGR------TTIEVGADGVAVITIINPPVNSLALDVLYSLKENYDQALRRDDVKAI  57

Query  209  VLTGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            V+ G  G FSGGFDI+ F K+ + G  S  P  +SV++L++T+E A+KP VAA+ GLALG
Sbjct  58   VVIGANGKFSGGFDISAFGKL-QGGTESPKPGFISVEILTDTVEAARKPSVAAIDGLALG  116



>ref|XP_009769326.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nicotiana sylvestris]
Length=725

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 85/121 (70%), Gaps = 7/121 (6%)
 Frame = +2

Query  26   LSANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKA  205
            +S+N  G+       T+EVG D VA+ITI NPPVN+L+L +   LKE + +AL+RDDVKA
Sbjct  1    MSSNPKGR------TTIEVGADGVAVITIINPPVNSLSLDVLYSLKESYEQALKRDDVKA  54

Query  206  IVLTGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLAL  382
            IV+TG  G FSGGFDI+ F K+      S  P  +SV++L++T+E A+KP VAA+ GLAL
Sbjct  55   IVVTGAKGKFSGGFDISAFGKLQGGTVESPKPGFISVEILTDTVEAARKPSVAAIDGLAL  114

Query  383  G  385
            G
Sbjct  115  G  115



>ref|XP_001765398.1| predicted protein [Physcomitrella patens]
 gb|EDQ69861.1| predicted protein [Physcomitrella patens]
Length=722

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            +V MEVG D VA+ITI NPPVN+LA+ +  GLKEK+ EA +RDDVKAIV+TG  G FSGG
Sbjct  4    SVNMEVGADGVAVITIQNPPVNSLAIDVLLGLKEKYVEAAKRDDVKAIVVTGANGKFSGG  63

Query  245  FDINVFKKVHETG--DNSLLPNVSVDLLSNTIEDAKKP  352
            FDI  F K+ + G   N  L  VS DL+  TIE+A KP
Sbjct  64   FDITAFPKIQQGGKCSNGYLSKVSTDLMIETIEEASKP  101



>ref|XP_004252912.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a isoform X1 [Solanum lycopersicum]
Length=727

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +2

Query  29   SANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAI  208
            S+N  G+       T+EVG D VA+ITI NPPVN+LAL +   LKE + +ALRRDDVKAI
Sbjct  4    SSNPKGR------TTIEVGADGVAVITIINPPVNSLALDVLYSLKENYDQALRRDDVKAI  57

Query  209  VLTGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            V+ G  G FSGGFDI+ F K+      S  P  +SV++L++T+E A+KP VAA+ GLALG
Sbjct  58   VVIGANGKFSGGFDISAFGKLQGGTVESPKPGFISVEILTDTVEAARKPSVAAIDGLALG  117



>ref|XP_003529561.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Glycine max]
Length=724

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFDI
Sbjct  10   MEVGPDGVAVITIVNPPVNSLSFDVLRSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFDI  69

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + E  +      +SV+++++TIE A+KP VAA+ GLALG
Sbjct  70   SAFGGIQEAKERPKPGWISVEIITDTIEAARKPSVAAIDGLALG  113



>gb|EEE63425.1| hypothetical protein OsJ_18237 [Oryza sativa Japonica Group]
Length=718

 Score =   116 bits (290),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  + ++EV  D VA+IT+SNPPVNAL+L + A L+  + EALRR DVKAIVLTG  G 
Sbjct  1    MARGSTSVEVRRDGVAVITVSNPPVNALSLDVIASLQRDYGEALRRSDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDIN F K  +      L   S+D L++ +EDA KP VAA+ G+ALG
Sbjct  61   FSGGFDINAFDKKPKNEKPGYL---SIDFLTDIVEDAPKPSVAAIDGVALG  108



>gb|ABK24476.1| unknown [Picea sitchensis]
Length=726

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 5/111 (5%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            V +EVG+D VALITI+NPPVN+L++ +  GLKEK+ EAL+RDDVKAIV+TG GG F GGF
Sbjct  6    VDIEVGSDGVALITITNPPVNSLSVDVLLGLKEKYDEALQRDDVKAIVITGSGGKFCGGF  65

Query  248  DINVFKKVHE-----TGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            DI     +        G+   L +VSV +++   E AKKP VAA+ GLALG
Sbjct  66   DIGTLGGLQHGAVKIGGEQFELTDVSVKIITELFEGAKKPSVAAIDGLALG  116



>gb|KHN02955.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Glycine soja]
Length=724

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFDI
Sbjct  10   MEVGPDGVAVITIVNPPVNSLSFDVLRSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFDI  69

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + E  +      +SV+++++TIE A+KP VAA+ GLALG
Sbjct  70   SAFGGIQEAKERPKPGWISVEIITDTIEAARKPSVAAIDGLALG  113



>dbj|BAJ85471.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA    TMEV +D VA+ITISNPPVNAL+  + A L+  + EALRR+DVKAIVLTG  G 
Sbjct  1    MARGATTMEVRDDGVAVITISNPPVNALSFDVIASLQRNYEEALRRNDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDIN F        N    + S+D L+  +EDA+KP VAA+ G+ALG
Sbjct  61   FSGGFDINGFG---NKPKNEKPGSFSIDFLTGVVEDAQKPSVAAIDGVALG  108



>ref|NP_001234975.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Glycine max]
 dbj|BAG09370.1| peroxisomal fatty acid beta-oxidation multifunctional protein 
[Glycine max]
Length=723

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFDI
Sbjct  10   MEVGPDGVAVITIVNPPVNSLSFDVLRSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFDI  69

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + E  +      +SV+++++TIE A+KP VAA+ GLALG
Sbjct  70   SAFGGIQEAKERPKPGWISVEIITDTIEAARKPSVAAIDGLALG  113



>gb|EEC79068.1| hypothetical protein OsI_19644 [Oryza sativa Indica Group]
Length=718

 Score =   115 bits (289),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  + ++EV  D VA+IT+SNPPVNAL+L + A L+  + EALRR DVKAIVLTG  G 
Sbjct  1    MARGSTSVEVRRDGVAVITVSNPPVNALSLDVIASLQRDYGEALRRSDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDIN F K  +      L   S+D L++ +EDA KP VAA+ G+ALG
Sbjct  61   FSGGFDINAFDKKPKNEKPGYL---SIDFLTDIVEDAPKPSVAAIDGVALG  108



>ref|NP_001054687.1| Os05g0155000 [Oryza sativa Japonica Group]
 dbj|BAF16601.1| Os05g0155000 [Oryza sativa Japonica Group]
Length=724

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEV    VALITISNPPVNAL++ +   LK+ + EALRR+DVKAIV+TGKGG FSGG DI
Sbjct  9    MEVRPGGVALITISNPPVNALSIHVLYSLKDHYEEALRRNDVKAIVVTGKGGVFSGGLDI  68

Query  254  NVFKKVHETGDNSL-LPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            N F  +       L +  VS+D+++NT+E A KP VAA+ G ALG
Sbjct  69   NTFGAIQRNKAEQLKVDYVSIDVMTNTLEAAGKPSVAAINGPALG  113



>gb|AAV32217.1| putative fatty acid beta-oxidation multifunctional protein [Oryza 
sativa Japonica Group]
Length=668

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEV    VALITISNPPVNAL++ +   LK+ + EALRR+DVKAIV+TGKGG FSGG DI
Sbjct  9    MEVRPGGVALITISNPPVNALSIHVLYSLKDHYEEALRRNDVKAIVVTGKGGVFSGGLDI  68

Query  254  NVFKKVHETGDNSL-LPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            N F  +       L +  VS+D+++NT+E A KP VAA+ G ALG
Sbjct  69   NTFGAIQRNKAEQLKVDYVSIDVMTNTLEAAGKPSVAAINGPALG  113



>ref|XP_008784761.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X2 [Phoenix dactylifera]
Length=690

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVNAL+L +   LKE + EALRRDDVKAIVLTG GG FSGGFDI
Sbjct  8    MEVGADGVAVITIVNPPVNALSLDVLVSLKENYEEALRRDDVKAIVLTGAGGKFSGGFDI  67

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F++       + +   + D L++T+E A+KP VAA+ GLALG
Sbjct  68   SAFQE--GKTKQAKVDFSANDFLNDTLEGARKPSVAAIDGLALG  109



>ref|XP_008784760.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X1 [Phoenix dactylifera]
Length=719

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVNAL+L +   LKE + EALRRDDVKAIVLTG GG FSGGFDI
Sbjct  8    MEVGADGVAVITIVNPPVNALSLDVLVSLKENYEEALRRDDVKAIVLTGAGGKFSGGFDI  67

