BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016C21

Length=226
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011078363.1|  PREDICTED: probable ADP-ribosylation factor ...    126   1e-31   Sesamum indicum [beniseed]
ref|XP_010656352.1|  PREDICTED: actin cytoskeleton-regulatory com...    125   2e-31   Vitis vinifera
ref|XP_002281316.2|  PREDICTED: probable ADP-ribosylation factor ...    125   2e-31   Vitis vinifera
ref|XP_010249829.1|  PREDICTED: probable ADP-ribosylation factor ...    123   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010047752.1|  PREDICTED: probable ADP-ribosylation factor ...    122   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010047751.1|  PREDICTED: probable ADP-ribosylation factor ...    122   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010249832.1|  PREDICTED: probable ADP-ribosylation factor ...    122   2e-30   Nelumbo nucifera [Indian lotus]
gb|EPS61339.1|  hypothetical protein M569_13457                         120   2e-30   Genlisea aurea
ref|XP_004139426.1|  PREDICTED: uncharacterized protein LOC101209764    121   3e-30   
ref|XP_004167945.1|  PREDICTED: uncharacterized LOC101209764            121   4e-30   
ref|XP_006844366.1|  hypothetical protein AMTR_s00142p00058560          122   4e-30   
ref|XP_008458192.1|  PREDICTED: probable ADP-ribosylation factor ...    121   4e-30   Cucumis melo [Oriental melon]
ref|XP_010088856.1|  putative ADP-ribosylation factor GTPase-acti...    121   5e-30   
ref|XP_010654693.1|  PREDICTED: probable ADP-ribosylation factor ...    121   6e-30   
emb|CBI36171.3|  unnamed protein product                                121   6e-30   Vitis vinifera
ref|XP_010654688.1|  PREDICTED: probable ADP-ribosylation factor ...    121   6e-30   Vitis vinifera
gb|KJB54156.1|  hypothetical protein B456_009G023500                    120   9e-30   Gossypium raimondii
gb|KJB54155.1|  hypothetical protein B456_009G023500                    120   1e-29   Gossypium raimondii
gb|KJB54158.1|  hypothetical protein B456_009G023500                    120   1e-29   Gossypium raimondii
gb|KJB54159.1|  hypothetical protein B456_009G023500                    120   1e-29   Gossypium raimondii
ref|XP_009415353.1|  PREDICTED: probable ADP-ribosylation factor ...    119   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408824.1|  PREDICTED: probable ADP-ribosylation factor ...    120   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415351.1|  PREDICTED: probable ADP-ribosylation factor ...    119   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324405.1|  Rev interacting-like family protein                119   2e-29   
gb|KJB27129.1|  hypothetical protein B456_004G279500                    119   2e-29   Gossypium raimondii
gb|KHG08531.1|  hypothetical protein F383_13599                         119   2e-29   Gossypium arboreum [tree cotton]
ref|XP_010254182.1|  PREDICTED: probable ADP-ribosylation factor ...    119   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010934816.1|  PREDICTED: probable ADP-ribosylation factor ...    119   2e-29   
gb|KJB27127.1|  hypothetical protein B456_004G279500                    119   2e-29   Gossypium raimondii
gb|KJB27126.1|  hypothetical protein B456_004G279500                    119   2e-29   Gossypium raimondii
gb|KJB27130.1|  hypothetical protein B456_004G279500                    119   2e-29   Gossypium raimondii
ref|XP_011043437.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Populus euphratica
ref|XP_010915040.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Elaeis guineensis
ref|XP_010934106.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Elaeis guineensis
ref|XP_010933331.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   
ref|XP_010931848.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Elaeis guineensis
gb|KJB27131.1|  hypothetical protein B456_004G279500                    119   3e-29   Gossypium raimondii
gb|KDP32306.1|  hypothetical protein JCGZ_13231                         119   3e-29   Jatropha curcas
ref|XP_009776200.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Nicotiana sylvestris
ref|XP_009776199.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Nicotiana sylvestris
ref|XP_009627509.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Nicotiana tomentosiformis
ref|XP_009627508.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-29   Nicotiana tomentosiformis
ref|XP_008242637.1|  PREDICTED: probable ADP-ribosylation factor ...    119   5e-29   
ref|XP_008242599.1|  PREDICTED: probable ADP-ribosylation factor ...    119   5e-29   Prunus mume [ume]
ref|XP_007203783.1|  hypothetical protein PRUPE_ppa001945mg             119   5e-29   Prunus persica
gb|KDO54160.1|  hypothetical protein CISIN_1g004435mg                   118   5e-29   Citrus sinensis [apfelsine]
ref|XP_008808989.1|  PREDICTED: probable ADP-ribosylation factor ...    118   5e-29   Phoenix dactylifera
ref|XP_008808979.1|  PREDICTED: probable ADP-ribosylation factor ...    118   5e-29   Phoenix dactylifera
gb|KJB27128.1|  hypothetical protein B456_004G279500                    118   6e-29   Gossypium raimondii
ref|XP_008793443.1|  PREDICTED: probable ADP-ribosylation factor ...    118   6e-29   Phoenix dactylifera
gb|KDO54159.1|  hypothetical protein CISIN_1g004435mg                   118   7e-29   Citrus sinensis [apfelsine]
ref|XP_006475716.1|  PREDICTED: probable ADP-ribosylation factor ...    118   7e-29   
gb|KDO54156.1|  hypothetical protein CISIN_1g004435mg                   118   7e-29   Citrus sinensis [apfelsine]
ref|XP_006475714.1|  PREDICTED: probable ADP-ribosylation factor ...    118   7e-29   
gb|KDO54161.1|  hypothetical protein CISIN_1g004435mg                   118   7e-29   Citrus sinensis [apfelsine]
ref|XP_006475717.1|  PREDICTED: probable ADP-ribosylation factor ...    118   7e-29   
gb|KDO54162.1|  hypothetical protein CISIN_1g004435mg                   118   9e-29   Citrus sinensis [apfelsine]
ref|XP_010532839.1|  PREDICTED: probable ADP-ribosylation factor ...    117   1e-28   Tarenaya hassleriana [spider flower]
ref|NP_001141785.2|  uncharacterized protein LOC100273921               115   1e-28   Zea mays [maize]
ref|XP_006583397.1|  PREDICTED: probable ADP-ribosylation factor ...    116   2e-28   Glycine max [soybeans]
ref|XP_008804233.1|  PREDICTED: probable ADP-ribosylation factor ...    117   2e-28   Phoenix dactylifera
ref|XP_008804232.1|  PREDICTED: probable ADP-ribosylation factor ...    117   2e-28   Phoenix dactylifera
ref|XP_004287082.1|  PREDICTED: probable ADP-ribosylation factor ...    117   2e-28   Fragaria vesca subsp. vesca
ref|XP_011458060.1|  PREDICTED: probable ADP-ribosylation factor ...    117   2e-28   Fragaria vesca subsp. vesca
ref|XP_009336872.1|  PREDICTED: probable ADP-ribosylation factor ...    117   2e-28   Pyrus x bretschneideri [bai li]
gb|KHN21549.1|  Arf-GAP domain and FG repeat-containing protein 1       116   3e-28   Glycine soja [wild soybean]
ref|XP_006580462.1|  PREDICTED: probable ADP-ribosylation factor ...    116   3e-28   Glycine max [soybeans]
emb|CDP03358.1|  unnamed protein product                                116   3e-28   Coffea canephora [robusta coffee]
ref|XP_008343980.1|  PREDICTED: probable ADP-ribosylation factor ...    116   3e-28   
ref|XP_007160353.1|  hypothetical protein PHAVU_002G314500g             116   3e-28   Phaseolus vulgaris [French bean]
ref|XP_006583396.1|  PREDICTED: probable ADP-ribosylation factor ...    116   3e-28   
ref|XP_006583393.1|  PREDICTED: probable ADP-ribosylation factor ...    116   3e-28   Glycine max [soybeans]
ref|XP_004251595.1|  PREDICTED: probable ADP-ribosylation factor ...    116   3e-28   Solanum lycopersicum
ref|XP_002440136.1|  hypothetical protein SORBIDRAFT_09g026670          114   4e-28   
ref|XP_002863138.1|  hypothetical protein ARALYDRAFT_358984             115   7e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_006286186.1|  hypothetical protein CARUB_v10007750mg             115   8e-28   Capsella rubella
ref|XP_006587513.1|  PREDICTED: probable ADP-ribosylation factor ...    114   8e-28   Glycine max [soybeans]
ref|XP_004512853.1|  PREDICTED: probable ADP-ribosylation factor ...    115   9e-28   Cicer arietinum [garbanzo]
ref|XP_010688167.1|  PREDICTED: probable ADP-ribosylation factor ...    115   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004512854.1|  PREDICTED: probable ADP-ribosylation factor ...    115   1e-27   Cicer arietinum [garbanzo]
ref|XP_009352480.1|  PREDICTED: probable ADP-ribosylation factor ...    115   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_006829864.1|  hypothetical protein AMTR_s00119p00132020          114   1e-27   
ref|XP_007013231.1|  NSP-interacting GTPase, putative isoform 1         115   1e-27   
ref|XP_007013233.1|  NSP-interacting GTPase, putative isoform 3         115   1e-27   
gb|EEC72722.1|  hypothetical protein OsI_06328                          115   1e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001046262.1|  Os02g0208900                                       115   1e-27   
ref|XP_007160351.1|  hypothetical protein PHAVU_002G314400g             114   1e-27   Phaseolus vulgaris [French bean]
ref|XP_007013232.1|  NSP-interacting GTPase, putative isoform 2         115   1e-27   
ref|XP_009412408.1|  PREDICTED: probable ADP-ribosylation factor ...    114   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007160352.1|  hypothetical protein PHAVU_002G314400g             114   1e-27   Phaseolus vulgaris [French bean]
ref|XP_006353447.1|  PREDICTED: probable ADP-ribosylation factor ...    114   1e-27   Solanum tuberosum [potatoes]
ref|XP_006587510.1|  PREDICTED: probable ADP-ribosylation factor ...    114   2e-27   Glycine max [soybeans]
ref|XP_006587509.1|  PREDICTED: probable ADP-ribosylation factor ...    114   2e-27   Glycine max [soybeans]
gb|KJB64872.1|  hypothetical protein B456_010G069100                    114   2e-27   Gossypium raimondii
ref|XP_006647062.1|  PREDICTED: probable ADP-ribosylation factor ...    114   2e-27   Oryza brachyantha
gb|EMT18497.1|  Putative ADP-ribosylation factor GTPase-activatin...    114   2e-27   
ref|XP_006584844.1|  PREDICTED: probable ADP-ribosylation factor ...    114   2e-27   Glycine max [soybeans]
ref|XP_008352294.1|  PREDICTED: probable ADP-ribosylation factor ...    113   2e-27   
gb|EMS60759.1|  putative ADP-ribosylation factor GTPase-activatin...    114   3e-27   Triticum urartu
emb|CDY47324.1|  BnaCnng14610D                                          113   3e-27   Brassica napus [oilseed rape]
dbj|BAD25003.1|  human Rev interacting-like protein-like                112   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008647576.1|  PREDICTED: uncharacterized protein LOC100273...    113   4e-27   
ref|XP_006414927.1|  hypothetical protein EUTSA_v10024713mg             112   4e-27   Eutrema salsugineum [saltwater cress]
ref|NP_193071.2|  NSP (nuclear shuttle protein)-interacting GTPase      112   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003571599.1|  PREDICTED: probable ADP-ribosylation factor ...    113   4e-27   
gb|KHG17023.1|  hypothetical protein F383_09821                         113   5e-27   Gossypium arboreum [tree cotton]
ref|XP_009402905.1|  PREDICTED: probable ADP-ribosylation factor ...    112   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010450221.1|  PREDICTED: probable ADP-ribosylation factor ...    112   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010435278.1|  PREDICTED: probable ADP-ribosylation factor ...    112   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010440592.1|  PREDICTED: probable ADP-ribosylation factor ...    112   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009416362.1|  PREDICTED: probable ADP-ribosylation factor ...    112   9e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004951486.1|  PREDICTED: probable ADP-ribosylation factor ...    112   9e-27   Setaria italica
ref|XP_002319204.1|  ARF GAP-like zinc finger-containing protein ...    112   1e-26   
ref|XP_006375928.1|  hypothetical protein POPTR_0013s06460g             112   1e-26   
ref|XP_011047055.1|  PREDICTED: probable ADP-ribosylation factor ...    112   1e-26   Populus euphratica
ref|XP_010931482.1|  PREDICTED: probable ADP-ribosylation factor ...    111   2e-26   
ref|XP_010653158.1|  PREDICTED: probable ADP-ribosylation factor ...    111   2e-26   Vitis vinifera
ref|XP_003620547.1|  Arf-GAP domain and FG repeats-containing pro...    111   2e-26   
ref|XP_010931480.1|  PREDICTED: probable ADP-ribosylation factor ...    111   2e-26   Elaeis guineensis
ref|XP_003620495.1|  Arf-GAP domain and FG repeats-containing pro...    111   2e-26   
ref|XP_009139640.1|  PREDICTED: probable ADP-ribosylation factor ...    110   2e-26   Brassica rapa
ref|XP_009139639.1|  PREDICTED: probable ADP-ribosylation factor ...    110   2e-26   Brassica rapa
ref|XP_009139636.1|  PREDICTED: probable ADP-ribosylation factor ...    110   2e-26   Brassica rapa
ref|XP_003630818.1|  hypothetical protein MTR_8g103750                  111   2e-26   Medicago truncatula
ref|XP_007024065.1|  Uncharacterized protein TCM_028636                 110   3e-26   
ref|XP_007151505.1|  hypothetical protein PHAVU_004G052500g             110   4e-26   Phaseolus vulgaris [French bean]
ref|XP_004512959.1|  PREDICTED: probable ADP-ribosylation factor ...    110   4e-26   Cicer arietinum [garbanzo]
ref|XP_004512958.1|  PREDICTED: probable ADP-ribosylation factor ...    110   4e-26   
ref|XP_004512957.1|  PREDICTED: probable ADP-ribosylation factor ...    110   4e-26   Cicer arietinum [garbanzo]
emb|CDY01122.1|  BnaA04g06970D                                          110   4e-26   
ref|XP_009389149.1|  PREDICTED: probable ADP-ribosylation factor ...    110   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT17187.1|  Arf GTPase activating protein                           110   4e-26   Saccharum hybrid cultivar R570
ref|XP_004287205.1|  PREDICTED: probable ADP-ribosylation factor ...    110   5e-26   Fragaria vesca subsp. vesca
ref|XP_007202210.1|  hypothetical protein PRUPE_ppa002501mg             110   5e-26   
ref|XP_008240628.1|  PREDICTED: probable ADP-ribosylation factor ...    110   5e-26   Prunus mume [ume]
ref|NP_001146420.1|  uncharacterized protein LOC100280000               110   5e-26   Zea mays [maize]
gb|AFW66088.1|  putative ARF GTPase-activating domain family prot...    110   5e-26   
ref|XP_010245795.1|  PREDICTED: probable ADP-ribosylation factor ...    110   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010245794.1|  PREDICTED: probable ADP-ribosylation factor ...    110   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010245793.1|  PREDICTED: probable ADP-ribosylation factor ...    110   6e-26   Nelumbo nucifera [Indian lotus]
gb|ACG43047.1|  GTP-ase activating protein for Arf containing pro...    110   7e-26   Zea mays [maize]
ref|XP_011070020.1|  PREDICTED: probable ADP-ribosylation factor ...    110   7e-26   Sesamum indicum [beniseed]
gb|KJB46060.1|  hypothetical protein B456_007G346500                    109   8e-26   Gossypium raimondii
gb|KHG17664.1|  hypothetical protein F383_06879                         109   8e-26   Gossypium arboreum [tree cotton]
gb|KDP39625.1|  hypothetical protein JCGZ_02645                         109   9e-26   Jatropha curcas
ref|XP_009389148.1|  PREDICTED: probable ADP-ribosylation factor ...    109   9e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP18503.1|  unnamed protein product                                109   1e-25   Coffea canephora [robusta coffee]
ref|XP_007029909.1|  GTPase activating protein, putative isoform 2      108   1e-25   
gb|KDO46636.1|  hypothetical protein CISIN_1g005051mg                   108   1e-25   Citrus sinensis [apfelsine]
gb|KDO46637.1|  hypothetical protein CISIN_1g005051mg                   108   1e-25   Citrus sinensis [apfelsine]
gb|KDO46638.1|  hypothetical protein CISIN_1g005051mg                   108   1e-25   Citrus sinensis [apfelsine]
