BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016C08

Length=488
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004253113.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    249   5e-76   Solanum lycopersicum
ref|XP_011074054.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    249   6e-76   Sesamum indicum [beniseed]
ref|XP_004238468.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    247   3e-75   Solanum lycopersicum
ref|XP_007018640.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    246   7e-75   
ref|XP_009777872.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    246   1e-74   Nicotiana sylvestris
ref|XP_006342524.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    246   1e-74   Solanum tuberosum [potatoes]
ref|XP_009608062.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    245   2e-74   Nicotiana tomentosiformis
gb|EYU41211.1|  hypothetical protein MIMGU_mgv1a003012mg                245   3e-74   Erythranthe guttata [common monkey flower]
ref|XP_009759651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    244   5e-74   Nicotiana sylvestris
ref|XP_009607500.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    243   1e-73   Nicotiana tomentosiformis
sp|P21342.2|PFPA_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...    243   2e-73   Solanum tuberosum [potatoes]
gb|AHZ08764.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    243   2e-73   Nicotiana tabacum [American tobacco]
gb|KHG12069.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    242   3e-73   Gossypium arboreum [tree cotton]
ref|XP_006435470.1|  hypothetical protein CICLE_v10000595mg             239   5e-73   
ref|NP_001275358.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    241   5e-73   Solanum tuberosum [potatoes]
ref|XP_011034779.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    241   7e-73   Populus euphratica
gb|ADZ96380.2|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    241   1e-72   Eriobotrya japonica [loquat]
ref|XP_008346428.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    240   2e-72   
ref|XP_010094500.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    240   2e-72   
ref|XP_011099944.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    240   2e-72   Sesamum indicum [beniseed]
gb|KDO85265.1|  hypothetical protein CISIN_1g006964mg                   239   2e-72   Citrus sinensis [apfelsine]
ref|XP_008373335.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    240   3e-72   
gb|KCW68157.1|  hypothetical protein EUGRSUZ_F018231                    237   3e-72   Eucalyptus grandis [rose gum]
gb|KDP36731.1|  hypothetical protein JCGZ_08022                         239   4e-72   Jatropha curcas
ref|XP_006435472.1|  hypothetical protein CICLE_v10000595mg             239   4e-72   Citrus clementina [clementine]
ref|XP_002510738.1|  phosphofructokinase, putative                      239   7e-72   Ricinus communis
gb|EYU36601.1|  hypothetical protein MIMGU_mgv1a003013mg                238   8e-72   Erythranthe guttata [common monkey flower]
gb|KJB29714.1|  hypothetical protein B456_005G115600                    238   9e-72   Gossypium raimondii
gb|KJB29713.1|  hypothetical protein B456_005G115600                    238   9e-72   Gossypium raimondii
gb|KJB29715.1|  hypothetical protein B456_005G115600                    238   1e-71   Gossypium raimondii
gb|KJB29716.1|  hypothetical protein B456_005G115600                    238   1e-71   Gossypium raimondii
gb|AIE47261.1|  pyrophosphate-dependent phosphofructokinase             238   2e-71   Hevea brasiliensis [jebe]
gb|KCW68155.1|  hypothetical protein EUGRSUZ_F018231                    237   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010061240.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    238   2e-71   Eucalyptus grandis [rose gum]
ref|XP_008453023.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    238   2e-71   Cucumis melo [Oriental melon]
gb|KCW68156.1|  hypothetical protein EUGRSUZ_F018231                    237   3e-71   Eucalyptus grandis [rose gum]
ref|XP_002307823.1|  pyrophosphate-dependent phosphofructokinase ...    237   3e-71   Populus trichocarpa [western balsam poplar]
gb|ABK93964.1|  unknown                                                 237   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010266302.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    236   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_002300615.1|  pyrophosphate-dependent phosphofructokinase ...    236   4e-71   Populus trichocarpa [western balsam poplar]
gb|AAC67587.1|  pyrophosphate-dependent phosphofructokinase alpha...    236   5e-71   Citrus x paradisi [grapefruit]
ref|XP_006386123.1|  hypothetical protein POPTR_0002s00490g             236   5e-71   
gb|KCW70371.1|  hypothetical protein EUGRSUZ_F03611                     234   5e-71   Eucalyptus grandis [rose gum]
ref|XP_008796200.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    236   5e-71   Phoenix dactylifera
ref|XP_010266301.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    236   6e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010927304.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    236   6e-71   Elaeis guineensis
ref|XP_009372651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    236   7e-71   Pyrus x bretschneideri [bai li]
sp|Q41140.1|PFPA_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...    235   1e-70   Ricinus communis
ref|XP_011041141.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    235   1e-70   Populus euphratica
ref|XP_002276269.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    234   2e-70   Vitis vinifera
ref|XP_010063177.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    234   3e-70   Eucalyptus grandis [rose gum]
ref|XP_010684564.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    234   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007210294.1|  hypothetical protein PRUPE_ppa002571mg             234   6e-70   
ref|XP_008237897.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    234   8e-70   
ref|XP_003529192.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    233   1e-69   Glycine max [soybeans]
ref|XP_010913868.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    233   1e-69   Elaeis guineensis
ref|XP_004300090.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    232   2e-69   Fragaria vesca subsp. vesca
ref|XP_004145564.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    232   2e-69   
ref|XP_009391869.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    232   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003555655.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    231   5e-69   Glycine max [soybeans]
ref|XP_010537247.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    231   7e-69   Tarenaya hassleriana [spider flower]
ref|XP_004498195.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    229   2e-68   Cicer arietinum [garbanzo]