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F++       + +   + D L++T+E A+KP VAA+ GLALG
Sbjct  68   SAFQE--GKTKQAKVDFSANDFLNDTLEGARKPSVAAIDGLALG  109



>ref|XP_004962329.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X2 [Setaria italica]
Length=719

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  T  MEV  D VA+ITISNPPVNAL+L   A L+  + EAL R DVKAIVLTG  G 
Sbjct  1    MAKGTTAMEVRADGVAVITISNPPVNALSLDAIASLQRNYAEALSRSDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            F GGFDI  F K+ +   N    ++S+D LS+ +EDA+KP VAA+ G+ALG
Sbjct  61   FCGGFDITAFGKMPK---NEKPGSMSIDFLSDIVEDARKPSVAAIDGIALG  108



>ref|XP_004962328.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X1 [Setaria italica]
Length=751

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  T  MEV  D VA+ITISNPPVNAL+L   A L+  + EAL R DVKAIVLTG  G 
Sbjct  1    MAKGTTAMEVRADGVAVITISNPPVNALSLDAIASLQRNYAEALSRSDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            F GGFDI  F K+ +   N    ++S+D LS+ +EDA+KP VAA+ G+ALG
Sbjct  61   FCGGFDITAFGKMPK---NEKPGSMSIDFLSDIVEDARKPSVAAIDGIALG  108



>ref|XP_004508202.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Cicer arietinum]
Length=722

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFDI
Sbjct  9    MEVGADGVAIITIINPPVNSLSFDVLHSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFDI  68

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + E  +      VS++++++TIE AKKP VA + GLALG
Sbjct  69   SAFGGLQEAKERPKPGWVSIEIITDTIEAAKKPSVATIDGLALG  112



>gb|KDP27817.1| hypothetical protein JCGZ_18897 [Jatropha curcas]
Length=725

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG+D VA+ITI NPPVN+L+  +   LK+ + +ALRRDDVKAIV+TG  G FSGGFD
Sbjct  10   TIEVGSDGVAIITIINPPVNSLSFDVLNSLKDSYEQALRRDDVKAIVVTGAKGKFSGGFD  69

Query  251  INVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  +     D   L  +SVD+L++T+E A+KP VAA+ GLALG
Sbjct  70   ISSFGGIQGGKVDQPKLGFISVDILTDTVEAARKPSVAAIDGLALG  115



>emb|CDO98847.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+L +   LKE + +ALRRDDVKAIV+ G  G FSGGFD
Sbjct  11   TIEVGADGVAVITIFNPPVNSLSLDVLNSLKESYEQALRRDDVKAIVVIGSNGKFSGGFD  70

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  + E    +  P  VS+++LS+T++ A+KP VAA+ GLALG
Sbjct  71   ITAFGGIQEGKFPAPKPGFVSIEILSDTVDAARKPSVAAIDGLALG  116



>gb|AES91892.2| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=723

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            M VG D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFDI
Sbjct  10   MNVGADGVAIITIINPPVNSLSFDVLQSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFDI  69

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + E  +      +S++++++TIE AKKP VAA+ GLALG
Sbjct  70   SAFGGLQEAKERPKPGWISIEIITDTIEAAKKPSVAAIDGLALG  113



>ref|XP_003609695.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Medicago truncatula]
Length=724

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            M VG D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFDI
Sbjct  10   MNVGADGVAIITIINPPVNSLSFDVLQSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFDI  69

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + E  +      +S++++++TIE AKKP VAA+ GLALG
Sbjct  70   SAFGGLQEAKERPKPGWISIEIITDTIEAAKKPSVAAIDGLALG  113



>ref|XP_004171035.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like, partial [Cucumis sativus]
Length=171

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VALITI NPPVN+L+  +   LKE + +AL+R+DVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVALITIINPPVNSLSFDVLFSLKESYEQALQREDVKAIVVTGARGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +         P  +S+D++++  E A+KP VAA+ GLALG
Sbjct  70   ITAFGGLQGGKAEEPRPGYISIDVITDIFEAARKPAVAAIDGLALG  115



>ref|XP_009352290.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Pyrus x bretschneideri]
Length=725

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 5/118 (4%)
 Frame = +2

Query  35   NQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVL  214
            + SGK   V    +EVG D VALITI NPPVN+L++ +   LK+ + EALRR+DVKAIV+
Sbjct  2    SSSGKGRTV----LEVGADGVALITIINPPVNSLSIDVLFSLKDSYEEALRRNDVKAIVV  57

Query  215  TGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            TG  G FSGGFDIN F  + E       P  +SV+++++ +E A+KP VAA+ GLALG
Sbjct  58   TGAKGKFSGGFDINAFGGLQEGQKQEPKPGFISVEVITDIVEGARKPSVAAIDGLALG  115



>ref|XP_003569321.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brachypodium distachyon]
Length=748

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            TMEV  D VA+ITISNPPVNAL+  + A  +  + EALRR+DVKAIVLTG  G F GGFD
Sbjct  37   TMEVRGDGVAVITISNPPVNALSFDVLASFQRNYQEALRRNDVKAIVLTGAEGRFCGGFD  96

Query  251  INVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            IN F        N    ++S+D L++ +EDA KP VAA+ G+ALG
Sbjct  97   INAFG---NKPKNEKPGSLSIDFLTDIVEDAHKPSVAAIDGIALG  138



>ref|XP_009381090.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Musa acuminata subsp. malaccensis]
Length=723

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VALITI NPPVN+L++ +   LK+ + +AL RDDVKAIV+TG  G FSGGFDI
Sbjct  9    MEVGADGVALITIVNPPVNSLSIDVLLCLKDNYEQALSRDDVKAIVITGAKGKFSGGFDI  68

Query  254  NVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  V   G ++  P    +S+DLL++T+E A+KP VAA+ GLALG
Sbjct  69   TAFGGVQ--GGSTEQPKIGYISIDLLTDTLEGARKPSVAAIDGLALG  113



>ref|XP_010931678.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Elaeis guineensis]
Length=722

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA     MEVG D VA+ITI NPPVN+L++ +   LK+ + +AL RDDVKAIV+TG GG 
Sbjct  1    MAKGRTEMEVGPDGVAVITIINPPVNSLSVDVLFSLKDSYEQALNRDDVKAIVITGAGGK  60

Query  233  FSGGFDINVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDI  F  +     D   +  VS+D++++T+E A+KP VAA+ GLALG
Sbjct  61   FSGGFDITAFGGLQGGQRDQPKVGYVSIDIITDTLEGARKPSVAAIDGLALG  112



>ref|XP_010693603.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Beta vulgaris subsp. vulgaris]
Length=722

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+L +   LKE F EAL+R+DVKAIV+TG  G FSGGFDI
Sbjct  7    MEVGADGVAVITIINPPVNSLSLDVLQSLKENFDEALKRNDVKAIVVTGAKGKFSGGFDI  66

Query  254  NVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  + E    S  P    V+V++L++T+E A+KP VAA+ GLALG
Sbjct  67   TAFGGIQEGKTAS--PKRGFVAVEVLTDTVEAARKPSVAAIDGLALG  111



>ref|XP_004296857.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Fragaria vesca subsp. vesca]
Length=725

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VALITI NPPVN+L+  +  GLK+ + EA+RRDDVKAIV+TG  G FSGGFDI
Sbjct  11   LEVGADGVALITIINPPVNSLSFDVLYGLKDSYEEAMRRDDVKAIVVTGAKGKFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  +   G +   P    +SV++++N +E A+KP VAA+ GLALG
Sbjct  71   SAFGGLQ--GGHKAEPKPGYISVEVITNAVEGARKPSVAAIDGLALG  115



>ref|XP_010921650.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation 
multifunctional protein MFP-a-like [Elaeis guineensis]
Length=720

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 74/107 (69%), Gaps = 8/107 (7%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D V +ITI NPPVNAL+L +   LKE + +ALRR DVKAIVLTG GG FSGGFDI
Sbjct  8    MEVGADGVVVITIVNPPVNALSLDVLVSLKENYEKALRRVDVKAIVLTGAGGKFSGGFDI  67

Query  254  NVF---KKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F   K  H   D S      +D L++T+E A+KP VAA+ GLALG
Sbjct  68   SAFQGGKTEHAKVDFS-----PIDFLTDTLEGARKPSVAAVDGLALG  109



>ref|XP_008458439.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Cucumis melo]
Length=725

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   L++ + +ALRRDDVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGTDGVAIITIINPPVNSLSFDVLFSLRDSYEQALRRDDVKAIVVTGAKGKFSGGFDI  70

Query  254  NVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +    G+   + N+S++++++  E A+KPVVAA+ GLALG
Sbjct  71   TAFGVLQGGKGEQPNVRNISIEMITDIFEAARKPVVAAIDGLALG  115