ref|XP_007029910.1|  ARF GAP-like zinc finger-containing protein ...    108   1e-25   
gb|KDO46629.1|  hypothetical protein CISIN_1g005051mg                   108   1e-25   Citrus sinensis [apfelsine]
gb|KDO46630.1|  hypothetical protein CISIN_1g005051mg                   108   1e-25   Citrus sinensis [apfelsine]
ref|XP_009389146.1|  PREDICTED: probable ADP-ribosylation factor ...    108   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO46631.1|  hypothetical protein CISIN_1g005051mg                   108   1e-25   Citrus sinensis [apfelsine]
ref|XP_007029908.1|  ARF GAP-like zinc finger-containing protein ...    108   1e-25   
ref|XP_009389147.1|  PREDICTED: probable ADP-ribosylation factor ...    108   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO46632.1|  hypothetical protein CISIN_1g005051mg                   108   2e-25   Citrus sinensis [apfelsine]
ref|XP_006484788.1|  PREDICTED: probable ADP-ribosylation factor ...    108   2e-25   Citrus sinensis [apfelsine]
gb|KDO46634.1|  hypothetical protein CISIN_1g005051mg                   108   2e-25   Citrus sinensis [apfelsine]
ref|XP_006437268.1|  hypothetical protein CICLE_v10030836mg             108   2e-25   Citrus clementina [clementine]
gb|KDO46633.1|  hypothetical protein CISIN_1g005051mg                   108   2e-25   Citrus sinensis [apfelsine]
ref|XP_006484787.1|  PREDICTED: probable ADP-ribosylation factor ...    108   2e-25   Citrus sinensis [apfelsine]
gb|KDO46635.1|  hypothetical protein CISIN_1g005051mg                   108   2e-25   Citrus sinensis [apfelsine]
gb|EEC79586.1|  hypothetical protein OsI_20764                          108   2e-25   Oryza sativa Indica Group [Indian rice]
gb|EEE64486.1|  hypothetical protein OsJ_19336                          107   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056151.1|  Os05g0534800                                       108   2e-25   
ref|XP_004136610.1|  PREDICTED: probable ADP-ribosylation factor ...    108   2e-25   Cucumis sativus [cucumbers]
ref|XP_008443183.1|  PREDICTED: probable ADP-ribosylation factor ...    108   2e-25   Cucumis melo [Oriental melon]
gb|AFW71361.1|  putative ARF GTPase-activating domain family protein    107   2e-25   
gb|KJB35086.1|  hypothetical protein B456_006G099700                    101   2e-25   Gossypium raimondii
ref|XP_010109048.1|  putative ADP-ribosylation factor GTPase-acti...    108   2e-25   
ref|XP_008807338.1|  PREDICTED: probable ADP-ribosylation factor ...    108   2e-25   Phoenix dactylifera
ref|XP_009796563.1|  PREDICTED: probable ADP-ribosylation factor ...    108   3e-25   Nicotiana sylvestris
ref|XP_009796556.1|  PREDICTED: probable ADP-ribosylation factor ...    108   3e-25   Nicotiana sylvestris
ref|XP_003521869.1|  PREDICTED: probable ADP-ribosylation factor ...    108   3e-25   Glycine max [soybeans]
ref|XP_009121281.1|  PREDICTED: probable ADP-ribosylation factor ...    105   3e-25   Brassica rapa
ref|XP_010036277.1|  PREDICTED: probable ADP-ribosylation factor ...    108   3e-25   Eucalyptus grandis [rose gum]
gb|KCW47808.1|  hypothetical protein EUGRSUZ_K015481                    108   3e-25   Eucalyptus grandis [rose gum]
ref|XP_010036278.1|  PREDICTED: probable ADP-ribosylation factor ...    108   3e-25   Eucalyptus grandis [rose gum]
ref|XP_009762670.1|  PREDICTED: probable ADP-ribosylation factor ...    107   3e-25   Nicotiana sylvestris
ref|XP_009796569.1|  PREDICTED: probable ADP-ribosylation factor ...    107   4e-25   Nicotiana sylvestris
ref|XP_006654703.1|  PREDICTED: uncharacterized protein LOC102721646    107   4e-25   Oryza brachyantha
gb|EPS66065.1|  hypothetical protein M569_08710                       99.8    4e-25   Genlisea aurea
ref|XP_008681297.1|  PREDICTED: uncharacterized protein LOC100216...    107   4e-25   
ref|XP_004249094.1|  PREDICTED: probable ADP-ribosylation factor ...    107   4e-25   Solanum lycopersicum
ref|XP_006364751.1|  PREDICTED: probable ADP-ribosylation factor ...    107   5e-25   Solanum tuberosum [potatoes]
gb|KHN05268.1|  Putative ADP-ribosylation factor GTPase-activatin...    107   5e-25   Glycine soja [wild soybean]
ref|XP_003555100.1|  PREDICTED: probable ADP-ribosylation factor ...    107   5e-25   Glycine max [soybeans]
ref|XP_002530953.1|  HIV-1 rev binding protein, hrbl, putative          107   5e-25   Ricinus communis
ref|XP_003525726.1|  PREDICTED: probable ADP-ribosylation factor ...    107   6e-25   Glycine max [soybeans]
gb|KHN35582.1|  Putative ADP-ribosylation factor GTPase-activatin...    107   6e-25   Glycine soja [wild soybean]
ref|XP_009353045.1|  PREDICTED: probable ADP-ribosylation factor ...    107   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_011459144.1|  PREDICTED: uncharacterized protein LOC105349887    107   6e-25   Fragaria vesca subsp. vesca
ref|XP_009592974.1|  PREDICTED: probable ADP-ribosylation factor ...    107   7e-25   Nicotiana tomentosiformis
ref|XP_009592977.1|  PREDICTED: probable ADP-ribosylation factor ...    107   7e-25   Nicotiana tomentosiformis
ref|XP_004498622.1|  PREDICTED: probable ADP-ribosylation factor ...    106   9e-25   Cicer arietinum [garbanzo]
gb|EYU35659.1|  hypothetical protein MIMGU_mgv1a004826mg                105   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_010051219.1|  PREDICTED: probable ADP-ribosylation factor ...    105   1e-24   
ref|XP_011026535.1|  PREDICTED: probable ADP-ribosylation factor ...    106   1e-24   Populus euphratica
gb|EYU35658.1|  hypothetical protein MIMGU_mgv1a004826mg                105   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_011026534.1|  PREDICTED: probable ADP-ribosylation factor ...    106   1e-24   Populus euphratica
ref|XP_011026537.1|  PREDICTED: probable ADP-ribosylation factor ...    106   2e-24   Populus euphratica
gb|KCW89405.1|  hypothetical protein EUGRSUZ_A01700                     105   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010648572.1|  PREDICTED: probable ADP-ribosylation factor ...    105   2e-24   
gb|KJB44411.1|  hypothetical protein B456_007G251300                    105   2e-24   Gossypium raimondii
ref|XP_006476221.1|  PREDICTED: probable ADP-ribosylation factor ...    106   2e-24   Citrus sinensis [apfelsine]
gb|KJB44412.1|  hypothetical protein B456_007G251300                    105   2e-24   Gossypium raimondii
emb|CDY65431.1|  BnaA08g29820D                                          105   2e-24   Brassica napus [oilseed rape]
ref|XP_009107694.1|  PREDICTED: probable ADP-ribosylation factor ...    105   2e-24   Brassica rapa
ref|XP_009107693.1|  PREDICTED: probable ADP-ribosylation factor ...    105   2e-24   Brassica rapa
ref|XP_006285581.1|  hypothetical protein CARUB_v10007026mg             105   2e-24   
ref|XP_010550477.1|  PREDICTED: probable ADP-ribosylation factor ...    105   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_010550492.1|  PREDICTED: probable ADP-ribosylation factor ...    105   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_010665813.1|  PREDICTED: probable ADP-ribosylation factor ...    105   3e-24   
ref|XP_006450579.1|  hypothetical protein CICLE_v10010498mg             105   4e-24   
ref|XP_002324829.2|  hypothetical protein POPTR_0018s01020g             105   4e-24   
ref|XP_008806244.1|  PREDICTED: probable ADP-ribosylation factor ...    104   4e-24   
ref|XP_008806240.1|  PREDICTED: probable ADP-ribosylation factor ...    104   4e-24   Phoenix dactylifera
ref|XP_009377378.1|  PREDICTED: probable ADP-ribosylation factor ...    104   5e-24   Pyrus x bretschneideri [bai li]
gb|KDO79652.1|  hypothetical protein CISIN_1g045661mg                   104   5e-24   Citrus sinensis [apfelsine]
emb|CDP18429.1|  unnamed protein product                                104   6e-24   Coffea canephora [robusta coffee]
emb|CDY68904.1|  BnaCnng61010D                                          103   6e-24   Brassica napus [oilseed rape]
ref|XP_008672718.1|  PREDICTED: uncharacterized protein LOC100279...    104   7e-24   Zea mays [maize]
ref|XP_009125724.1|  PREDICTED: probable ADP-ribosylation factor ...    103   7e-24   Brassica rapa
ref|XP_011079155.1|  PREDICTED: probable ADP-ribosylation factor ...    103   7e-24   
ref|NP_001146152.1|  uncharacterized protein LOC100279721               104   7e-24   Zea mays [maize]
ref|XP_002456523.1|  hypothetical protein SORBIDRAFT_03g037790          104   7e-24   Sorghum bicolor [broomcorn]
ref|XP_006644891.1|  PREDICTED: probable ADP-ribosylation factor ...    104   8e-24   
gb|EAY76254.1|  hypothetical protein OsI_04189                          104   8e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001044602.1|  Os01g0813900                                       104   8e-24   
ref|XP_008357498.1|  PREDICTED: probable ADP-ribosylation factor ...    103   9e-24   
gb|EMT09716.1|  Putative ADP-ribosylation factor GTPase-activatin...    103   9e-24   
gb|KHG04223.1|  hypothetical protein F383_29715                         103   9e-24   Gossypium arboreum [tree cotton]
emb|CDX75265.1|  BnaA01g04370D                                          103   9e-24   
ref|XP_011079156.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   
ref|NP_001031002.1|  putative ADP-ribosylation factor GTPase-acti...    103   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475678.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010458119.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010489263.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010489254.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   
ref|XP_006306972.1|  hypothetical protein CARUB_v10008548mg             103   1e-23   Capsella rubella
ref|XP_010437881.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008219908.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   Prunus mume [ume]
ref|XP_006306973.1|  hypothetical protein CARUB_v10008548mg             103   1e-23   
ref|NP_172344.2|  putative ADP-ribosylation factor GTPase-activat...    103   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850941.1|  putative ADP-ribosylation factor GTPase-activat...    103   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43179.1|  hypothetical protein AALP_AA1G090300                    103   1e-23   Arabis alpina [alpine rockcress]
gb|KFK43178.1|  hypothetical protein AALP_AA1G090300                    103   1e-23   Arabis alpina [alpine rockcress]
ref|NP_001184942.1|  putative ADP-ribosylation factor GTPase-acti...    103   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417659.1|  hypothetical protein EUTSA_v10007026mg             103   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_006417657.1|  hypothetical protein EUTSA_v10007026mg             103   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_006417658.1|  hypothetical protein EUTSA_v10007026mg             103   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010922919.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   Elaeis guineensis
ref|XP_008394008.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   
ref|XP_002889709.1|  hypothetical protein ARALYDRAFT_470937             103   1e-23   
ref|XP_010922917.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   Elaeis guineensis
gb|EMS45868.1|  putative ADP-ribosylation factor GTPase-activatin...    103   1e-23   Triticum urartu
ref|XP_010922918.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   
gb|KGN60132.1|  hypothetical protein Csa_3G879500                       103   1e-23   Cucumis sativus [cucumbers]
ref|XP_007013726.1|  ArfGap/RecO-like zinc finger domain-containi...    103   1e-23   
ref|XP_008391730.1|  PREDICTED: probable ADP-ribosylation factor ...    103   1e-23   
ref|XP_006587511.1|  PREDICTED: probable ADP-ribosylation factor ...    103   2e-23   Glycine max [soybeans]
ref|XP_010447361.1|  PREDICTED: probable ADP-ribosylation factor ...    103   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004970331.1|  PREDICTED: probable ADP-ribosylation factor ...    103   2e-23   
ref|XP_010670775.1|  PREDICTED: uncharacterized protein LOC104887747    103   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002467938.1|  hypothetical protein SORBIDRAFT_01g036780          102   2e-23   Sorghum bicolor [broomcorn]
emb|CBI20945.3|  unnamed protein product                                100   2e-23   Vitis vinifera
ref|XP_008378286.1|  PREDICTED: probable ADP-ribosylation factor ...    101   2e-23   
ref|XP_010436288.1|  PREDICTED: probable ADP-ribosylation factor ...    102   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010553783.1|  PREDICTED: probable ADP-ribosylation factor ...    102   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_008466359.1|  PREDICTED: probable ADP-ribosylation factor ...    102   2e-23   Cucumis melo [Oriental melon]
ref|XP_008394005.1|  PREDICTED: probable ADP-ribosylation factor ...    103   2e-23   
ref|XP_001758951.1|  predicted protein                                  102   3e-23   
gb|ABF95689.1|  GTPase activating protein, putative, expressed          102   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984536.1|  PREDICTED: probable ADP-ribosylation factor ...    102   3e-23   
ref|XP_006412447.1|  hypothetical protein EUTSA_v10024655mg             102   3e-23   
ref|XP_004984535.1|  PREDICTED: probable ADP-ribosylation factor ...    102   3e-23   Setaria italica
ref|XP_010904972.1|  PREDICTED: probable ADP-ribosylation factor ...    102   4e-23   
ref|XP_004984533.1|  PREDICTED: probable ADP-ribosylation factor ...    102   4e-23   
emb|CDM84685.1|  unnamed protein product                                102   4e-23   
ref|XP_004984534.1|  PREDICTED: probable ADP-ribosylation factor ...    102   4e-23   
dbj|BAK07055.1|  predicted protein                                      101   5e-23   
gb|EAY87827.1|  hypothetical protein OsI_09246                          101   5e-23   
ref|XP_008338196.1|  PREDICTED: probable ADP-ribosylation factor ...  96.7    5e-23   
emb|CDY43691.1|  BnaC08g46980D                                          101   5e-23   
ref|XP_004489644.1|  PREDICTED: probable ADP-ribosylation factor ...    101   6e-23   
ref|XP_010458114.1|  PREDICTED: probable ADP-ribosylation factor ...    101   6e-23   
ref|XP_008655211.1|  PREDICTED: probable ADP-ribosylation factor ...    101   7e-23   
ref|XP_009408383.1|  PREDICTED: probable ADP-ribosylation factor ...    101   8e-23   
ref|XP_009408382.1|  PREDICTED: probable ADP-ribosylation factor ...    101   8e-23   
ref|XP_009408380.1|  PREDICTED: probable ADP-ribosylation factor ...    101   9e-23   
ref|NP_001049974.1|  Os03g0323500                                       100   1e-22   
ref|XP_007227166.1|  hypothetical protein PRUPE_ppa024658mg             101   1e-22   
ref|NP_194989.2|  ArfGap/RecO-like zinc finger domain-containing ...    100   1e-22   
ref|NP_001119100.1|  ArfGap/RecO-like zinc finger domain-containi...    100   1e-22   
ref|XP_010232480.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    101   1e-22   
gb|EMT02442.1|  Putative ADP-ribosylation factor GTPase-activatin...    101   1e-22   
gb|EMS66657.1|  putative ADP-ribosylation factor GTPase-activatin...    101   2e-22   
ref|XP_001770050.1|  predicted protein                                99.4    4e-22   
ref|XP_001773485.1|  predicted protein                                99.0    6e-22   
ref|XP_011081866.1|  PREDICTED: probable ADP-ribosylation factor ...  98.2    9e-22   
ref|XP_002869259.1|  hypothetical protein ARALYDRAFT_491451           97.4    1e-21   
gb|KJB64565.1|  hypothetical protein B456_010G054100                  97.4    2e-21   
ref|XP_010113164.1|  putative ADP-ribosylation factor GTPase-acti...  91.7    2e-21   
gb|EYU33121.1|  hypothetical protein MIMGU_mgv1a020516mg              94.4    3e-21   
ref|XP_002965858.1|  hypothetical protein SELMODRAFT_439307           95.1    3e-21   
ref|XP_002309583.2|  hypothetical protein POPTR_0006s26230g           96.7    4e-21   
dbj|BAB90399.1|  putative ARF GAP-like zinc finger-containing pro...  96.3    5e-21   