>ref|XP_006380154.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
 gb|ERP57951.1| MULTIFUNCTIONAL family protein [Populus trichocarpa]
Length=726

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            T T+EVG D VALIT+ NPPVNAL+  +   LK+ + +ALRRDDVKAIV+TG  G FSGG
Sbjct  9    TTTIEVGADGVALITLINPPVNALSSDVLNSLKDSYEQALRRDDVKAIVITGAKGKFSGG  68

Query  245  FDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+ F++V E   N   P+ +  ++L +T+E AKKP VAA+ GLALG
Sbjct  69   ADISSFEEVQEGKVNEPKPDFIFSEVLGDTLEAAKKPSVAAIDGLALG  116



>ref|XP_010105147.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Morus notabilis]
 gb|EXC03955.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Morus notabilis]
Length=726

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VALITI NPPVN+L+  +  GLK  + EALRR+DV+AIV+TG  G FSGGFDI
Sbjct  11   MEVGADGVALITIINPPVNSLSFDVLYGLKANYEEALRRNDVRAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVH--ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  +   +  +++    +SV+L+++T+E A+KP VAA+ GLALG
Sbjct  71   SAFGGLQGGQQAEHARPGFISVELVTDTLEAARKPSVAAIDGLALG  116



>ref|XP_006380155.1| hypothetical protein POPTR_0008s22410g [Populus trichocarpa]
 gb|ERP57952.1| hypothetical protein POPTR_0008s22410g [Populus trichocarpa]
Length=721

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            T T+EVG D VALIT+ NPPVNAL+  +   LK+ + +ALRRDDVKAIV+TG  G FSGG
Sbjct  9    TTTIEVGADGVALITLINPPVNALSSDVLNSLKDSYEQALRRDDVKAIVITGAKGKFSGG  68

Query  245  FDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+ F++V E   N   P+ +  ++L +T+E AKKP VAA+ GLALG
Sbjct  69   ADISSFEEVQEGKVNEPKPDFIFSEVLGDTLEAAKKPSVAAIDGLALG  116



>gb|KJB72709.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=638

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+  +   LKE + EAL+RDDVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVAIITIINPPVNSLSPDVLYSLKESYDEALQRDDVKAIVVTGTNGKFSGGFD  69

Query  251  INVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +     +   L  VSV+++S+T+E AKKP VAA+ GLALG
Sbjct  70   ITSFDGMQSGKVEQPKLGFVSVEIVSDTLEAAKKPSVAAIDGLALG  115



>gb|KJB72711.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=712

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+  +   LKE + EAL+RDDVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVAIITIINPPVNSLSPDVLYSLKESYDEALQRDDVKAIVVTGTNGKFSGGFD  69

Query  251  INVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +     +   L  VSV+++S+T+E AKKP VAA+ GLALG
Sbjct  70   ITSFDGMQSGKVEQPKLGFVSVEIVSDTLEAAKKPSVAAIDGLALG  115



>ref|XP_006600114.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein isoform X1 [Glycine max]
Length=759

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVG-NDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            +EVG +D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFD
Sbjct  9    LEVGPDDGVAVITIVNPPVNSLSFDVLRSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFD  68

Query  251  INVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  + E  +      VSV+++++TIE A+KP VAA+ GLALG
Sbjct  69   ISAFGGIQEAKERPKPGWVSVEIITDTIEAARKPSVAAIDGLALG  113



>gb|KHN03349.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Glycine soja]
Length=719

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVG-NDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            +EVG +D VA+ITI NPPVN+L+  +   LKE F +A++RDDVKAIV+TG  G FSGGFD
Sbjct  9    LEVGPDDGVAVITIVNPPVNSLSFDVLRSLKESFDQAIQRDDVKAIVVTGAKGKFSGGFD  68

Query  251  INVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  + E  +      VSV+++++TIE A+KP VAA+ GLALG
Sbjct  69   ISAFGGIQEAKERPKPGWVSVEIITDTIEAARKPSVAAIDGLALG  113



>gb|KJB72706.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
 gb|KJB72708.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=725

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+  +   LKE + EAL+RDDVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVAIITIINPPVNSLSPDVLYSLKESYDEALQRDDVKAIVVTGTNGKFSGGFD  69

Query  251  INVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +     +   L  VSV+++S+T+E AKKP VAA+ GLALG
Sbjct  70   ITSFDGMQSGKVEQPKLGFVSVEIVSDTLEAAKKPSVAAIDGLALG  115



>ref|XP_008810214.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Phoenix dactylifera]
Length=723

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L++ +   LK+ + +AL RDDVKAIV+TG GG FSGGFDI
Sbjct  10   MEVGADGVAVITIINPPVNSLSVDVLFSLKDSYEQALNRDDVKAIVITGAGGKFSGGFDI  69

Query  254  NVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +     D      VS+D++++T+E A+KP VAA+ GLALG
Sbjct  70   TAFGGIQGGQRDQPKAGYVSIDIITDTLEGARKPSVAAIDGLALG  114



>gb|AFW77663.1| hypothetical protein ZEAMMB73_186479 [Zea mays]
Length=352

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA    TMEV  D VA+ITI NPPVNAL+L + A L+  + EAL R+D+KAIVLTG  G 
Sbjct  1    MARGITTMEVRADGVAVITIINPPVNALSLDVIASLQRNYAEALSRNDIKAIVLTGSKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            F GGFDI  F+       N    ++S+D L++ +EDA KP VAA+ G+ALG
Sbjct  61   FCGGFDIAAFE---NKPKNEKPGSMSIDFLTDIVEDAHKPSVAAIDGIALG  108



>gb|KJB72707.1| hypothetical protein B456_011G191800 [Gossypium raimondii]
Length=681

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+  +   LKE + EAL+RDDVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVAIITIINPPVNSLSPDVLYSLKESYDEALQRDDVKAIVVTGTNGKFSGGFD  69

Query  251  INVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +     +   L  VSV+++S+T+E AKKP VAA+ GLALG
Sbjct  70   ITSFDGMQSGKVEQPKLGFVSVEIVSDTLEAAKKPSVAAIDGLALG  115



>ref|XP_011071437.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Sesamum indicum]
Length=724

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T++VG D VA+ITI NPPVN+L+  +   LKE   +ALRRDDVKA+V+TG  G FSGGFD
Sbjct  9    TLDVGADGVAIITIINPPVNSLSFDVLNSLKETCEQALRRDDVKAVVITGAQGKFSGGFD  68

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F K+ +    +  P  VSV++L++ +  AKKP VAA+ GLALG
Sbjct  69   ISAFGKIQDKSVQAPKPGFVSVEILNDVVAAAKKPFVAAVDGLALG  114



>ref|XP_006419532.1| hypothetical protein CICLE_v10004429mg [Citrus clementina]
 gb|ESR32772.1| hypothetical protein CICLE_v10004429mg [Citrus clementina]
Length=725

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 5/108 (5%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+  +   LKE + +ALRRDDVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVAIITIINPPVNSLSFDVLFSLKENYEQALRRDDVKAIVVTGAKGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I +F  +   G     P    ++V++L+N +E A+KP VAA+ GLALG
Sbjct  70   ITLFGGIQ--GGQLAEPKPGYIAVEILTNIVEGARKPSVAAIDGLALG  115



>ref|XP_003550336.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Glycine max]
 gb|KHN03350.1| Peroxisomal fatty acid beta-oxidation multifunctional protein 
MFP2 [Glycine soja]
Length=722

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 5/106 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +    KE F +AL+RDDVKAIV+TG  G FSGGFDI
Sbjct  10   MEVGPDGVAIITIVNPPVNSLSYDVLRSFKENFDQALQRDDVKAIVVTGAKGRFSGGFDI  69

Query  254  NVF--KKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  +K  E      L   SV+++++TIE A+KP+VAA+ GLALG
Sbjct  70   SAFGAQKPEERPKPGWL---SVEIITDTIEAARKPLVAAIDGLALG  112



>gb|AIL29217.1| fatty acid beta-oxidation multifunctional protein [Camellia oleifera]
Length=725

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 7/121 (6%)
 Frame = +2

Query  26   LSANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKA  205
            + +N  G+ M      MEVG D VA+ITI NPPVN+L+L +   LK+ F +ALRRDDVKA
Sbjct  1    MGSNPKGRTM------MEVGADGVAVITIINPPVNSLSLDVLQSLKDSFDQALRRDDVKA  54

Query  206  IVLTGKGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLAL  382
            IV+TG  G FSGGFDI  F         +  P  +S ++L++T+E A+KP VAA+ GLAL
Sbjct  55   IVVTGAKGKFSGGFDITAFGGFQGGKIPAPKPGFISAEILTDTVEAARKPSVAAIDGLAL  114