gb|EYU21903.1|  hypothetical protein MIMGU_mgv1a024605mg              94.7    6e-21   
ref|XP_006356657.1|  PREDICTED: probable ADP-ribosylation factor ...  95.1    1e-20   
ref|XP_010325273.1|  PREDICTED: probable ADP-ribosylation factor ...  94.4    2e-20   
ref|XP_011019713.1|  PREDICTED: uncharacterized protein LOC105122...  94.4    3e-20   
ref|XP_011019709.1|  PREDICTED: uncharacterized protein LOC105122...  94.4    3e-20   
ref|XP_011019714.1|  PREDICTED: uncharacterized protein LOC105122...  94.0    3e-20   
ref|XP_011019715.1|  PREDICTED: probable ADP-ribosylation factor ...  93.6    5e-20   
gb|EPS64232.1|  hypothetical protein M569_10549                       89.4    6e-20   
gb|AFW71360.1|  putative ARF GTPase-activating domain family protein  92.8    9e-20   
gb|KEH25527.1|  ARF GTPase activator                                  90.1    7e-19   
gb|KEH25528.1|  ARF GTPase activator                                  90.1    7e-19   
gb|AAF99759.1|AC003981_9  F22O13.16                                   85.9    1e-18   
gb|KJB64566.1|  hypothetical protein B456_010G054100                  89.7    1e-18   
gb|EYU24927.1|  hypothetical protein MIMGU_mgv1a020162mg              82.0    3e-18   
ref|XP_001780627.1|  predicted protein                                83.2    1e-17   
ref|XP_002516603.1|  conserved hypothetical protein                   86.3    2e-17   
emb|CDX95040.1|  BnaC05g06310D                                        85.5    3e-17   
ref|XP_009148122.1|  PREDICTED: probable ADP-ribosylation factor ...  85.5    3e-17   
emb|CDX93544.1|  BnaA06g05040D                                        85.5    3e-17   
ref|XP_006604074.1|  PREDICTED: probable ADP-ribosylation factor ...  84.7    5e-17   
ref|XP_004356450.1|  Arf GTPase activating protein                    79.7    1e-15   
ref|XP_008856972.1|  Arf GTPase activating protein                    78.2    3e-15   
dbj|BAN38789.1|  hypothetical protein, conserved                      78.2    3e-15   
gb|EMS16233.1|  stromal membrane-associated protein                   78.2    4e-15   
gb|EMD46676.1|  stromal membrane-associated protein, putative         78.2    4e-15   
ref|XP_653473.2|  hypothetical protein                                77.8    5e-15   
ref|XP_003055304.1|  predicted protein                                78.6    9e-15   
ref|XP_001741933.1|  stromal membrane-associated protein              76.3    2e-14   
ref|XP_008869860.1|  hypothetical protein H310_06530                  77.0    3e-14   
ref|XP_009836817.1|  hypothetical protein H257_11538                  76.3    4e-14   
gb|KDO29191.1|  hypothetical protein SPRG_05433                       75.9    5e-14   
ref|XP_008612823.1|  hypothetical protein SDRG_08707                  75.9    5e-14   
ref|XP_005846627.1|  hypothetical protein CHLNCDRAFT_135266           72.8    8e-14   
ref|XP_008909968.1|  hypothetical protein, variant 7                  73.6    4e-13   
gb|ETI40188.1|  hypothetical protein, variant 7                       73.6    4e-13   
ref|XP_008909966.1|  hypothetical protein, variant 5                  73.6    4e-13   
gb|ETI40186.1|  hypothetical protein, variant 5                       73.6    4e-13   
ref|XP_008909962.1|  hypothetical protein, variant 1                  73.6    5e-13   
gb|ETI40182.1|  hypothetical protein, variant 1                       73.6    5e-13   
ref|XP_008909961.1|  hypothetical protein PPTG_14423                  73.6    5e-13   
gb|ETI40181.1|  hypothetical protein F443_14354                       73.6    5e-13   
ref|XP_004258804.1|  stromal membrane-associated protein, putative    71.6    9e-13   
ref|XP_002142389.1|  hypothetical protein                             70.1    9e-13   
gb|EST48603.1|  Arf GTP activating protein                            70.5    3e-12   
gb|EWM29036.1|  adp-ribosylation factor gtpase-activating protein...  65.1    7e-12   
ref|XP_004359305.1|  Arf GTPase activating protein                    70.1    7e-12   
ref|XP_006441407.1|  hypothetical protein CICLE_v100239431mg          65.1    1e-11   
ref|XP_007149639.1|  hypothetical protein PHAVU_005G086400g           69.3    1e-11   
ref|XP_006451094.1|  hypothetical protein CICLE_v100075542mg          63.9    1e-11   
ref|XP_005792468.1|  hypothetical protein EMIHUDRAFT_631919           69.3    1e-11   
ref|XP_006841803.1|  hypothetical protein AMTR_s00003p00268700        68.9    2e-11   
ref|XP_010278369.1|  PREDICTED: probable ADP-ribosylation factor ...  68.6    2e-11   
ref|XP_010268821.1|  PREDICTED: probable ADP-ribosylation factor ...  68.6    2e-11   
ref|XP_009402611.1|  PREDICTED: probable ADP-ribosylation factor ...  68.6    2e-11   
ref|XP_009402610.1|  PREDICTED: probable ADP-ribosylation factor ...  68.6    2e-11   
ref|XP_001388247.1|  ARF GTPase activating protein                    65.9    2e-11   
ref|XP_009402612.1|  PREDICTED: probable ADP-ribosylation factor ...  68.2    2e-11   
gb|KEH19584.1|  ARF GTPase activator                                  68.2    2e-11   
ref|XP_004958030.1|  PREDICTED: probable ADP-ribosylation factor ...  68.2    2e-11   
ref|XP_010687294.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    2e-11   
ref|XP_002531044.1|  Stromal membrane-associated protein, putative    68.2    2e-11   
gb|KDP38941.1|  hypothetical protein JCGZ_00698                       68.2    2e-11   
ref|XP_010687293.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    2e-11   
ref|XP_007021273.1|  ADP-ribosylation factor GTPase-activating pr...  68.2    2e-11   
ref|XP_004958029.1|  PREDICTED: probable ADP-ribosylation factor ...  68.2    2e-11   
dbj|GAM19371.1|  hypothetical protein SAMD00019534_025460             68.6    3e-11   
ref|XP_009411992.1|  PREDICTED: probable ADP-ribosylation factor ...  68.2    3e-11   
ref|XP_009411991.1|  PREDICTED: probable ADP-ribosylation factor ...  68.2    3e-11   
ref|XP_007021272.1|  ADP-ribosylation factor GTPase-activating pr...  68.2    3e-11   
ref|XP_010687295.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    3e-11   
ref|XP_008386102.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    3e-11   
ref|XP_002961181.1|  hypothetical protein SELMODRAFT_68090            64.3    4e-11   
ref|XP_003634688.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
ref|XP_006594793.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
gb|EFA83789.1|  Arf GTPase activating protein                         68.2    5e-11   
ref|XP_009801433.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
ref|XP_009801428.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
ref|XP_009591587.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
gb|KHN36780.1|  Putative ADP-ribosylation factor GTPase-activatin...  67.4    5e-11   
ref|XP_003543266.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
ref|XP_009758306.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
ref|XP_006360130.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
ref|XP_004244190.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
ref|XP_009801421.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    5e-11   
gb|KJB81893.1|  hypothetical protein B456_013G166300                  67.0    6e-11   
ref|XP_009590935.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    6e-11   
ref|XP_009590934.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    6e-11   
tpg|DAA63145.1|  TPA: hypothetical protein ZEAMMB73_948128            64.7    6e-11   
ref|XP_010687296.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    6e-11   
ref|XP_009590932.1|  PREDICTED: probable ADP-ribosylation factor ...  67.4    6e-11   
ref|XP_009590933.1|  PREDICTED: probable ADP-ribosylation factor ...  67.0    7e-11   
gb|KHG01716.1|  putative ADP-ribosylation factor GTPase-activatin...  67.0    7e-11   
gb|KJB81892.1|  hypothetical protein B456_013G166300                  67.0    7e-11   
ref|XP_004299472.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    7e-11   
ref|XP_004516447.1|  PREDICTED: probable ADP-ribosylation factor ...  67.0    7e-11   
gb|EYU22286.1|  hypothetical protein MIMGU_mgv1a023301mg              64.7    7e-11   
ref|XP_005648476.1|  Arf GTPase activating protein                    63.5    8e-11   
gb|KJB81894.1|  hypothetical protein B456_013G166300                  65.9    8e-11   
ref|XP_004516448.1|  PREDICTED: probable ADP-ribosylation factor ...  66.6    8e-11   
ref|XP_011461156.1|  PREDICTED: probable ADP-ribosylation factor ...  66.6    8e-11   
gb|EPS68616.1|  hypothetical protein M569_06153                       64.7    8e-11   
ref|XP_009334591.1|  PREDICTED: probable ADP-ribosylation factor ...  66.6    9e-11   
ref|XP_008366529.1|  PREDICTED: probable ADP-ribosylation factor ...  66.6    9e-11   
ref|XP_008226703.1|  PREDICTED: probable ADP-ribosylation factor ...  66.6    9e-11   
ref|XP_007212019.1|  hypothetical protein PRUPE_ppa004879mg           66.6    9e-11   
ref|XP_010279445.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    9e-11   
ref|XP_004294501.1|  PREDICTED: probable ADP-ribosylation factor ...  66.6    9e-11   
ref|XP_007025767.1|  ARF-GAP domain 5, putative isoform 1             66.6    1e-10   
gb|KDO74208.1|  hypothetical protein CISIN_1g009702mg                 66.2    1e-10   
ref|XP_003540442.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
gb|KHN28022.1|  Putative ADP-ribosylation factor GTPase-activatin...  66.2    1e-10   
ref|XP_011098357.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
emb|CDP05859.1|  unnamed protein product                              66.2    1e-10   
ref|XP_006493411.1|  PREDICTED: probable ADP-ribosylation factor ...  64.3    1e-10   
ref|XP_010694420.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_010549023.1|  PREDICTED: probable ADP-ribosylation factor ...  64.3    1e-10   
gb|KHN46953.1|  Putative ADP-ribosylation factor GTPase-activatin...  66.2    1e-10   
gb|ACU23447.1|  unknown                                               65.1    1e-10   
ref|NP_001059999.1|  Os07g0563800                                     66.2    1e-10   
gb|EAZ04350.1|  hypothetical protein OsI_26489                        66.2    1e-10   
ref|XP_006657841.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
gb|KDO74207.1|  hypothetical protein CISIN_1g009702mg                 66.2    1e-10   
ref|XP_006451988.1|  hypothetical protein CICLE_v10008023mg           66.2    1e-10   
ref|XP_008454632.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_004150098.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_006370332.1|  ARF GAP-like zinc finger-containing protein ...  66.2    1e-10   
ref|XP_006464684.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_003527279.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_011044549.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_011095256.1|  PREDICTED: probable ADP-ribosylation factor ...  65.9    1e-10   
gb|KHN16012.1|  Putative ADP-ribosylation factor GTPase-activatin...  66.2    1e-10   
ref|NP_001240964.1|  uncharacterized protein LOC100807561             66.2    1e-10   
gb|KDO74206.1|  hypothetical protein CISIN_1g009702mg                 66.2    1e-10   
ref|XP_006464683.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_006451989.1|  hypothetical protein CICLE_v10008023mg           66.2    1e-10   
gb|KDO74205.1|  hypothetical protein CISIN_1g009702mg                 66.2    1e-10   
ref|XP_008806756.1|  PREDICTED: probable ADP-ribosylation factor ...  65.9    1e-10   
ref|XP_011044548.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    1e-10   
ref|XP_002463027.1|  hypothetical protein SORBIDRAFT_02g036460        65.9    2e-10   
ref|XP_011044547.1|  PREDICTED: probable ADP-ribosylation factor ...  66.2    2e-10   
ref|XP_010905130.1|  PREDICTED: probable ADP-ribosylation factor ...  65.9    2e-10   
ref|XP_005829326.1|  hypothetical protein GUITHDRAFT_45023            61.6    2e-10   
ref|XP_004248276.1|  PREDICTED: probable ADP-ribosylation factor ...  65.9    2e-10   
ref|XP_010931913.1|  PREDICTED: probable ADP-ribosylation factor ...  65.9    2e-10   
gb|KHG05861.1|  putative ADP-ribosylation factor GTPase-activatin...  65.5    2e-10   
ref|XP_008805833.1|  PREDICTED: probable ADP-ribosylation factor ...  65.9    2e-10   
ref|XP_002424611.1|  protein AGE2, putative                           65.1    2e-10   
ref|XP_010057492.1|  PREDICTED: probable ADP-ribosylation factor ...  61.6    2e-10   
ref|XP_009342444.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    2e-10   
ref|XP_006362941.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    2e-10   
ref|NP_001146187.1|  uncharacterized protein LOC100279757             65.5    2e-10   
gb|ACG36972.1|  ARF GAP-like zinc finger-containing protein ZIGA3     65.5    2e-10   
ref|XP_002316931.2|  hypothetical protein POPTR_0011s12650g           65.9    2e-10   
gb|KHG13720.1|  putative ADP-ribosylation factor GTPase-activatin...  65.5    2e-10   
ref|XP_006449234.1|  hypothetical protein CICLE_v10015133mg           65.5    2e-10   
ref|XP_011029404.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    2e-10   
ref|XP_001772371.1|  predicted protein                                62.4    2e-10   
ref|XP_009398219.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    2e-10   
ref|XP_009398218.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    2e-10   
ref|XP_004487666.1|  PREDICTED: probable ADP-ribosylation factor ...  65.1    3e-10   
ref|XP_008240348.1|  PREDICTED: probable ADP-ribosylation factor ...  63.2    3e-10   
emb|CBK23744.2|  unnamed protein product                              65.1    3e-10   
ref|XP_002316650.2|  hypothetical protein POPTR_0011s04390g           65.1    3e-10   
ref|XP_010922000.1|  PREDICTED: probable ADP-ribosylation factor ...  65.5    3e-10   
ref|XP_006377781.1|  hypothetical protein POPTR_0011s12650g           65.5    3e-10   
ref|XP_003596474.1|  Arf-GAP with coiled-coil, ANK repeat and PH ...  65.1    3e-10   
gb|KJB69397.1|  hypothetical protein B456_011G022000                  65.1    3e-10   
gb|KDO75768.1|  hypothetical protein CISIN_1g011159mg                 65.1    3e-10   
ref|XP_011043270.1|  PREDICTED: probable ADP-ribosylation factor ...  65.1    3e-10   
ref|XP_007209526.1|  hypothetical protein PRUPE_ppa010611mg           63.2    3e-10   
ref|XP_011460281.1|  PREDICTED: probable ADP-ribosylation factor ...  65.1    3e-10   
ref|XP_004293520.1|  PREDICTED: probable ADP-ribosylation factor ...  65.1    3e-10   
ref|XP_009610528.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    4e-10   
ref|XP_009610525.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    4e-10   
ref|XP_011072054.1|  PREDICTED: probable ADP-ribosylation factor ...  62.8    4e-10   
emb|CDO98576.1|  unnamed protein product                              62.8    4e-10   
ref|XP_006467881.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    4e-10   
ref|XP_009610527.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    4e-10   
ref|XP_010060508.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    4e-10   
ref|XP_010060507.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    4e-10   
gb|AES76518.2|  ADP-ribosylation factor GTPase-activating protein...  63.2    4e-10   
ref|XP_008467226.1|  PREDICTED: probable ADP-ribosylation factor ...  62.4    4e-10   
gb|KDP20898.1|  hypothetical protein JCGZ_21369                       64.7    4e-10   
ref|XP_006587429.1|  PREDICTED: probable ADP-ribosylation factor ...  62.8    4e-10   
ref|XP_006599706.1|  PREDICTED: probable ADP-ribosylation factor ...  62.8    4e-10   
ref|XP_003562882.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    5e-10   
ref|XP_011001116.1|  PREDICTED: probable ADP-ribosylation factor ...  64.3    5e-10   
gb|KGN64203.1|  hypothetical protein Csa_1G043060                     62.4    5e-10   
gb|KDO75770.1|  hypothetical protein CISIN_1g011159mg                 63.2    5e-10   
ref|XP_009044309.1|  hypothetical protein LOTGIDRAFT_184772           63.2    5e-10   