Query  383  G  385
            G
Sbjct  115  G  115



>ref|XP_010259502.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Nelumbo nucifera]
Length=725

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 3/106 (3%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VALITI NPPVN+L+  +   LKE + +AL+RDDVKAI++TG  G FSGGFDI
Sbjct  11   MEVGTDGVALITIINPPVNSLSTDVLFSLKEHYDQALQRDDVKAIIITGSKGKFSGGFDI  70

Query  254  NVFKKVHETG--DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F   H+ G    S    VS++ +S+ +E AKKP VAA+ GLALG
Sbjct  71   SAFVS-HQAGKIKESTPGLVSIEFISDILEGAKKPSVAAIDGLALG  115



>gb|KJB34649.1| hypothetical protein B456_006G076600 [Gossypium raimondii]
Length=724

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VA+ITI NPPVN+L+L +   LKE F EAL+RDDVKAIV+ G  G FSGGFDI
Sbjct  10   VEVGADGVAVITIINPPVNSLSLDVLQSLKESFDEALQRDDVKAIVVAGANGKFSGGFDI  69

Query  254  NVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + +          VSV++L++TIE A+KP VAA+ GLALG
Sbjct  70   SAFGGIQQGAVQQPKSGYVSVEVLTDTIEAARKPSVAAIDGLALG  114



>ref|XP_006489051.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Citrus sinensis]
Length=725

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 5/108 (5%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+L +   LKE + +ALRRDDVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVAIITIINPPVNSLSLDVLFSLKENYEQALRRDDVKAIVVTGAKGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +   G     P    +SV++L++T+E  +KP VAA+ GLALG
Sbjct  70   ITSFGGLQ--GGQLAEPKPGYISVEILTDTVEGGRKPSVAAIDGLALG  115



>ref|XP_004168411.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform 2 [Cucumis sativus]
 sp|Q39659.1|MFPA_CUCSA RecName: Full=Glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-CoA 
isomerase/3-hydroxybutyryl-CoA epimerase; 
Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Cucumis sativus]
 emb|CAA55630.1| tetrafunctional protein [Cucumis sativus]
Length=725

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   L++ + +ALRRDDVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGTDGVAIITIINPPVNSLSFDVLFSLRDSYEQALRRDDVKAIVVTGAKGKFSGGFDI  70

Query  254  NVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +    G+   + N+S++++++  E A+KP VAA+ GLALG
Sbjct  71   TAFGVLQGGKGEQPNVRNISIEMITDIFEAARKPAVAAIDGLALG  115



>ref|XP_004148210.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation 
multifunctional protein MFP-a-like [Cucumis sativus]
Length=713

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   L++ + +ALRRDDVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGTDGVAIITIINPPVNSLSFDVLFSLRDSYEQALRRDDVKAIVVTGAKGKFSGGFDI  70

Query  254  NVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +    G+   + N+S++++++  E A+KP VAA+ GLALG
Sbjct  71   TAFGVLQGGKGEQPNVRNISIEMITDIFEAARKPAVAAIDGLALG  115



>ref|XP_010024717.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Eucalyptus grandis]
 gb|KCW61183.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=725

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T++VG D VA+ITI NPPVN+L+L +   LK+ + EALRR+DVKAIV+TG  G FSGGFD
Sbjct  10   TLDVGADGVAVITIINPPVNSLSLDVLNSLKQSYDEALRRNDVKAIVVTGANGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +  +      P  ++V++L+ T+E A+KP VAA+ GLALG
Sbjct  70   ITAFGGIQTSKVEQPKPGFIAVEILTKTVEAARKPSVAAIDGLALG  115



>gb|KCW61185.1| hypothetical protein EUGRSUZ_H039482 [Eucalyptus grandis]
Length=732

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T++VG D VA+ITI NPPVN+L+L +   LK+ + EALRR+DVKAIV+TG  G FSGGFD
Sbjct  10   TLDVGADGVAVITIINPPVNSLSLDVLNSLKQSYDEALRRNDVKAIVVTGANGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +  +      P  ++V++L+ T+E A+KP VAA+ GLALG
Sbjct  70   ITAFGGIQTSKVEQPKPGFIAVEILTKTVEAARKPSVAAIDGLALG  115



>ref|XP_008390640.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Malus domestica]
Length=725

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 5/116 (4%)
 Frame = +2

Query  41   SGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTG  220
            SGK   V    +EVG D VALITI NPPVN+L++ +   LK+ + EALRR+DVKAIV+TG
Sbjct  4    SGKGRTV----LEVGADGVALITIINPPVNSLSIDVLFSLKDSYEEALRRNDVKAIVVTG  59

Query  221  KGGTFSGGFDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
              G FSGGFDI  F  + E       P  +SV+++++ +E A+KP VAA+ GLALG
Sbjct  60   AKGKFSGGFDITAFGGLQEGQKQEPKPGFISVEVITDIVEGARKPSVAAIDGLALG  115



>gb|KGN47371.1| hypothetical protein Csa_6G306330 [Cucumis sativus]
Length=777

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   L++ + +ALRRDDVKAIV+TG  G FSGGFDI
Sbjct  63   MEVGTDGVAIITIINPPVNSLSFDVLFSLRDSYEQALRRDDVKAIVVTGAKGKFSGGFDI  122

Query  254  NVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +    G+   + N+S++++++  E A+KP VAA+ GLALG
Sbjct  123  TAFGVLQGGKGEQPNVRNISIEMITDIFEAARKPAVAAIDGLALG  167



>ref|XP_004168410.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform 1 [Cucumis sativus]
Length=794

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   L++ + +ALRRDDVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGTDGVAIITIINPPVNSLSFDVLFSLRDSYEQALRRDDVKAIVVTGAKGKFSGGFDI  70

Query  254  NVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +    G+   + N+S++++++  E A+KP VAA+ GLALG
Sbjct  71   TAFGVLQGGKGEQPNVRNISIEMITDIFEAARKPAVAAIDGLALG  115



>ref|XP_008649524.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X2 [Zea mays]
Length=689

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA    TMEV  D VA+ITI NPPVNAL+L + A L+  + EAL R+D+KAIVLTG  G 
Sbjct  1    MARGITTMEVRADGVAVITIINPPVNALSLDVIASLQRNYAEALSRNDIKAIVLTGSKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            F GGFDI  F+       N    ++S+D L++ +EDA KP VAA+ G+ALG
Sbjct  61   FCGGFDIAAFE---NKPKNEKPGSMSIDFLTDIVEDAHKPSVAAIDGIALG  108



>ref|XP_008649523.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X1 [Zea mays]
 gb|AFW77664.1| hypothetical protein ZEAMMB73_186479 [Zea mays]
Length=718

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA    TMEV  D VA+ITI NPPVNAL+L + A L+  + EAL R+D+KAIVLTG  G 
Sbjct  1    MARGITTMEVRADGVAVITIINPPVNALSLDVIASLQRNYAEALSRNDIKAIVLTGSKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            F GGFDI  F+       N    ++S+D L++ +EDA KP VAA+ G+ALG
Sbjct  61   FCGGFDIAAFE---NKPKNEKPGSMSIDFLTDIVEDAHKPSVAAIDGIALG  108



>gb|KHG21889.1| Peroxisomal fatty acid beta-oxidation multifunctional MFP2 -like 
protein [Gossypium arboreum]
Length=724

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VA+ITI NPPVN+L+L +   LKE + EAL+RDDVKAIV+ G  G FSGGFDI
Sbjct  10   VEVGADGVAVITIINPPVNSLSLDVLQSLKESYDEALQRDDVKAIVVAGANGKFSGGFDI  69

Query  254  NVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  + +          +SV++L++TIE A+KP VAA+ GLALG
Sbjct  70   SAFGGIQQGAVQQPKSGYISVEVLTDTIEAARKPSVAAIDGLALG  114



>gb|KHG21753.1| Peroxisomal fatty acid beta-oxidation multifunctional MFP2 -like 
protein [Gossypium arboreum]
Length=725

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+  +   LKE + +AL+RDDVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGVDGVAVITIINPPVNSLSPDVLYSLKESYDKALQRDDVKAIVVTGANGKFSGGFD  69

Query  251  INVFKKVHETG-DNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +     +   L  VSV+++S+T+E AKKP VAA+ GLALG
Sbjct  70   ITSFDGMQSGKVEQPKLGFVSVEIVSDTLEAAKKPSVAAIDGLALG  115



>ref|XP_011003910.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Populus euphratica]
Length=726

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            T T+EVG D VALIT+ N PVNAL+  +   LK+ + +ALRRDDVKAIV+TG  G FSGG
Sbjct  9    TTTIEVGADGVALITLINHPVNALSSDVLNSLKDSYEQALRRDDVKAIVITGAKGKFSGG  68