>ref|XP_011078363.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
Length=699

 Score =   126 bits (316),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NFSTF+CTTCSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRNLLKLPENRRCINCNSLGPQYVCTNFSTFVCTTCSGIHREFT  58



>ref|XP_010656352.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1 
isoform X2 [Vitis vinifera]
Length=758

 Score =   125 bits (315),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRMKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_002281316.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 emb|CBI28100.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   125 bits (315),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRMKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_010249829.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
 ref|XP_010249830.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
 ref|XP_010249831.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
Length=758

 Score =   123 bits (308),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC +F TF+CTTCSGIHREFT
Sbjct  1    MANRVKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTSFWTFVCTTCSGIHREFT  58



>ref|XP_010047752.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Eucalyptus grandis]
Length=725

 Score =   122 bits (307),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKLP+N+RCINCNSLGPQYVC +F TF+CTTCSGIHREFT
Sbjct  1    MANRIKEDEKNERIIRGLLKLPENKRCINCNSLGPQYVCTSFCTFVCTTCSGIHREFT  58



>ref|XP_010047751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Eucalyptus grandis]
 gb|KCW79713.1| hypothetical protein EUGRSUZ_C01068 [Eucalyptus grandis]
Length=733

 Score =   122 bits (307),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKLP+N+RCINCNSLGPQYVC +F TF+CTTCSGIHREFT
Sbjct  1    MANRIKEDEKNERIIRGLLKLPENKRCINCNSLGPQYVCTSFCTFVCTTCSGIHREFT  58



>ref|XP_010249832.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nelumbo nucifera]
Length=712

 Score =   122 bits (307),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC +F TF+CTTCSGIHREFT
Sbjct  1    MANRVKEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTSFWTFVCTTCSGIHREFT  58



>gb|EPS61339.1| hypothetical protein M569_13457, partial [Genlisea aurea]
Length=380

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIR LLKLP+NRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT
Sbjct  1    MANRVKEDEKNEKIIRNLLKLPENRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  58



>ref|XP_004139426.1| PREDICTED: uncharacterized protein LOC101209764 [Cucumis sativus]
Length=630

 Score =   121 bits (304),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_004167945.1| PREDICTED: uncharacterized LOC101209764 [Cucumis sativus]
 gb|KGN60631.1| hypothetical protein Csa_2G005280 [Cucumis sativus]
Length=711

 Score =   121 bits (304),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_006844366.1| hypothetical protein AMTR_s00142p00058560 [Amborella trichopoda]
 gb|ERN06041.1| hypothetical protein AMTR_s00142p00058560 [Amborella trichopoda]
Length=782

 Score =   122 bits (305),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  41   IGVQMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHRE  220
            IGV MANR KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TF+CT CSGIHRE
Sbjct  9    IGV-MANRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFVCTACSGIHRE  67