Query  245  FDINVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
             DI+ F++V E   N   P+ +  ++L +T+E AKKP VAA+ GLALG
Sbjct  69   ADISSFEEVQEGKVNEPKPDFIFSEVLGDTLEAAKKPSVAAIDGLALG  116



>ref|XP_007012079.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 ref|XP_007012080.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 gb|EOY29698.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
 gb|EOY29699.1| Enoyl-CoA hydratase/isomerase family isoform 2 [Theobroma cacao]
Length=716

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEV  D +A+I  S+PPVNAL +     LK    E++ RDDVKA+VLTG G  F  G 
Sbjct  9    VTMEVRGDGIAVIAFSSPPVNALHIPALTELKRMHRESMERDDVKAVVLTGAGSKFCSGL  68

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            D+++ + +  TGD+S+L  +S DL+ + +ED KKP VAA+QG ALG
Sbjct  69   DMSLVQDIQRTGDDSVLAEISHDLI-DQVEDGKKPSVAAIQGYALG  113



>ref|XP_007012081.1| Enoyl-CoA hydratase/isomerase family, putative isoform 4 [Theobroma 
cacao]
 gb|EOY29700.1| Enoyl-CoA hydratase/isomerase family, putative isoform 4 [Theobroma 
cacao]
Length=726

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEV  D +A+I  S+PPVNAL +     LK    E++ RDDVKA+VLTG G  F  G 
Sbjct  9    VTMEVRGDGIAVIAFSSPPVNALHIPALTELKRMHRESMERDDVKAVVLTGAGSKFCSGL  68

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            D+++ + +  TGD+S+L  +S DL+ + +ED KKP VAA+QG ALG
Sbjct  69   DMSLVQDIQRTGDDSVLAEISHDLI-DQVEDGKKPSVAAIQGYALG  113



>ref|XP_007012078.1| Peroxisomal fatty acid beta-oxidation multifunctional protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29697.1| Peroxisomal fatty acid beta-oxidation multifunctional protein, 
putative isoform 1 [Theobroma cacao]
Length=812

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEV  D +A+I  S+PPVNAL +     LK    E++ RDDVKA+VLTG G  F  G 
Sbjct  105  VTMEVRGDGIAVIAFSSPPVNALHIPALTELKRMHRESMERDDVKAVVLTGAGSKFCSGL  164

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            D+++ + +  TGD+S+L  +S DL+ + +ED KKP VAA+QG ALG
Sbjct  165  DMSLVQDIQRTGDDSVLAEISHDLI-DQVEDGKKPSVAAIQGYALG  209



>ref|XP_008340793.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like, partial [Malus domestica]
Length=721

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = +2

Query  41   SGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTG  220
            SGK   V    +EVG D VALITI NPPVN+L++ +   LK+ + EALRR+DVKAIV+TG
Sbjct  4    SGKGRTV----LEVGADGVALITIINPPVNSLSVDVLYSLKDSYEEALRRNDVKAIVITG  59

Query  221  KGGTFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
              G FSGGFDI+ F    E         +SV+++++  E A+KP VAA+ GLALG
Sbjct  60   AKGKFSGGFDISAFGGHQEEQKPGF---ISVEVITDIFEGARKPSVAAIDGLALG  111



>ref|XP_006342814.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Solanum tuberosum]
Length=725

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 79/108 (73%), Gaps = 5/108 (5%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            +++VG D VA+ITI NPPVN+L+L +   LK+ F EA RRDDVKAIV+TG  G FSGGF+
Sbjct  8    SIDVGADGVAVITIINPPVNSLSLDVLYSLKDAFEEAFRRDDVKAIVVTGCHGKFSGGFN  67

Query  251  INVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  + +  +    PN   +S+D+L++T+E +KKP+VAA+ G ALG
Sbjct  68   ISSFVDLQQ--EKVAQPNPGYISLDILTDTVEVSKKPLVAAIDGHALG  113



>emb|CDX92908.1| BnaC07g41660D [Brassica napus]
Length=787

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 6/106 (6%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTMEVG D VA+ITISNPPVN+L+  I +   EK  EA +R DVKAIVLT    T     
Sbjct  7    VTMEVGEDGVAVITISNPPVNSLSSPILSEWNEKLQEANKRSDVKAIVLTVSLNT-----  61

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             + +  KVH+TGD SL+P++S DL+   +ED++KP+VAA++G+ALG
Sbjct  62   -LIISGKVHKTGDMSLMPDISFDLVGTLMEDSRKPIVAAVEGVALG  106



>ref|XP_004487834.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Cicer arietinum]
Length=721

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VA+ITI +PPVN+L+  +F  LKE F EA +R+DVKAIV+TG  G FSGGFDI
Sbjct  7    LEVGADGVAIITIIHPPVNSLSFDVFLSLKESFDEAAQREDVKAIVVTGAKGKFSGGFDI  66

Query  254  NVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            N F  + +  +++   + VS++LL+ TIE  +KP VAA+ G++LG
Sbjct  67   NAFGLMQKGIEHATSGDFVSIELLTETIEAGRKPSVAAIDGISLG  111



>gb|KGN47431.1| hypothetical protein Csa_6G319770 [Cucumis sativus]
Length=725

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VALITI NPPVN+L+  +   LKE + +AL R+DVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVALITIINPPVNSLSFDVLFSLKESYEQALEREDVKAIVVTGARGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +         P  +S+D++++  E A+KP VAA+ GLALG
Sbjct  70   ITAFGGLQGGKAEEPRPGYISIDVITDIFEAARKPAVAAIDGLALG  115



>ref|XP_008458418.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Cucumis melo]
Length=725

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 5/108 (5%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VALITI NPPVN+L+  +   LKE + +AL R+DVKAIV+TG  G FSGGFD
Sbjct  10   TLEVGADGVALITIINPPVNSLSFDVLFSLKESYEQALLREDVKAIVVTGARGKFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I  F  +   G  ++ P    +S+D++++  E A+KP VAA+ GLALG
Sbjct  70   ITAFGGLQ--GGKAVEPRPGYISIDVITDIFEAARKPAVAAIDGLALG  115



>ref|XP_009623955.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Nicotiana tomentosiformis]
Length=715

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+ITI NPPVN+L+L +   L++K  E LRRDDVKAIV+ G  G FS GF 
Sbjct  7    TIEVGADGVAVITIINPPVNSLSLDVLYSLEKKLEEGLRRDDVKAIVVIGYQGNFSSGFH  66

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  + +       P  VSVD+L++T+E A+KP+VAA+ G ALG
Sbjct  67   ISSFDDLQQGKVAQPKPGYVSVDILTDTVEAARKPLVAAIDGYALG  112



>gb|EYU45545.1| hypothetical protein MIMGU_mgv1a002038mg [Erythranthe guttata]
Length=724

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T++VG D V ++TI NPPVN+L+  +   LK+   +ALRRDDVKAIV+TG  G FSGGFD
Sbjct  9    TLDVGADGVGIVTIINPPVNSLSFDVLNSLKDTCEQALRRDDVKAIVITGAQGKFSGGFD  68

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F K+ +    +  P  VS+++LS+ +  A KP VAA+ GLALG
Sbjct  69   ISAFGKIQDKSIQAPKPGFVSLEILSDVVAAATKPFVAAVDGLALG  114



>ref|XP_009393205.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Musa acuminata subsp. malaccensis]
Length=719

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 6/109 (6%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPP+N L+  +   LK  F EA+RRDDVKAIVLTG+G  FSGGFDI
Sbjct  10   MEVGADGVAVITIINPPINCLSFDVMWSLKANFEEAIRRDDVKAIVLTGQGPNFSGGFDI  69

Query  254  NVFKKVHETGDNSLLPN-----VSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F+ + + G+N   P       ++D++++  E A+KP VAA+ GL +G
Sbjct  70   AAFEDL-QGGNNGQKPEPKVGYFAIDVVTDIFEAARKPSVAAITGLVIG  117



>gb|KEH37224.1| glyoxysomal fatty acid beta-oxidation MFP-A protein [Medicago 
truncatula]
Length=721

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA     +EVG D VA+ITI NPPVN+L+  +F  LKE F EA +R+DVKAIV+TG  G 
Sbjct  1    MAKGHTVLEVGADGVAIITIVNPPVNSLSFDVFQSLKESFDEAHKREDVKAIVVTGAKGK  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FSGGFDIN F  + +   ++    +S++L +NTIE  +KP VAA+
Sbjct  61   FSGGFDINAFGLIQKGLGDTKPGLISIELQTNTIEAGRKPTVAAI  105



>ref|XP_010321770.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Solanum lycopersicum]
Length=859

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            +++VG D VA+ITI NPPVN+L+L +   LK+ F EALRRDDVKAIV+TG  G FSGGF+
Sbjct  142  SIDVGADGVAIITIINPPVNSLSLDVLYSLKDAFEEALRRDDVKAIVVTGCHGKFSGGFN  201