Query  221  FT  226
            FT
Sbjct  68   FT  69



>ref|XP_008458192.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Cucumis melo]
 ref|XP_008458200.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Cucumis melo]
Length=712

 Score =   121 bits (304),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_010088856.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
 gb|EXB37053.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
Length=767

 Score =   121 bits (304),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRVKEDEKNERIIRGLLKLQENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_010654693.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Vitis vinifera]
 ref|XP_010654694.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Vitis vinifera]
Length=717

 Score =   121 bits (303),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCN LGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPGNRRCINCNGLGPQYVCTNFWTFVCTTCSGIHREFT  58



>emb|CBI36171.3| unnamed protein product [Vitis vinifera]
Length=734

 Score =   121 bits (303),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCN LGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPGNRRCINCNGLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_010654688.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654689.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654690.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654691.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
 ref|XP_010654692.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Vitis vinifera]
Length=736

 Score =   121 bits (303),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCN LGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPGNRRCINCNGLGPQYVCTNFWTFVCTTCSGIHREFT  58



>gb|KJB54156.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=713

 Score =   120 bits (302),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFT
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFT  58



>gb|KJB54155.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
 gb|KJB54157.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
 gb|KJB54160.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=741

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFT
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFT  58



>gb|KJB54158.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=742

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFT
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFT  58



>gb|KJB54159.1| hypothetical protein B456_009G023500 [Gossypium raimondii]
Length=613

 Score =   120 bits (300),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KEDEKNERIIRGLLK P+NRRCINCNSLGPQYVC NF TFICTTCSGIHREFT
Sbjct  1    MAGRVKEDEKNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFT  58



>ref|XP_009415353.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Musa acuminata subsp. malaccensis]
Length=598

 Score =   119 bits (299),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +EDEKNERIIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSGIHREFT
Sbjct  1    MASRVREDEKNERIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGIHREFT  58



>ref|XP_009408824.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
 ref|XP_009408825.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=672

 Score =   120 bits (300),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCN+LGPQYVC NF TFICT CSGIHREFT
Sbjct  1    MANRVKEDEKNEKIIRGLLKLPANRRCINCNNLGPQYVCTNFWTFICTNCSGIHREFT  58



>ref|XP_009415351.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415352.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
Length=638

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +EDEKNERIIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSGIHREFT
Sbjct  1    MASRVREDEKNERIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGIHREFT  58



>ref|XP_002324405.1| Rev interacting-like family protein [Populus trichocarpa]
 gb|EEF02970.1| Rev interacting-like family protein [Populus trichocarpa]
Length=649

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKHTENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>gb|KJB27129.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=595

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>gb|KHG08531.1| hypothetical protein F383_13599 [Gossypium arboreum]
Length=693

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_010254182.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nelumbo nucifera]
 ref|XP_010254183.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nelumbo nucifera]
Length=747

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +EDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRMREDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_010934816.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Elaeis guineensis]
Length=625

 Score =   119 bits (298),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFT  58



>gb|KJB27127.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=729

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>gb|KJB27126.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=736

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>gb|KJB27130.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=737

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_011043437.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
 ref|XP_011043438.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
 ref|XP_011043439.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
Length=739

 Score =   119 bits (299),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKHTENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_010915040.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Elaeis guineensis]
Length=711

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCN+LGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNNLGPQYVCTNFWTFICTNCSGVHREFT  58



>ref|XP_010934106.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Elaeis guineensis]
Length=664

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFT  58



>ref|XP_010933331.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Elaeis guineensis]
Length=665

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFT  58



>ref|XP_010931848.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
 ref|XP_010932605.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
Length=666

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP N+RCINCNSLGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANKRCINCNSLGPQYVCTNFWTFICTNCSGLHREFT  58



>gb|KJB27131.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=715

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>gb|KDP32306.1| hypothetical protein JCGZ_13231 [Jatropha curcas]
Length=717

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKLP+NRRCINCN LGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRGLLKLPENRRCINCNCLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_009776200.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana sylvestris]
Length=693

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_009776199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana sylvestris]
Length=694

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_009627509.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana tomentosiformis]
Length=694

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_009627508.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
Length=695

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIR LLKLPDNRRC+NCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MANR-KEDEKNERIIRNLLKLPDNRRCMNCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_008242637.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=710

 Score =   119 bits (297),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_008242599.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=738

 Score =   119 bits (297),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_007203783.1| hypothetical protein PRUPE_ppa001945mg [Prunus persica]
 gb|EMJ04982.1| hypothetical protein PRUPE_ppa001945mg [Prunus persica]
Length=738

 Score =   119 bits (297),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIR LLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>gb|KDO54160.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=677

 Score =   118 bits (296),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_008808989.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Phoenix dactylifera]
Length=662

 Score =   118 bits (296),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MASRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLHREFT  58



>ref|XP_008808979.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
Length=664

 Score =   118 bits (296),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MASRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLHREFT  58



>gb|KJB27128.1| hypothetical protein B456_004G279500 [Gossypium raimondii]
Length=648

 Score =   118 bits (296),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLK P+NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MASRVKEDERNERIIRGLLKQPENRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  58



>ref|XP_008793443.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Phoenix dactylifera]
Length=667

 Score =   118 bits (296),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCN+LGPQYVC NF TFICT CSG+HREFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNNLGPQYVCTNFWTFICTNCSGVHREFT  58



>gb|KDO54159.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=743

 Score =   118 bits (296),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_006475716.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Citrus sinensis]
Length=743

 Score =   118 bits (296),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>gb|KDO54156.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
 gb|KDO54157.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
 gb|KDO54158.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=753

 Score =   118 bits (296),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_006475714.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Citrus sinensis]
 ref|XP_006475715.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Citrus sinensis]
Length=753

 Score =   118 bits (296),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>gb|KDO54161.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=711

 Score =   118 bits (296),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_006475717.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X4 [Citrus sinensis]
Length=711

 Score =   118 bits (296),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>gb|KDO54162.1| hypothetical protein CISIN_1g004435mg [Citrus sinensis]
Length=698

 Score =   118 bits (295),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNERIIRGLLKL DNRRCINCNSLG QYVC NF TF+CT CSGIHREFT
Sbjct  1    MANRLKEDEKNERIIRGLLKLQDNRRCINCNSLGTQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_010532839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Tarenaya hassleriana]
Length=669

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNER+IRGLLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MASRLKEDEKNERVIRGLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|NP_001141785.2| uncharacterized protein LOC100273921 [Zea mays]
 gb|ACF87040.2| unknown [Zea mays]
 gb|AFW78870.1| putative ARF GTPase-activating domain family protein [Zea mays]
Length=433

 Score =   115 bits (288),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDE+NE+IIRGLLKLP NRRCINCNSLGPQYVC +FSTFICT CSGIHREF+
Sbjct  1    MGSRVKEDERNEKIIRGLLKLPGNRRCINCNSLGPQYVCTSFSTFICTNCSGIHREFS  58



>ref|XP_006583397.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X5 [Glycine max]
Length=546

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNER+IRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRMKEDEKNERVIRGLLKLQHNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_008804233.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Phoenix dactylifera]
Length=662

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+ REFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLXREFT  58



>ref|XP_008804232.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
Length=663

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TFICT CSG+ REFT
Sbjct  1    MANRMKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFICTNCSGLXREFT  58



>ref|XP_004287082.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Fragaria vesca subsp. vesca]
Length=701

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  57



>ref|XP_011458060.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011458085.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Fragaria vesca subsp. vesca]
Length=726

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  57



>ref|XP_009336872.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=731

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  57



>gb|KHN21549.1| Arf-GAP domain and FG repeat-containing protein 1 [Glycine soja]
Length=697

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRGLLKLAPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_006580462.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
Length=697

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>emb|CDP03358.1| unnamed protein product [Coffea canephora]
Length=714

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R KEDEKNERIIR LLKLPDNRRCINCNSLGPQYVC+NF TF+CT CSGIHREFT
Sbjct  1    MSSR-KEDEKNERIIRNLLKLPDNRRCINCNSLGPQYVCVNFWTFVCTNCSGIHREFT  57



>ref|XP_008343980.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=663

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASR-KEDEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  57



>ref|XP_007160353.1| hypothetical protein PHAVU_002G314500g [Phaseolus vulgaris]
 gb|ESW32347.1| hypothetical protein PHAVU_002G314500g [Phaseolus vulgaris]
Length=692

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRLKEDEKNERIIRGLLKLAPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_006583396.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X4 [Glycine max]
Length=680

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNER+IRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRMKEDEKNERVIRGLLKLQHNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_006583393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
 ref|XP_006583394.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Glycine max]
 ref|XP_006583395.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Glycine max]
Length=681

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNER+IRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRMKEDEKNERVIRGLLKLQHNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_004251595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Solanum lycopersicum]
 ref|XP_010313725.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Solanum lycopersicum]
Length=691

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR +EDEKNER IR LLKLPDNRRCINCNSLGPQYVC NF TF+CTTCSG+HREFT
Sbjct  1    MANR-REDEKNERTIRNLLKLPDNRRCINCNSLGPQYVCTNFWTFVCTTCSGLHREFT  57



>ref|XP_002440136.1| hypothetical protein SORBIDRAFT_09g026670 [Sorghum bicolor]
 gb|EES18566.1| hypothetical protein SORBIDRAFT_09g026670 [Sorghum bicolor]
Length=439

 Score =   114 bits (284),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDE+NE+IIRGLLKLP NRRCINCNSLGPQYVC +FSTFICT CSGIHREF+
Sbjct  1    MGSRVKEDERNEKIIRGLLKLPGNRRCINCNSLGPQYVCTSFSTFICTNCSGIHREFS  58



>ref|XP_002863138.1| hypothetical protein ARALYDRAFT_358984 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39397.1| hypothetical protein ARALYDRAFT_358984 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   115 bits (287),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MANRVKEDEKNEKIIRSLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|XP_006286186.1| hypothetical protein CARUB_v10007750mg [Capsella rubella]
 gb|EOA19084.1| hypothetical protein CARUB_v10007750mg [Capsella rubella]
Length=627

 Score =   115 bits (287),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRSLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|XP_006587513.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X5 [Glycine max]
Length=545

 Score =   114 bits (285),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+  KEDEKNER+IRGLLKL  NRRC+NCNSLGPQYVCINF TF+CT CSGIHREFT
Sbjct  1    MASPMKEDEKNERVIRGLLKLQHNRRCVNCNSLGPQYVCINFWTFVCTNCSGIHREFT  58



>ref|XP_004512853.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
Length=687

 Score =   115 bits (287),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MTSRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_010688167.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Beta vulgaris subsp. vulgaris]
Length=712

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KED++NE++IRGLLKLP NRRC+NCN+LGPQYVC  FSTFICTTC GIHREFT
Sbjct  1    MASRLKEDDRNEKVIRGLLKLPGNRRCMNCNTLGPQYVCTTFSTFICTTCGGIHREFT  58



>ref|XP_004512854.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=686

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MTSRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_009352480.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=707

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KE+EKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASR-KEEEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  57



>ref|XP_006829864.1| hypothetical protein AMTR_s00119p00132020 [Amborella trichopoda]
 gb|ERM97280.1| hypothetical protein AMTR_s00119p00132020 [Amborella trichopoda]
Length=653

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDE+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MGSRMKEDERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_007013231.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 ref|XP_007013234.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 gb|EOY30850.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
 gb|EOY30853.1| NSP-interacting GTPase, putative isoform 1 [Theobroma cacao]
Length=752

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRGLLKQQENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_007013233.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 ref|XP_007013235.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 gb|EOY30852.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
 gb|EOY30854.1| NSP-interacting GTPase, putative isoform 3 [Theobroma cacao]
Length=753

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRGLLKQQENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>gb|EEC72722.1| hypothetical protein OsI_06328 [Oryza sativa Indica Group]
Length=722

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFT
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFT  58



>ref|NP_001046262.1| Os02g0208900 [Oryza sativa Japonica Group]
 dbj|BAD25002.1| ZIGA2 protein-like [Oryza sativa Japonica Group]
 dbj|BAD25011.1| ZIGA2 protein-like [Oryza sativa Japonica Group]
 dbj|BAF08176.1| Os02g0208900 [Oryza sativa Japonica Group]
 dbj|BAH00355.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56541.1| hypothetical protein OsJ_05850 [Oryza sativa Japonica Group]
Length=728

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFT
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFT  58



>ref|XP_007160351.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
 gb|ESW32345.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
Length=670

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+C  CSGIHREFT
Sbjct  1    MASRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCINCSGIHREFT  58



>ref|XP_007013232.1| NSP-interacting GTPase, putative isoform 2 [Theobroma cacao]
 gb|EOY30851.1| NSP-interacting GTPase, putative isoform 2 [Theobroma cacao]
Length=710

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLK  +NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRVKEDEKNERIIRGLLKQQENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_009412408.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=596

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA   KEDEKNE+IIRGLLKLP NRRCINCNSLGPQYVCINF TFIC  CSGIHREFT
Sbjct  1    MARPEKEDEKNEKIIRGLLKLPANRRCINCNSLGPQYVCINFWTFICINCSGIHREFT  58