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
            I+ F  + +       P  +S+D+L++ +E +KKP+VAA+ G ALG
Sbjct  202  ISSFVDLQQQKVAQPNPGYISLDILTDIVEVSKKPLVAAIDGHALG  247



>ref|XP_007154175.1| hypothetical protein PHAVU_003G096500g [Phaseolus vulgaris]
 gb|ESW26169.1| hypothetical protein PHAVU_003G096500g [Phaseolus vulgaris]
Length=722

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L+  +   LK+ F +AL R+DVKA V+TG  G FSGGFDI
Sbjct  9    MEVGPDGVAVITIVNPPVNSLSYDVLRSLKQNFDQALGRNDVKAFVVTGPKGKFSGGFDI  68

Query  254  NVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F    E  +      +SV+++++TIE A+KP+VAA+ GLALG
Sbjct  69   SAFGD-EEPKERPKPGWLSVEIITDTIEAARKPLVAAIDGLALG  111



>ref|XP_007221966.1| hypothetical protein PRUPE_ppa002036mg [Prunus persica]
 gb|EMJ23165.1| hypothetical protein PRUPE_ppa002036mg [Prunus persica]
Length=725

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VALITI NPPVN+L+  +   LK+ F EALRR+DVKAIV+TG  G FSGGFDI
Sbjct  11   LEVGADGVALITIINPPVNSLSFDVLYSLKDNFEEALRRNDVKAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +     +   P  +SV+++++  E   KP VAA+ GLALG
Sbjct  71   TAFGGLQGGQKDESKPGLMSVEVITDIFEGTSKPSVAAIDGLALG  115



>ref|XP_008223215.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Prunus mume]
Length=725

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VALITI NPPVN+L+  +   LK+ F EALRR++VKAIV+TG  G FSGGFDI
Sbjct  11   LEVGADGVALITIINPPVNSLSFDVLYSLKDNFEEALRRNEVKAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAMQGLALG  385
              F  +     +   P  +SV+++++  E   KP VAA+ GLALG
Sbjct  71   TAFGGLQGGQKDESKPGFMSVEVITDIFEGTSKPSVAAIDGLALG  115



>ref|XP_007050970.1| Multifunctional protein 2, putative isoform 1 [Theobroma cacao]
 gb|EOX95127.1| Multifunctional protein 2, putative isoform 1 [Theobroma cacao]
Length=738

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = +2

Query  32   ANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIV  211
            A + G+ M   ++ +EVG D VA+ITI+NPP+N L+  +    KE   +AL RDDVKAIV
Sbjct  16   AGKVGRRMKGKSL-LEVGADGVAIITINNPPLNLLSADVLLSFKENVEQALLRDDVKAIV  74

Query  212  LTGKGGTFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            +TG  G FSGGFD+  F K    G++  L   S++ +++ +E A+KP VAA+ GLALG
Sbjct  75   ITGSKGKFSGGFDVTAFGK---KGNHGKLGFWSIEFITDILEAARKPFVAAIDGLALG  129



>ref|XP_007050971.1| Multifunctional protein 2, putative isoform 2 [Theobroma cacao]
 gb|EOX95128.1| Multifunctional protein 2, putative isoform 2 [Theobroma cacao]
Length=699

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = +2

Query  32   ANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIV  211
            A + G+ M   ++ +EVG D VA+ITI+NPP+N L+  +    KE   +AL RDDVKAIV
Sbjct  16   AGKVGRRMKGKSL-LEVGADGVAIITINNPPLNLLSADVLLSFKENVEQALLRDDVKAIV  74

Query  212  LTGKGGTFSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            +TG  G FSGGFD+  F K    G++  L   S++ +++ +E A+KP VAA+ GLALG
Sbjct  75   ITGSKGKFSGGFDVTAFGK---KGNHGKLGFWSIEFITDILEAARKPFVAAIDGLALG  129



>ref|XP_006840485.1| hypothetical protein AMTR_s00045p00190660 [Amborella trichopoda]
 gb|ERN02160.1| hypothetical protein AMTR_s00045p00190660 [Amborella trichopoda]
Length=717

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VALITI NPPVN+L++ +   +K  + EAL+R+DVKAIV+TG  G FSGGFDI
Sbjct  9    MEVGPDGVALITIINPPVNSLSIDVLQSIKANYEEALQRNDVKAIVITGSKGKFSGGFDI  68

Query  254  NVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
               + +    G       +SV+++++ +E A+KP VAA+ GLALG
Sbjct  69   TNIEGIQMGKGAQPKKGYISVEIITDLLEGARKPSVAAVDGLALG  113



>gb|AAT38103.1| putative glyoxysomal fatty acid beta-oxidation multifunctional 
protein [Oryza sativa Japonica Group]
Length=724

 Score =   101 bits (251),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 9/117 (8%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  + ++EV  D VA+IT+SNPPVNAL+L + A L+  + EALRR DVKAIVLTG  G 
Sbjct  1    MARGSTSVEVRRDGVAVITVSNPPVNALSLDVIASLQRDYGEALRRSDVKAIVLTGAKGR  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVS------VDLLSNTIEDAKKPVVAAMQGLALG  385
            FSGGFDIN F K   + D  +L  V+      V  +   + DA KP VAA+ G+ALG
Sbjct  61   FSGGFDINAFDK-KPSKDCPVLSFVNKLNIYVVKFM--LLPDAPKPSVAAIDGVALG  114



>ref|XP_009134933.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Brassica rapa]
Length=725

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            T TMEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGG
Sbjct  8    TTTMEVGADGVAVITLVNPPVNSLSFDVLYSLKSNYEEALSRNDVKAIVVTGAKGKFSGG  67

Query  245  FDINVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FDI+ F ++ + T     +  +S+D+L++ +E AKKP VAA+
Sbjct  68   FDISGFGEIQKGTMKEPKVGYISIDILTDLLEAAKKPSVAAI  109



>ref|XP_010524718.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Tarenaya hassleriana]
Length=725

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 5/101 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG+D VA+IT+ NPPVN+L+  +   LK  + EALRRDDVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGSDGVAVITLINPPVNSLSFDVLYSLKSNYEEALRRDDVKAIVVTGANGKFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAM  367
            + F ++ +   N   P    VS+D++++ +E A+KP VAA+
Sbjct  71   SGFGEIQK--GNRPEPKAGYVSIDIITDLVEAARKPSVAAI  109



>emb|CDX74076.1| BnaA03g29710D [Brassica napus]
Length=726

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            T TMEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGG
Sbjct  8    TTTMEVGADGVAVITLINPPVNSLSFDVLYSLKSNYEEALSRNDVKAIVVTGAKGKFSGG  67

Query  245  FDINVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FDI+ F ++ + T     +  +S+D+L++ +E AKKP VAA+
Sbjct  68   FDISGFGEIQKGTMKEPKVGYISIDILTDLLEAAKKPSVAAI  109



>ref|XP_009124621.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brassica rapa]
Length=725

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            TMEVG D VA++TI NPPVN+L+  +   LK  + EAL R+DVKAIV+TG+ G FSGGFD
Sbjct  10   TMEVGGDGVAVVTIINPPVNSLSFDVLDNLKSNYEEALSRNDVKAIVITGEKGKFSGGFD  69

Query  251  INVFKKVH-ETGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            I+ F +V  ET     +  +S+D+L++  E A+KP VAA+
Sbjct  70   ISGFGEVQKETRKEPKVGYLSIDILTDLFEAARKPSVAAI  109



>emb|CBI22983.3| unnamed protein product [Vitis vinifera]
Length=765

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 77/145 (53%), Gaps = 41/145 (28%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALA--------------------------------------  139
            MEVG D VALIT+ NPPVN+L+                                      
Sbjct  11   MEVGADGVALITLINPPVNSLSFDECSLRLRFEVLLSFSRKWEEFIFLLDALKRKKGLPV  70

Query  140  ---LQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDINVFKKVHETGDNSLLPNVS  310
               L +   LKE + EALRRDDVKAIV+TG  G FSGGFDI  F  +   G+ S    VS
Sbjct  71   KLHLPVLNSLKESYEEALRRDDVKAIVITGAKGKFSGGFDITAFGGIQAGGEVSKPGFVS  130

Query  311  VDLLSNTIEDAKKPVVAAMQGLALG  385
            V++L++T+E A+KP VAA+ GLALG
Sbjct  131  VEILTDTVEAARKPSVAAIDGLALG  155



>ref|XP_009147124.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Brassica rapa]
Length=725

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            TMEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFD
Sbjct  10   TMEVGGDGVAVITLINPPVNSLSFDVLENLKSNYEEALSRNDVKAIVITGAKGRFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAM  367
            I+ F  + +    +  P  +S+D++++ +E AKKP VAA+
Sbjct  70   ISGFGDIQKGTRKAPKPGYISIDIITDLLEAAKKPSVAAI  109



>emb|CDY24662.1| BnaA05g30610D [Brassica napus]
Length=726

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            TMEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFD
Sbjct  10   TMEVGGDGVAVITLINPPVNSLSFDVLENLKSNYEEALSRNDVKAIVITGAKGRFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAM  367
            I+ F  + +    +  P  +S+D++++ +E AKKP VAA+
Sbjct  70   ISGFGDIQKGTRKAPKPGYISIDIITDLLEAAKKPSVAAI  109



>sp|O49809.2|MFPA_BRANA RecName: Full=Glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-CoA 
isomerase/3-hydroxybutyryl-CoA epimerase; 
Includes: RecName: Full=3-hydroxyacyl-CoA dehydrogenase 
[Brassica napus]
 emb|CAA04386.1| Tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Brassica napus]
Length=725

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +2

Query  65   TVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGG  244
            T T+EVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGG
Sbjct  8    TTTIEVGADGVAVITLINPPVNSLSFDVLYSLKSNYEEALSRNDVKAIVVTGAKGKFSGG  67

Query  245  FDINVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            FDI+ F ++ + T     +  +S+D+L++ +E AKKP VAA+
Sbjct  68   FDISGFGEIQKGTMKEPKVGYISIDILTDLLEAAKKPSVAAI  109



>emb|CDY34924.1| BnaA01g32550D [Brassica napus]
Length=727

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            TMEVG D VA++TI NPPVN+L+  +   LK  + EAL R+DVKAIV+TG+ G FSGGFD
Sbjct  10   TMEVGGDGVAVVTIINPPVNSLSFDVLDNLKSNYEEALSRNDVKAIVITGEKGKFSGGFD  69

Query  251  INVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            I+ F +V + T     +  +S+D+L++  E A+KP VAA+
Sbjct  70   ISGFGEVQKGTRKEPKVGYLSIDILTDLFEAARKPSVAAI  109



>ref|XP_004240549.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X1 [Solanum lycopersicum]
Length=732

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +2

Query  77   EVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDIN  256
            EVG   VA+ITI+ PP+N L++ +   LKEK  EA+R+D VKAIV+TG  G FS GF + 
Sbjct  20   EVGEHGVAIITINRPPLNLLSVDVVLSLKEKIEEAIRKDSVKAIVITGSRGNFSAGFVVT  79

Query  257  VFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             F    +   +  L  +S+D +++T+E ++KP+VAA++G  LG
Sbjct  80   AFGGSQQRKTHRELGFMSIDFITDTLEASRKPIVAAVEGFCLG  122



>gb|KFK38149.1| hypothetical protein AALP_AA3G075600 [Arabis alpina]
Length=725

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            M+VG+D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG+ G FSGGFDI
Sbjct  11   MDVGSDGVAVITLINPPVNSLSFDVLGNLKSNYEEALSRNDVKAIVITGEKGKFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAM  367
            + F ++ +       P  +S+DL+S+ +E AKKP VAA+
Sbjct  71   SGFGEMQKGTRKEPKPGYLSIDLISDLLEAAKKPSVAAI  109



>ref|XP_010464276.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2 [Camelina sativa]
Length=725

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG+D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGSDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            + F ++ + T     +  +S+D+L++ +E A+KP VAA+
Sbjct  71   SGFGEIQKGTRKEPKVGYISIDILTDLLEAARKPSVAAI  109



>emb|CDY05296.1| BnaC05g45070D [Brassica napus]
Length=725

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            TMEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFD
Sbjct  10   TMEVGGDGVAVITLINPPVNSLSFDVLENLKSNYEEALSRNDVKAIVITGAKGRFSGGFD  69

Query  251  INVFKKVHETGDNSLLPN-VSVDLLSNTIEDAKKPVVAAM  367
            I+ F  + +    +  P  +S+D++++ +E  KKP VAA+
Sbjct  70   ISGFGDIQKGTRKAPKPGYISIDIITDLLEAGKKPSVAAI  109



>gb|ACL53557.1| unknown [Zea mays]
 gb|AFW80682.1| hypothetical protein ZEAMMB73_867373 [Zea mays]
Length=189

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            ++VG D VA+ITI NPPVN+L++ +   LKE + EALRR+DVKAIV+TGKGG FSGGFDI
Sbjct  9    LDVGADGVAVITIYNPPVNSLSIDVLHSLKESYEEALRRNDVKAIVVTGKGGKFSGGFDI  68

Query  254  NVFKKVHETGDNSLLPNV---SVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  V   G  ++ P V   ++D+L++T+E A KP VAA+ GLALG
Sbjct  69   SSFGGVQ--GGQTMQPKVGYIAIDILTDTVEAATKPSVAAIDGLALG  113



>emb|CDY08028.1| BnaC03g34950D [Brassica napus]
Length=726

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFD
Sbjct  10   TIEVGADGVAVITLINPPVNSLSFDVLYSLKSNYEEALSRNDVKAIVVTGAKGKFSGGFD  69

Query  251  INVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            I+ F ++ + T     +  +S+D+L++ +E A+KP VAA+
Sbjct  70   ISGFGEIQKGTMKEPKVGYISIDILTDLLEAARKPSVAAI  109



>ref|XP_010547011.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a [Tarenaya hassleriana]
Length=725

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+I + NPPVN+L+  +   LK  + EALRR+DVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGADGVAVINLINPPVNSLSFDVLYSLKSNYEEALRRNDVKAIVVTGANGKFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAM  367
            + F ++ +   N   P    +S+D++++ IE A+KP VAA+
Sbjct  71   SGFGEIQK--GNRQEPKAGYISIDIITDLIEAARKPSVAAI  109



>ref|XP_010445530.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like isoform X3 [Camelina sativa]
Length=725

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            + F ++ + T     +  +S+D++++ +E A+KP VAA+
Sbjct  71   SGFGEIQKGTRKEPKVGYISIDIITDLLEAARKPSVAAI  109



>ref|XP_006297065.1| hypothetical protein CARUB_v10013066mg [Capsella rubella]
 gb|EOA29963.1| hypothetical protein CARUB_v10013066mg [Capsella rubella]
Length=725

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            + F ++ + T     +  +S+D++++ +E A+KP VAA+
Sbjct  71   SGFGEIQKGTRKEPKVGYISIDIITDLLEAARKPSVAAI  109



>ref|XP_010486216.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2-like [Camelina sativa]
Length=725

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGKFSGGFDI  70

Query  254  NVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            + F ++ + T     +  +S+D++++ +E A+KP VAA+
Sbjct  71   SGFSEIQKGTMKEPKVGFISIDIITDLLEAARKPSVAAI  109



>gb|AAL32728.1| fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]
Length=404

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGRFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAM  367
            + F ++ +   N   P    +S+D++++ +E A+KP VAA+
Sbjct  71   SGFGEMQK--GNVKEPKAGYISIDIITDLLEAARKPSVAAI  109



>gb|EMT31909.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Aegilops tauschii]
Length=751

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 67/111 (60%), Gaps = 20/111 (18%)
 Frame = +2

Query  53   MAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGT  232
            MA  T  MEVG+D VA+I + NPPVNAL++ ++  LK  + EAL+R+DVKAIVLTG G +
Sbjct  1    MAKGTTEMEVGSDGVAVIYVVNPPVNALSIDVWYSLKRHYEEALQREDVKAIVLTGSGRS  60

Query  233  FSGGFDINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            FS G D++VF  +H                    + A KP VAA+ G ALG
Sbjct  61   FSAGLDVSVFADIH--------------------KHAGKPSVAAIDGPALG  91



>ref|XP_006407895.1| hypothetical protein EUTSA_v10020152mg [Eutrema salsugineum]
 gb|ESQ49348.1| hypothetical protein EUTSA_v10020152mg [Eutrema salsugineum]
Length=725

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = +2

Query  26   LSANQSGKDMAVPTVTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKA  205
            +++   GK M      MEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKA
Sbjct  1    MASRTKGKTM------MEVGGDGVAVITLINPPVNSLSFDVLDNLKSNYEEALSRNDVKA  54

Query  206  IVLTGKGGTFSGGFDINVFKKVHE-TGDNSLLPNVSVDLLSNTIEDAKKPVVAAM  367
            IV+TG  G FSGGFDI+ F ++ +       +  +S+D++++ +E A+KP VAA+
Sbjct  55   IVITGAKGKFSGGFDISGFGEIQKGKRKEPKVGYISIDIITDLLEAARKPSVAAI  109



>ref|XP_011082447.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X1 [Sesamum indicum]
Length=722