>ref|XP_007160352.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
 gb|ESW32346.1| hypothetical protein PHAVU_002G314400g [Phaseolus vulgaris]
Length=701

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+C  CSGIHREFT
Sbjct  1    MASRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCTNFWTFVCINCSGIHREFT  58



>ref|XP_006353447.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Solanum tuberosum]
Length=695

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M NR +EDEKNER IR LLKLPDNRRCINCNSLGPQYVC NF TF+CTTCSG+HREFT
Sbjct  1    MTNR-REDEKNERTIRNLLKLPDNRRCINCNSLGPQYVCTNFWTFVCTTCSGLHREFT  57



>ref|XP_006587510.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Glycine max]
Length=679

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+  KEDEKNER+IRGLLKL  NRRC+NCNSLGPQYVCINF TF+CT CSGIHREFT
Sbjct  1    MASPMKEDEKNERVIRGLLKLQHNRRCVNCNSLGPQYVCINFWTFVCTNCSGIHREFT  58



>ref|XP_006587509.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
 gb|KHN32007.1| Arf-GAP domain and FG repeat-containing protein 1 [Glycine soja]
Length=680

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+  KEDEKNER+IRGLLKL  NRRC+NCNSLGPQYVCINF TF+CT CSGIHREFT
Sbjct  1    MASPMKEDEKNERVIRGLLKLQHNRRCVNCNSLGPQYVCINFWTFVCTNCSGIHREFT  58



>gb|KJB64872.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
 gb|KJB64873.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
 gb|KJB64874.1| hypothetical protein B456_010G069100 [Gossypium raimondii]
Length=740

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIR LLK P+NRRCINCNSLGPQYVC +F TF+C TCSGIHREFT
Sbjct  1    MASRLKEDEKNERIIRALLKQPENRRCINCNSLGPQYVCTSFWTFVCITCSGIHREFT  58



>ref|XP_006647062.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Oryza brachyantha]
Length=717

 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFT  58



>gb|EMT18497.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Aegilops tauschii]
Length=707

 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNER+IRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRVKEDEKNERVIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFT  58



>ref|XP_006584844.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
 gb|KHN16595.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Glycine soja]
Length=696

 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIRGLLKL  NRRCINCNSLGPQYVC NF TF+C  CSGIHREFT
Sbjct  1    MASRLKEDEKNERIIRGLLKLTPNRRCINCNSLGPQYVCSNFWTFVCINCSGIHREFT  58



>ref|XP_008352294.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=609

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KE+EKNERIIRGLLKLP+NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASR-KEEEKNERIIRGLLKLPENRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  57



>gb|EMS60759.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Triticum urartu]
Length=661

 Score =   114 bits (284),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNER+IRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRVKEDEKNERVIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFT  58



>emb|CDY47324.1| BnaCnng14610D [Brassica napus]
Length=594

 Score =   113 bits (282),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA   KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MAGGVKEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>dbj|BAD25003.1| human Rev interacting-like protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD25012.1| human Rev interacting-like protein-like [Oryza sativa Japonica 
Group]
Length=544

 Score =   112 bits (280),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFT
Sbjct  1    MASRLKEDERNERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFT  58



>ref|XP_008647576.1| PREDICTED: uncharacterized protein LOC100273921 isoform X1 [Zea 
mays]
Length=619

 Score =   113 bits (282),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDE+NE+IIRGLLKLP NRRCINCNSLGPQYVC +FSTFICT CSGIHREF+
Sbjct  1    MGSRVKEDERNEKIIRGLLKLPGNRRCINCNSLGPQYVCTSFSTFICTNCSGIHREFS  58



>ref|XP_006414927.1| hypothetical protein EUTSA_v10024713mg [Eutrema salsugineum]
 gb|ESQ56380.1| hypothetical protein EUTSA_v10024713mg [Eutrema salsugineum]
Length=602

 Score =   112 bits (281),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KEDEKNER IR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MAGRVKEDEKNERSIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|NP_193071.2| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
 ref|NP_849540.1| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
 gb|AAL32583.1| putative protein [Arabidopsis thaliana]
 gb|AAP37738.1| At4g13350 [Arabidopsis thaliana]
 gb|AEE83268.1| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
 gb|AEE83269.1| NSP (nuclear shuttle protein)-interacting GTPase [Arabidopsis 
thaliana]
Length=602

 Score =   112 bits (281),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KEDEKNE+IIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MAGRVKEDEKNEKIIRSLLKLPENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|XP_003571599.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brachypodium distachyon]
 ref|XP_010234027.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brachypodium distachyon]
Length=704

 Score =   113 bits (283),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE+NER+IRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRVKEDERNERVIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFT  58



>gb|KHG17023.1| hypothetical protein F383_09821 [Gossypium arboreum]
Length=774

 Score =   113 bits (283),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDEKNERIIR LLK  +NRRCINCNSLGPQYVC +F TF+CTTCSGIHREFT
Sbjct  1    MASRLKEDEKNERIIRALLKQSENRRCINCNSLGPQYVCTSFWTFVCTTCSGIHREFT  58



>ref|XP_009402905.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
 ref|XP_009402906.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Musa acuminata subsp. malaccensis]
Length=671

 Score =   112 bits (281),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MAN  KE++KNE+IIRGLLKLP NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MANLVKEEKKNEKIIRGLLKLPANRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_010450221.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010450222.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=602

 Score =   112 bits (280),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIR LLKL +N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MANRVKEDEKNEKIIRSLLKLAENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|XP_010435278.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435279.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435280.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435281.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435282.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010435283.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=602

 Score =   112 bits (280),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIR LLKL +N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MANRVKEDEKNEKIIRSLLKLAENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|XP_010440592.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440593.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440594.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440597.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010440598.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=602

 Score =   112 bits (280),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MANR KEDEKNE+IIR LLKL +N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MANRVKEDEKNEKIIRSLLKLAENKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|XP_009416362.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
Length=642

 Score =   112 bits (279),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            KEDE+NE++IRGLLKLP NR+CINCNSLGPQYVCINF TFIC TCSGIHREFT
Sbjct  5    KEDERNEKVIRGLLKLPPNRKCINCNSLGPQYVCINFWTFICVTCSGIHREFT  57



>ref|XP_004951486.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Setaria italica]
Length=717

 Score =   112 bits (280),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE++ERIIRGLLKLP N+RCINCN+LGPQYVC NF TFICT CSG HREFT
Sbjct  1    MASRVKEDERHERIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFICTNCSGAHREFT  58



>ref|XP_002319204.1| ARF GAP-like zinc finger-containing protein ZiGA4 [Populus trichocarpa]
 gb|EEE95127.1| ARF GAP-like zinc finger-containing protein ZiGA4 [Populus trichocarpa]
Length=672

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFICTTCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFT  57



>ref|XP_006375928.1| hypothetical protein POPTR_0013s06460g [Populus trichocarpa]
 gb|ERP53725.1| hypothetical protein POPTR_0013s06460g [Populus trichocarpa]
Length=677

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFICTTCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFT  57



>ref|XP_011047055.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Populus euphratica]
Length=695

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFICTTCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICTTCSGIHREFT  57



>ref|XP_010931482.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Elaeis guineensis]
Length=614

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M+NR +E+E+NE+IIRGL+KLP NR+CINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MSNR-REEERNEKIIRGLMKLPPNRKCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_010653158.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
 emb|CBI31191.3| unnamed protein product [Vitis vinifera]
Length=695

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_003620547.1| Arf-GAP domain and FG repeats-containing protein [Medicago truncatula]
 gb|AES76765.1| ARF GTPase activator [Medicago truncatula]
Length=658

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  RFKEDE+NER IR LLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MGTRFKEDERNERAIRTLLKLEPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_010931480.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Elaeis guineensis]
Length=662

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M+NR +E+E+NE+IIRGL+KLP NR+CINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MSNR-REEERNEKIIRGLMKLPPNRKCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_003620495.1| Arf-GAP domain and FG repeats-containing protein [Medicago truncatula]
Length=698

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  RFKEDE+NER IR LLKL  NRRCINCNSLGPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MGTRFKEDERNERAIRTLLKLEPNRRCINCNSLGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_009139640.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Brassica rapa]
Length=596

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  59



>ref|XP_009139639.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Brassica rapa]
Length=598

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  59



>ref|XP_009139636.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
 ref|XP_009139637.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
 ref|XP_009139638.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
Length=599

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  59



>ref|XP_003630818.1| hypothetical protein MTR_8g103750 [Medicago truncatula]
 gb|AET05294.1| ARF GTPase activator [Medicago truncatula]
Length=688

 Score =   111 bits (277),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KED+KNER IRGLLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MTSRLKEDQKNERTIRGLLKLTPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_007024065.1| Uncharacterized protein TCM_028636 [Theobroma cacao]
 gb|EOY26687.1| Uncharacterized protein TCM_028636 [Theobroma cacao]
Length=739

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  R  EDEKNE+IIRGLLKLP NRRC+NCN LGPQYVC NFSTF+C TC GIHREFT
Sbjct  1    MKGRITEDEKNEKIIRGLLKLPANRRCVNCNGLGPQYVCTNFSTFVCATCGGIHREFT  58



>ref|XP_007151505.1| hypothetical protein PHAVU_004G052500g [Phaseolus vulgaris]
 gb|ESW23499.1| hypothetical protein PHAVU_004G052500g [Phaseolus vulgaris]
Length=685

 Score =   110 bits (276),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+EKNE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFICTTCSGIHREFT
Sbjct  1    MGSR-KEEEKNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICTTCSGIHREFT  57



>ref|XP_004512959.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X3 [Cicer arietinum]
Length=694

 Score =   110 bits (276),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +EDEKNER IR LLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRLREDEKNERAIRALLKLQPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_004512958.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=695

 Score =   110 bits (276),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +EDEKNER IR LLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRLREDEKNERAIRALLKLQPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFT  58



>ref|XP_004512957.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
Length=696

 Score =   110 bits (276),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +EDEKNER IR LLKL  NRRCINCNS+GPQYVC NF TF+CT CSGIHREFT
Sbjct  1    MASRLREDEKNERAIRALLKLQPNRRCINCNSMGPQYVCTNFWTFVCTNCSGIHREFT  58



>emb|CDY01122.1| BnaA04g06970D [Brassica napus]
Length=611

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA   KEDEKNERIIR LLKLP N+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MAGGVKEDEKNERIIRSLLKLPHNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  58



>ref|XP_009389149.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Musa acuminata subsp. malaccensis]
Length=640

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFT
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFT  57



>gb|AGT17187.1| Arf GTPase activating protein [Saccharum hybrid cultivar R570]
Length=681

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRVKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGAHREFT  58



>ref|XP_004287205.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Fragaria vesca subsp. vesca]
Length=676

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCPNFWTFVCTTCSGIHREFT  57



>ref|XP_007202210.1| hypothetical protein PRUPE_ppa002501mg [Prunus persica]
 gb|EMJ03409.1| hypothetical protein PRUPE_ppa002501mg [Prunus persica]
Length=665

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MATR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCITCSGIHREFT  57



>ref|XP_008240628.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Prunus mume]
Length=683

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MATR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCITCSGIHREFT  57



>ref|NP_001146420.1| uncharacterized protein LOC100280000 [Zea mays]
 gb|ACL53929.1| unknown [Zea mays]
Length=692

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRIKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGSHREFT  58



>gb|AFW66088.1| putative ARF GTPase-activating domain family protein isoform 
1 [Zea mays]
 gb|AFW66089.1| putative ARF GTPase-activating domain family protein isoform 
2 [Zea mays]
Length=692

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRIKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGSHREFT  58



>ref|XP_010245795.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Nelumbo nucifera]
Length=688

 Score =   110 bits (274),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 46/59 (78%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +2

Query  50   QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  4    KMSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCVTCSGIHREFT  61



>ref|XP_010245794.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nelumbo nucifera]
Length=691

 Score =   110 bits (274),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 46/59 (78%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +2

Query  50   QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  4    KMSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCVTCSGIHREFT  61



>ref|XP_010245793.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nelumbo nucifera]
Length=696

 Score =   110 bits (274),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 46/59 (78%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +2

Query  50   QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  4    KMSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCVTCSGIHREFT  61



>gb|ACG43047.1| GTP-ase activating protein for Arf containing protein [Zea mays]
Length=691

 Score =   110 bits (274),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE++E+IIRGLLKLP N+RCINCN+LGPQYVC NF TF+CT CSG HREFT
Sbjct  1    MASRVKEDERHEKIIRGLLKLPANKRCINCNNLGPQYVCTNFWTFVCTNCSGSHREFT  58



>ref|XP_011070020.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
 ref|XP_011070021.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Sesamum indicum]
Length=695

 Score =   110 bits (274),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>gb|KJB46060.1| hypothetical protein B456_007G346500 [Gossypium raimondii]
Length=685

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFIC TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICMTCSGIHREFT  57



>gb|KHG17664.1| hypothetical protein F383_06879 [Gossypium arboreum]
Length=685

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFIC TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICMTCSGIHREFT  57



>gb|KDP39625.1| hypothetical protein JCGZ_02645 [Jatropha curcas]
Length=691

 Score =   109 bits (273),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TFIC TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFICMTCSGIHREFT  57



>ref|XP_009389148.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Musa acuminata subsp. malaccensis]
Length=657

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFT
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFT  57



>emb|CDP18503.1| unnamed protein product [Coffea canephora]
Length=687

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MSSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_007029909.1| GTPase activating protein, putative isoform 2 [Theobroma cacao]
 gb|EOY10411.1| GTPase activating protein, putative isoform 2 [Theobroma cacao]
Length=609

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46636.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=645

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46637.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=647

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46638.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=648

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_007029910.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
3 [Theobroma cacao]
 gb|EOY10412.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
3 [Theobroma cacao]
Length=654

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46629.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=682

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46630.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=687

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_009389146.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Musa acuminata subsp. malaccensis]
Length=690

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFT
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFT  57



>gb|KDO46631.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=690

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_007029908.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
1 [Theobroma cacao]
 gb|EOY10410.1| ARF GAP-like zinc finger-containing protein ZIGA4, putative isoform 
1 [Theobroma cacao]
Length=698

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_009389147.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Musa acuminata subsp. malaccensis]
Length=686

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            K+DE+NE+IIRGLLKLP NR+CINCNSLGPQYVC+NF TFIC TCSGIHREFT
Sbjct  5    KQDERNEKIIRGLLKLPPNRKCINCNSLGPQYVCVNFWTFICVTCSGIHREFT  57



>gb|KDO46632.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=713

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_006484788.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Citrus sinensis]
Length=713

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46634.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=714

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_006437268.1| hypothetical protein CICLE_v10030836mg [Citrus clementina]
 gb|ESR50508.1| hypothetical protein CICLE_v10030836mg [Citrus clementina]
Length=714

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46633.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=715

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_006484787.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Citrus sinensis]
Length=715

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KDO46635.1| hypothetical protein CISIN_1g005051mg [Citrus sinensis]
Length=716

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|EEC79586.1| hypothetical protein OsI_20764 [Oryza sativa Indica Group]
Length=537

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FSTF+C +CSGIHREFT
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTFVCVSCSGIHREFT  58



>gb|EEE64486.1| hypothetical protein OsJ_19336 [Oryza sativa Japonica Group]
Length=537

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FSTF+C +CSGIHREFT
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTFVCVSCSGIHREFT  58



>ref|NP_001056151.1| Os05g0534800 [Oryza sativa Japonica Group]
 gb|AAS75226.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18065.1| Os05g0534800 [Oryza sativa Japonica Group]
Length=550

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FSTF+C +CSGIHREFT
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTFVCVSCSGIHREFT  58



>ref|XP_004136610.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Cucumis sativus]
 ref|XP_004168097.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Cucumis sativus]
 gb|KGN59389.1| hypothetical protein Csa_3G816020 [Cucumis sativus]
Length=673

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NERIIRGL+KLP NRRCINCN LGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNERIIRGLMKLPPNRRCINCNGLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_008443183.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Cucumis melo]
 gb|ADN33979.1| GTPase activating protein [Cucumis melo subsp. melo]
Length=674

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NERIIRGL+KLP NRRCINCN LGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNERIIRGLMKLPPNRRCINCNGLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|AFW71361.1| putative ARF GTPase-activating domain family protein [Zea mays]
Length=467

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE++E+I+RGLLKLP N+RCINCN+LGPQY C NF TF+CT CSG HREFT
Sbjct  1    MASRVKEDERHEKILRGLLKLPANKRCINCNNLGPQYACTNFWTFVCTNCSGAHREFT  58



>gb|KJB35086.1| hypothetical protein B456_006G099700 [Gossypium raimondii]
Length=99

 Score =   101 bits (251),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  + +EDEKNE+I+R L+KLP NRRCINCNS GPQYVC NFSTF+C TCSGIHREF+
Sbjct  1    MKRKVEEDEKNEKIVRNLMKLPSNRRCINCNSQGPQYVCTNFSTFVCATCSGIHREFS  58



>ref|XP_010109048.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
 gb|EXC20800.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Morus notabilis]
Length=624

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M NR KED++ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT CSG+HREFT
Sbjct  1    MGNRIKEDDRIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFLTFVCTNCSGVHREFT  58



>ref|XP_008807338.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Phoenix dactylifera]
Length=665

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R +E+E+NE+IIRGL+KLP NR+CINCNSLGPQYVC NF TF+CTTCSGIHREFT
Sbjct  1    MSSR-REEERNEKIIRGLMKLPPNRKCINCNSLGPQYVCTNFWTFVCTTCSGIHREFT  57



>ref|XP_009796563.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana sylvestris]
Length=740

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MSSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_009796556.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana sylvestris]
Length=754

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MSSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_003521869.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Glycine max]
Length=676

 Score =   108 bits (269),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCANFWTFVCMTCSGIHREFT  57



>ref|XP_009121281.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brassica rapa]
Length=303

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            KEDEKNERIIR LLKLPDN+RCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  7    KEDEKNERIIRSLLKLPDNKRCINCNSLGPQYVCTTFWTFVCTNCSGIHREFT  59



>ref|XP_010036277.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Eucalyptus grandis]
 gb|KCW47809.1| hypothetical protein EUGRSUZ_K015481 [Eucalyptus grandis]
Length=704

 Score =   108 bits (269),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TFICTTCSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFICTTCSGIHREFT  57



>gb|KCW47808.1| hypothetical protein EUGRSUZ_K015481 [Eucalyptus grandis]
Length=685

 Score =   108 bits (269),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TFICTTCSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFICTTCSGIHREFT  57



>ref|XP_010036278.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Eucalyptus grandis]
Length=700

 Score =   108 bits (269),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TFICTTCSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFICTTCSGIHREFT  57



>ref|XP_009762670.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nicotiana sylvestris]
 ref|XP_009762678.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Nicotiana sylvestris]
Length=637

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  R KE+E+ E+IIRGLL+LPDN+RCINCNSLGPQY+C NF TF+CT CSG+HREFT
Sbjct  1    MFKRMKEEERIEKIIRGLLRLPDNKRCINCNSLGPQYICTNFWTFVCTRCSGVHREFT  58



>ref|XP_009796569.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Nicotiana sylvestris]
Length=699

 Score =   107 bits (268),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MSSR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_006654703.1| PREDICTED: uncharacterized protein LOC102721646 [Oryza brachyantha]
Length=610

 Score =   107 bits (267),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NER IR LLKLP NRRCINCNSLGPQYVC +FST +C +CSGIHREFT
Sbjct  1    MGSRVKEEERNERAIRALLKLPGNRRCINCNSLGPQYVCTSFSTLVCISCSGIHREFT  58



>gb|EPS66065.1| hypothetical protein M569_08710, partial [Genlisea aurea]
Length=82

 Score = 99.8 bits (247),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  41   IGVQMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHRE  220
            I ++M ++ +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TF+CTTCSGIHRE
Sbjct  10   ILMEMTSK-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTDFWTFVCTTCSGIHRE  68

Query  221  FT  226
            FT
Sbjct  69   FT  70



>ref|XP_008681297.1| PREDICTED: uncharacterized protein LOC100216932 isoform X1 [Zea 
mays]
Length=708

 Score =   107 bits (268),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R KEDE++E+I+RGLLKLP N+RCINCN+LGPQY C NF TF+CT CSG HREFT
Sbjct  1    MASRVKEDERHEKILRGLLKLPANKRCINCNNLGPQYACTNFWTFVCTNCSGAHREFT  58



>ref|XP_004249094.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Solanum lycopersicum]
Length=741

 Score =   107 bits (268),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R +E+E+NE+IIRGLLKLP NR+CINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MSSR-REEERNEKIIRGLLKLPPNRKCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_006364751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Solanum tuberosum]
Length=748

 Score =   107 bits (268),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R +E+E+NE+IIRGLLKLP NR+CINCNSLGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MSSR-REEERNEKIIRGLLKLPPNRKCINCNSLGPQYVCTNFWTFVCMTCSGIHREFT  57



>gb|KHN05268.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Glycine soja]
Length=697

 Score =   107 bits (267),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFT  57



>ref|XP_003555100.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
Length=697

 Score =   107 bits (267),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFT  57



>ref|XP_002530953.1| HIV-1 rev binding protein, hrbl, putative [Ricinus communis]
 gb|EEF31425.1| HIV-1 rev binding protein, hrbl, putative [Ricinus communis]
Length=692

 Score =   107 bits (267),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQ+VC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQFVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_003525726.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Glycine max]
Length=741

 Score =   107 bits (267),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFT  57



>gb|KHN35582.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Glycine soja]
Length=745

 Score =   107 bits (267),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC +F TFIC TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTSFWTFICMTCSGIHREFT  57



>ref|XP_009353045.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=698

 Score =   107 bits (267),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCN LGPQYVC NF TF+C TCSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNGLGPQYVCTNFWTFVCMTCSGIHREFT  57



>ref|XP_011459144.1| PREDICTED: uncharacterized protein LOC105349887 [Fragaria vesca 
subsp. vesca]
Length=882

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M NR +E+EK ERIIR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFT
Sbjct  1    MGNRIREEEKIERIIRSLLKLPENKRCINCNSLGPQYVCTTFLTFVCTNCSGVHREFT  58



>ref|XP_009592974.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009592976.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Nicotiana tomentosiformis]
Length=634

 Score =   107 bits (266),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  R KE+E+ E+IIRGLL+LPDN+RCINCNSLGPQY+C NF TF+CT CSG+HREFT
Sbjct  1    MFKRMKEEERIEKIIRGLLRLPDNKRCINCNSLGPQYICTNFWTFVCTRCSGVHREFT  58



>ref|XP_009592977.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Nicotiana tomentosiformis]
Length=631

 Score =   107 bits (266),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  R KE+E+ E+IIRGLL+LPDN+RCINCNSLGPQY+C NF TF+CT CSG+HREFT
Sbjct  1    MFKRMKEEERIEKIIRGLLRLPDNKRCINCNSLGPQYICTNFWTFVCTRCSGVHREFT  58



>ref|XP_004498622.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X1 [Cicer arietinum]
 ref|XP_004498623.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like isoform X2 [Cicer arietinum]
Length=694

 Score =   106 bits (265),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +  KE+E+ ERIIRGLLKLP+NRRCINCN+LGPQYVC  FSTF+CT CSGIHREFT
Sbjct  1    MGHSKKEEERVERIIRGLLKLPENRRCINCNTLGPQYVCTTFSTFVCTNCSGIHREFT  58



>gb|EYU35659.1| hypothetical protein MIMGU_mgv1a004826mg [Erythranthe guttata]
Length=481

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++  +E+E+NE+I++GLLKLP NRRCINCN+LGPQYVC NF TFIC TCSGIHREFT
Sbjct  1    MSSSKREEERNEKIVKGLLKLPPNRRCINCNNLGPQYVCTNFWTFICITCSGIHREFT  58



>ref|XP_010051219.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Eucalyptus grandis]
Length=559

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA + KEDE+ ERIIRGLLKLP+NRRCINCNSLGPQYVC  F TF+C  C GIHREFT
Sbjct  1    MAPKVKEDERLERIIRGLLKLPENRRCINCNSLGPQYVCTTFCTFVCMNCGGIHREFT  58



>ref|XP_011026535.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Populus euphratica]
Length=765

 Score =   106 bits (265),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT+CSGIHREFT
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTSCSGIHREFT  58



>gb|EYU35658.1| hypothetical protein MIMGU_mgv1a004826mg [Erythranthe guttata]
Length=508

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++  +E+E+NE+I++GLLKLP NRRCINCN+LGPQYVC NF TFIC TCSGIHREFT
Sbjct  1    MSSSKREEERNEKIVKGLLKLPPNRRCINCNNLGPQYVCTNFWTFICITCSGIHREFT  58



>ref|XP_011026534.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Populus euphratica]
Length=793

 Score =   106 bits (265),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT+CSGIHREFT
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTSCSGIHREFT  58



>ref|XP_011026537.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Populus euphratica]
Length=748

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT+CSGIHREFT
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTSCSGIHREFT  58



>gb|KCW89405.1| hypothetical protein EUGRSUZ_A01700 [Eucalyptus grandis]
Length=632

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA + KEDE+ ERIIRGLLKLP+NRRCINCNSLGPQYVC  F TF+C  C GIHREFT
Sbjct  1    MAPKVKEDERLERIIRGLLKLPENRRCINCNSLGPQYVCTTFCTFVCMNCGGIHREFT  58



>ref|XP_010648572.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
 ref|XP_010648573.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Vitis vinifera]
Length=719

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M N+ KE+EK ER IRGLLKL +NRRCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MGNKVKEEEKIERTIRGLLKLAENRRCINCNSLGPQYVCTTFLTFVCTNCSGIHREFT  58



>gb|KJB44411.1| hypothetical protein B456_007G251300 [Gossypium raimondii]
Length=650

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNS+GPQYVC NF TF+C  CSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSVGPQYVCTNFWTFVCMACSGIHREFT  57