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EV  D VA++TI+NPP+N L++ +   LKE    AL RDDVKAIV+TG  G FS GFD
Sbjct  6    TVEVRADGVAVVTINNPPLNLLSVDVILSLKESIEGALIRDDVKAIVVTGSRGKFSAGFD  65

Query  251  INVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            +  F           L  +S+ ++++T+E A+KP VAA++G A G
Sbjct  66   VTAFGGSQGKKTKMELGFMSIQIVTDTLEAARKPFVAAIEGPAFG  110



>ref|XP_011082449.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X3 [Sesamum indicum]
Length=687

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EV  D VA++TI+NPP+N L++ +   LKE    AL RDDVKAIV+TG  G FS GFD
Sbjct  6    TVEVRADGVAVVTINNPPLNLLSVDVILSLKESIEGALIRDDVKAIVVTGSRGKFSAGFD  65

Query  251  INVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            +  F           L  +S+ ++++T+E A+KP VAA++G A G
Sbjct  66   VTAFGGSQGKKTKMELGFMSIQIVTDTLEAARKPFVAAIEGPAFG  110



>ref|XP_011082448.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X2 [Sesamum indicum]
Length=721

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = +2

Query  71   TMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFD  250
            T+EV  D VA++TI+NPP+N L++ +   LKE    AL RDDVKAIV+TG  G FS GFD
Sbjct  6    TVEVRADGVAVVTINNPPLNLLSVDVILSLKESIEGALIRDDVKAIVVTGSRGKFSAGFD  65

Query  251  INVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
            +  F           L  +S+ ++++T+E A+KP VAA++G A G
Sbjct  66   VTAFGGSQGKKTKMELGFMSIQIVTDTLEAARKPFVAAIEGPAFG  110



>ref|XP_006355813.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X2 [Solanum tuberosum]
Length=715

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +2

Query  77   EVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDIN  256
            EVG + VA+ITI+ PP+N L++ +   LKEK  EA+R+D VKAIV+TG  G FS GF + 
Sbjct  20   EVGENGVAIITINRPPLNLLSVDVLLSLKEKIEEAIRKDSVKAIVITGSRGNFSAGFVVT  79

Query  257  VFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             F    +   +  L  +SVD +++T+E ++KP+VAA++G +LG
Sbjct  80   AFGGSQQRKTHRELGFMSVDFITDTLEASRKPIVAAVEGFSLG  122



>ref|NP_187342.1| fatty acid beta-oxidation multifunctional protein MFP2 [Arabidopsis 
thaliana]
 sp|Q9ZPI5.1|MFP2_ARATH RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional 
protein MFP2; Short=AtMPF2; Includes: RecName: Full=Enoyl-CoA 
hydratase/3-2-trans-enoyl-CoA isomerase/3-hydroxybutyryl-CoA 
epimerase; Includes: RecName: Full=3-hydroxyacyl-CoA 
dehydrogenase [Arabidopsis thaliana]
 pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2
 gb|AAF26990.1|AC016827_1 fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]
 gb|AAD18042.1| MFP2 [Arabidopsis thaliana]
 gb|AAL32699.1| fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]
 gb|AEE74468.1| fatty acid beta-oxidation multifunctional protein MFP2 [Arabidopsis 
thaliana]
Length=725

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+IT+ NPPVN+L+  +   LK  + EAL R+DVKAIV+TG  G FSGGFDI
Sbjct  11   MEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGRFSGGFDI  70

Query  254  NVFKKVHETGDNSLLPN---VSVDLLSNTIEDAKKPVVAAM  367
            + F ++ +   N   P    +S+D++++ +E A+KP VAA+
Sbjct  71   SGFGEMQK--GNVKEPKAGYISIDIITDLLEAARKPSVAAI  109



>ref|XP_004968710.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like [Setaria italica]
Length=723

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            +EVG D VA+ITI NPPVN+L++ +   LKE + EALRR DVKAIV+TGKGG FSGGFDI
Sbjct  9    LEVGADGVAVITIYNPPVNSLSIDVLYSLKESYEEALRRSDVKAIVVTGKGGKFSGGFDI  68

Query  254  NVFKKVHETGDNSLLPNV---SVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  V   G   + P V   S+D+L++T+E A KP VAA+ GLALG
Sbjct  69   SSFGGVQ--GGQMMQPKVGYISIDILTDTLEAAAKPSVAAVDGLALG  113



>ref|XP_006355812.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X1 [Solanum tuberosum]
Length=732

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +2

Query  77   EVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDIN  256
            EVG + VA+ITI+ PP+N L++ +   LKEK  EA+R+D VKAIV+TG  G FS GF + 
Sbjct  20   EVGENGVAIITINRPPLNLLSVDVLLSLKEKIEEAIRKDSVKAIVITGSRGNFSAGFVVT  79

Query  257  VFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             F    +   +  L  +SVD +++T+E ++KP+VAA++G +LG
Sbjct  80   AFGGSQQRKTHRELGFMSVDFITDTLEASRKPIVAAVEGFSLG  122



>ref|XP_006355814.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional 
protein MFP-a-like isoform X3 [Solanum tuberosum]
Length=636

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 47/103 (46%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +2

Query  77   EVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDIN  256
            EVG + VA+ITI+ PP+N L++ +   LKEK  EA+R+D VKAIV+TG  G FS GF + 
Sbjct  20   EVGENGVAIITINRPPLNLLSVDVLLSLKEKIEEAIRKDSVKAIVITGSRGNFSAGFVVT  79

Query  257  VFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
             F    +   +  L  +SVD +++T+E ++KP+VAA++G +LG
Sbjct  80   AFGGSQQRKTHRELGFMSVDFITDTLEASRKPIVAAVEGFSLG  122



>ref|NP_001042973.1| Os01g0348600 [Oryza sativa Japonica Group]
 dbj|BAB63893.1| putative tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Oryza sativa Japonica Group]
 dbj|BAB93398.1| putative tetrafunctional protein of glyoxysomal fatty acid beta-oxidation 
[Oryza sativa Japonica Group]
 dbj|BAF04887.1| Os01g0348600 [Oryza sativa Japonica Group]
 gb|EAZ11803.1| hypothetical protein OsJ_01677 [Oryza sativa Japonica Group]
 dbj|BAG94610.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70593.1| hypothetical protein OsI_01815 [Oryza sativa Indica Group]
 gb|AGW30398.1| glyoxysomal fatty acid beta-chain multifunctional protein [Oryza 
sativa]
Length=727

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            MEVG D VA+ITI NPPVN+L++ +   LKE + EALRR+DVKAIV+TGKGG FSGGFDI
Sbjct  13   MEVGADGVAVITICNPPVNSLSIDVLLSLKENYAEALRRNDVKAIVVTGKGGKFSGGFDI  72

Query  254  NVFKKVHETGDNSLLPNV---SVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  V   G     P V   S+D++++T+E A KP VAA+ GLALG
Sbjct  73   SSFGSVQ--GGKVEQPKVGYISIDIITDTLEAATKPSVAAIDGLALG  117



>ref|XP_009137821.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional 
protein AIM1-like [Brassica rapa]
Length=700

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 21/106 (20%)
 Frame = +2

Query  68   VTMEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGF  247
            VTM+VG D VA+ITISNPPVN+L+  I +   EK  EA +R DVKAIVL           
Sbjct  7    VTMDVGEDGVAVITISNPPVNSLSSSILSEWNEKLQEANQRSDVKAIVL-----------  55

Query  248  DINVFKKVHETGDNSLLPNVSVDLLSNTIEDAKKPVVAAMQGLALG  385
                      TGD SL+P++S D++   +ED++KP+VAA++G+ALG
Sbjct  56   ----------TGDMSLMPDISFDVVGTLMEDSRKPIVAAVEGVALG  91



>ref|NP_001152306.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
 gb|ACG46924.1| glyoxysomal fatty acid beta-oxidation multifunctional protein 
MFP-a [Zea mays]
Length=723

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = +2

Query  74   MEVGNDAVALITISNPPVNALALQIFAGLKEKFTEALRRDDVKAIVLTGKGGTFSGGFDI  253
            ++VG D VA+ITI NPPVN+L++ +   LKE + EALRR+DVKAIV+TGKGG FSGGFDI
Sbjct  9    LDVGADGVAVITIYNPPVNSLSIDVLHSLKESYEEALRRNDVKAIVVTGKGGKFSGGFDI  68

Query  254  NVFKKVHETGDNSLLPNV---SVDLLSNTIEDAKKPVVAAMQGLALG  385
            + F  V   G  ++ P V   ++D+L++T+E A KP VAA+ GLALG
Sbjct  69   SSFGGVQ--GGQTMQPKVGYIAIDILTDTVEAATKPSVAAIDGLALG  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565581808380