>ref|XP_006476221.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Citrus sinensis]
Length=828

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +2

Query  50   QMANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +M N+ KEDE+ E IIRGLLKLP+NRRCINCN LGPQYVC  F TF+CT CSG+HREFT
Sbjct  3    KMGNKIKEDERIEGIIRGLLKLPENRRCINCNCLGPQYVCTTFLTFVCTNCSGVHREFT  61



>gb|KJB44412.1| hypothetical protein B456_007G251300 [Gossypium raimondii]
Length=659

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCNS+GPQYVC NF TF+C  CSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNSVGPQYVCTNFWTFVCMACSGIHREFT  57



>emb|CDY65431.1| BnaA08g29820D [Brassica napus]
Length=577

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    KE+EKNE+IIR LLKL  N+RCINCNSLGPQYVC +FSTF+CT CSGIHREFT
Sbjct  1    MGGGVKEEEKNEKIIRSLLKLAHNKRCINCNSLGPQYVCTSFSTFVCTNCSGIHREFT  58



>ref|XP_009107694.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Brassica rapa]
Length=583

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    KE+EKNE+IIR LLKL  N+RCINCNSLGPQYVC +FSTF+CT CSGIHREFT
Sbjct  1    MGGGVKEEEKNEKIIRSLLKLAHNKRCINCNSLGPQYVCTSFSTFVCTNCSGIHREFT  58



>ref|XP_009107693.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Brassica rapa]
Length=584

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    KE+EKNE+IIR LLKL  N+RCINCNSLGPQYVC +FSTF+CT CSGIHREFT
Sbjct  1    MGGGVKEEEKNEKIIRSLLKLAHNKRCINCNSLGPQYVCTSFSTFVCTNCSGIHREFT  58



>ref|XP_006285581.1| hypothetical protein CARUB_v10007026mg [Capsella rubella]
 gb|EOA18479.1| hypothetical protein CARUB_v10007026mg [Capsella rubella]
Length=631

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDE+ E+ +R LLKLP+NRRCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MGSRIKEDERIEKAVRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCTNCSGIHREFT  58



>ref|XP_010550477.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550484.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Tarenaya hassleriana]
Length=636

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MASR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  57



>ref|XP_010550492.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X3 [Tarenaya hassleriana]
Length=610

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            MA+R +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MASR-REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  57



>ref|XP_010665813.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Beta vulgaris subsp. vulgaris]
Length=635

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M++R +E+E+NE+IIRGLLKLP NRRCINCNS+GPQYVC NF TF+C  CSGIHREFT
Sbjct  1    MSSR-REEERNEKIIRGLLKLPPNRRCINCNSMGPQYVCTNFWTFVCMICSGIHREFT  57



>ref|XP_006450579.1| hypothetical protein CICLE_v10010498mg, partial [Citrus clementina]
 gb|ESR63819.1| hypothetical protein CICLE_v10010498mg, partial [Citrus clementina]
Length=776

 Score =   105 bits (262),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M N+ KEDE+ E IIRGLLKLP+NRRCINCN LGPQYVC  F TF+CT CSG+HREFT
Sbjct  1    MGNKIKEDERIEGIIRGLLKLPENRRCINCNCLGPQYVCTTFLTFVCTNCSGVHREFT  58



>ref|XP_002324829.2| hypothetical protein POPTR_0018s01020g [Populus trichocarpa]
 gb|EEF03394.2| hypothetical protein POPTR_0018s01020g [Populus trichocarpa]
Length=783

 Score =   105 bits (262),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M  + KE+E+ E+IIRGLLKLP+NRRCINCNSLGPQYVC  F TF+CT CSGIHREFT
Sbjct  1    MTKKDKEEERIEKIIRGLLKLPENRRCINCNSLGPQYVCTTFFTFVCTGCSGIHREFT  58



>ref|XP_008806244.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Phoenix dactylifera]
Length=654

 Score =   104 bits (260),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +E+E+NE+IIRGLLKLP NR+CINCNSLGPQYVC  F TF+C TCSGIHREFT
Sbjct  5    REEERNEKIIRGLLKLPPNRKCINCNSLGPQYVCTTFWTFVCMTCSGIHREFT  57



>ref|XP_008806240.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
 ref|XP_008806241.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
 ref|XP_008806242.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
 ref|XP_008806243.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Phoenix dactylifera]
Length=664

 Score =   104 bits (260),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +E+E+NE+IIRGLLKLP NR+CINCNSLGPQYVC  F TF+C TCSGIHREFT
Sbjct  5    REEERNEKIIRGLLKLPPNRKCINCNSLGPQYVCTTFWTFVCMTCSGIHREFT  57



>ref|XP_009377378.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Pyrus x bretschneideri]
Length=706

 Score =   104 bits (260),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    KEDEK+ER IR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFT
Sbjct  1    MRKGLKEDEKSERTIRSLLKLPENKRCINCNSLGPQYVCTTFLTFVCTKCSGVHREFT  58



>gb|KDO79652.1| hypothetical protein CISIN_1g045661mg, partial [Citrus sinensis]
Length=719

 Score =   104 bits (260),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M N+ KEDE+ E IIRGLLKLP+NRRCINCN LGPQYVC  F TF+CT CSG+HREFT
Sbjct  1    MGNKIKEDERIEGIIRGLLKLPENRRCINCNCLGPQYVCTTFLTFVCTNCSGVHREFT  58



>emb|CDP18429.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   104 bits (259),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +  + KE+E+ E+IIRGLLKLP+N+RCINCNSLGPQYVC  F TFICT CSG+HREFT
Sbjct  2    LKGKVKEEERIEKIIRGLLKLPENKRCINCNSLGPQYVCTTFLTFICTNCSGVHREFT  59



>emb|CDY68904.1| BnaCnng61010D, partial [Brassica napus]
Length=506

 Score =   103 bits (256),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M ++ KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MGSKMKEDERTEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFT  58



>ref|XP_008672718.1| PREDICTED: uncharacterized protein LOC100279721 isoform X1 [Zea 
mays]
Length=727

 Score =   104 bits (259),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NR+CINCNS+GPQYVC NF TFIC +CSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRKCINCNSVGPQYVCTNFWTFICLSCSGIHREFT  57



>ref|XP_009125724.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brassica rapa]
 ref|XP_009125730.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Brassica rapa]
Length=614

 Score =   103 bits (258),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M ++ KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MGSKMKEDERTEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFT  58



>ref|XP_011079155.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Sesamum indicum]
Length=657

 Score =   103 bits (258),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +E+E+NE+IIRGL+KLP NRRCINCN+LGPQYVC  F TF+C TCSGIHREFT
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNTLGPQYVCTTFWTFVCMTCSGIHREFT  57



>ref|NP_001146152.1| uncharacterized protein LOC100279721 [Zea mays]
 gb|ACN25466.1| unknown [Zea mays]
 tpg|DAA57142.1| TPA: putative ARF GTPase-activating domain family protein isoform 
1 [Zea mays]
 tpg|DAA57143.1| TPA: putative ARF GTPase-activating domain family protein isoform 
2 [Zea mays]
Length=765

 Score =   104 bits (259),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NR+CINCNS+GPQYVC NF TFIC +CSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRKCINCNSVGPQYVCTNFWTFICLSCSGIHREFT  57



>ref|XP_002456523.1| hypothetical protein SORBIDRAFT_03g037790 [Sorghum bicolor]
 gb|EES01643.1| hypothetical protein SORBIDRAFT_03g037790 [Sorghum bicolor]
Length=768

 Score =   104 bits (259),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NR+CINCNS+GPQYVC NF TFIC +CSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRKCINCNSVGPQYVCTNFWTFICLSCSGIHREFT  57



>ref|XP_006644891.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14-like [Oryza brachyantha]
Length=798

 Score =   104 bits (259),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NR+CINCNS+GPQYVC NF TFIC +CSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRKCINCNSVGPQYVCTNFWTFICLSCSGIHREFT  57



>gb|EAY76254.1| hypothetical protein OsI_04189 [Oryza sativa Indica Group]
Length=801

 Score =   104 bits (259),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NR+CINCNS+GPQYVC NF TFIC +CSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRKCINCNSVGPQYVCTNFWTFICLSCSGIHREFT  57



>ref|NP_001044602.1| Os01g0813900 [Oryza sativa Japonica Group]
 dbj|BAD82686.1| ZIGA1 protein-like [Oryza sativa Japonica Group]
 dbj|BAF06516.1| Os01g0813900 [Oryza sativa Japonica Group]
 gb|EAZ13922.1| hypothetical protein OsJ_03848 [Oryza sativa Japonica Group]
Length=801

 Score =   104 bits (259),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R +E+E+NE+IIRGL+KLP NR+CINCNS+GPQYVC NF TFIC +CSGIHREFT
Sbjct  1    MGSR-REEERNEKIIRGLMKLPPNRKCINCNSVGPQYVCTNFWTFICLSCSGIHREFT  57



>ref|XP_008357498.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Malus domestica]
Length=702

 Score =   103 bits (258),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    KEDEK+ER IR LLKLP+N+RCINCNSLGPQYVC  F TF+CT CSG+HREFT
Sbjct  1    MRKGLKEDEKSERTIRSLLKLPENKRCINCNSLGPQYVCTTFLTFVCTKCSGVHREFT  58



>gb|EMT09716.1| Putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Aegilops tauschii]
Length=580

 Score =   103 bits (257),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            KE+E+NERI+RGLLKLP NRRCINCN++GPQYVC +F TFIC +CSGIHREFT
Sbjct  7    KEEERNERIVRGLLKLPPNRRCINCNAIGPQYVCTSFWTFICISCSGIHREFT  59



>gb|KHG04223.1| hypothetical protein F383_29715 [Gossypium arboreum]
Length=653

 Score =   103 bits (258),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KE+E+NE+IIRGL+KLP NRRCINCN +GPQYVC NF TF+C  CSGIHREFT
Sbjct  1    MGSR-KEEERNEKIIRGLMKLPPNRRCINCNGVGPQYVCTNFWTFVCMACSGIHREFT  57



>emb|CDX75265.1| BnaA01g04370D [Brassica napus]
Length=613

 Score =   103 bits (257),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M ++ KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MGSKMKEDERTEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFT  58



>ref|XP_011079156.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Sesamum indicum]
Length=608

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +E+E+NE+IIRGL+KLP NRRCINCN+LGPQYVC  F TF+C TCSGIHREFT
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNTLGPQYVCTTFWTFVCMTCSGIHREFT  57



>ref|NP_001031002.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
 dbj|BAD44178.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28333.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
Length=607

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|XP_010475678.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=613

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|XP_010458119.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X4 [Camelina sativa]
Length=613

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|XP_010489263.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X2 [Camelina sativa]
Length=613

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|XP_010489254.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 isoform X1 [Camelina sativa]
Length=615

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|XP_006306972.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
 gb|EOA39870.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
Length=617

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|XP_010437881.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
 ref|XP_010437882.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Camelina sativa]
Length=648

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M +R KEDE+ E+ IR LLKLP+NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MGSRIKEDERIEKAIRSLLKLPENRRCINCNSLGPQYVCSTFWTFVCINCSGIHREFT  58



>ref|XP_008219908.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD14 [Prunus mume]
Length=730

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M NR KEDEK ER IR LLK P N+RCINCNSLGPQYVC  F TF+CT CSG+HREFT
Sbjct  1    MGNRLKEDEKIERTIRSLLKHPQNKRCINCNSLGPQYVCTTFLTFVCTNCSGVHREFT  58



>ref|XP_006306973.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
 gb|EOA39871.1| hypothetical protein CARUB_v10008548mg [Capsella rubella]
Length=646

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|NP_172344.2| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
 gb|AAL91192.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37757.1| At1g08690 [Arabidopsis thaliana]
 gb|AEE28332.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
Length=648

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>ref|NP_850941.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
 sp|Q8RXE7.2|AGD14_ARATH RecName: Full=Probable ADP-ribosylation factor GTPase-activating 
protein AGD14; Short=ARF GAP AGD14; AltName: Full=Protein 
ARF-GAP DOMAIN 14; Short=AtAGD14; AltName: Full=Protein ZIGA4 
[Arabidopsis thaliana]
 gb|AAG17005.1|AF184145_1 ARF GAP-like zinc finger-containing protein ZiGA4 [Arabidopsis 
thaliana]
 gb|AEE28331.1| putative ADP-ribosylation factor GTPase-activating protein AGD14 
[Arabidopsis thaliana]
Length=649

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  53   MANRFKEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            M    +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  1    MMGSKREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  58



>gb|KFK43179.1| hypothetical protein AALP_AA1G090300 [Arabis alpina]
Length=634

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  57



>gb|KFK43178.1| hypothetical protein AALP_AA1G090300 [Arabis alpina]
Length=635

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  68   KEDEKNERIIRGLLKLPDNRRCINCNSLGPQYVCINFSTFICTTCSGIHREFT  226
            +E+E+NE+IIRGL+KLP NRRCINCNSLGPQYVC  F TF+C  CSGIHREFT
Sbjct  5    REEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570526909590