ref|XP_010270592.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    229   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_009410339.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    229   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539758.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    228   7e-68   Tarenaya hassleriana [spider flower]
ref|XP_010932134.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    228   9e-68   Elaeis guineensis
ref|XP_007153134.1|  hypothetical protein PHAVU_003G009600g             226   3e-67   Phaseolus vulgaris [French bean]
ref|XP_008775478.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    225   8e-67   Phoenix dactylifera
ref|XP_008802157.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    224   1e-66   Phoenix dactylifera
ref|XP_010527650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    224   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_009149574.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    224   2e-66   Brassica rapa
ref|XP_009414937.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    223   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006390180.1|  hypothetical protein EUTSA_v10018291mg             223   6e-66   Eutrema salsugineum [saltwater cress]
emb|CDX88295.1|  BnaC06g37390D                                          223   8e-66   
ref|XP_009106323.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    223   9e-66   Brassica rapa
ref|XP_006302013.1|  hypothetical protein CARUB_v10019988mg             222   2e-65   Capsella rubella
ref|NP_173519.1|  pyrophosphate--fructose 6-phosphate 1-phosphotr...    221   3e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87587.1|  BnaA07g32860D                                          221   3e-65   
ref|XP_006416345.1|  hypothetical protein EUTSA_v10007087mg             221   4e-65   Eutrema salsugineum [saltwater cress]
gb|KFK35354.1|  hypothetical protein AALP_AA5G273800                    221   4e-65   Arabis alpina [alpine rockcress]
ref|XP_010471809.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    220   6e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010416575.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    220   6e-65   Camelina sativa [gold-of-pleasure]
emb|CDY33660.1|  BnaC08g19600D                                          220   6e-65   Brassica napus [oilseed rape]
emb|CDY67022.1|  BnaC05g50320D                                          220   9e-65   Brassica napus [oilseed rape]
ref|XP_010498548.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    219   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002889091.1|  hypothetical protein ARALYDRAFT_476813             219   1e-64   
ref|NP_177781.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    219   1e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01310.1|  putative pyrophosphate-dependent phosphofructoki...    219   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477351.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    218   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010428720.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    218   4e-64   Camelina sativa [gold-of-pleasure]
gb|KFK42073.1|  hypothetical protein AALP_AA2G207700                    218   7e-64   Arabis alpina [alpine rockcress]
ref|XP_002893141.1|  hypothetical protein ARALYDRAFT_472333             217   1e-63   
emb|CBI40779.3|  unnamed protein product                                217   1e-63   Vitis vinifera
ref|XP_006306984.1|  hypothetical protein CARUB_v10008559mg             217   2e-63   
ref|XP_010459789.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    216   2e-63   Camelina sativa [gold-of-pleasure]
emb|CDX96611.1|  BnaA08g21540D                                          216   2e-63   
dbj|BAJ92904.1|  predicted protein                                      216   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010235882.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    215   4e-63   
ref|XP_003570229.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    215   4e-63   Brachypodium distachyon [annual false brome]
gb|EMS68198.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    214   4e-63   Triticum urartu
gb|EPS71673.1|  hypothetical protein M569_03082                         214   2e-62   Genlisea aurea
ref|XP_009417287.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    212   9e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849934.1|  hypothetical protein AMTR_s00022p00121950          207   7e-60   Amborella trichopoda
ref|XP_004498196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    202   5e-58   
ref|XP_004953678.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    201   8e-58   Setaria italica
ref|NP_001047918.1|  Os02g0714200                                       200   3e-57   
ref|XP_002452651.1|  hypothetical protein SORBIDRAFT_04g030000          199   7e-57   Sorghum bicolor [broomcorn]
ref|XP_006659170.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    197   3e-56   Oryza brachyantha
ref|NP_001057528.1|  Os06g0326400                                       197   4e-56   
gb|EEC80509.1|  hypothetical protein OsI_22776                          196   7e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_006648988.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    196   1e-55   Oryza brachyantha
gb|AFW73096.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    195   1e-55   
gb|ACN26363.1|  unknown                                                 195   2e-55   Zea mays [maize]
ref|XP_004965353.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    194   6e-55   Setaria italica
ref|NP_001146841.1|  LOC100280449                                       193   7e-55   Zea mays [maize]
dbj|BAD33246.1|  putative Pyrophosphate--fructose 6-phosphate 1-p...    193   8e-55   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001131947.1|  uncharacterized protein LOC100193340               193   8e-55   Zea mays [maize]
ref|XP_006435471.1|  hypothetical protein CICLE_v10000595mg             190   2e-54   
ref|XP_006435473.1|  hypothetical protein CICLE_v10000595mg             191   7e-54   
dbj|BAK04583.1|  predicted protein                                      185   9e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563894.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    185   1e-51   
ref|XP_003589697.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    184   2e-51   
gb|AES59948.2|  pyrophosphate-fructose-6-phosphate 1-phosphotrans...    182   5e-51   Medicago truncatula
ref|XP_004956505.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    181   2e-50   Setaria italica
gb|AEZ53899.1|  pyrophosphate-dependent fructose-6-phosphate 1-ph...    180   3e-50   Zea mays [maize]
ref|XP_008659507.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    180   7e-50   
ref|XP_006660512.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    169   6e-46   Oryza brachyantha
gb|EEC84297.1|  hypothetical protein OsI_30782                          168   1e-45   Oryza sativa Indica Group [Indian rice]
gb|EEE69397.1|  hypothetical protein OsJ_28754                          167   1e-45   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD33224.1|  putative pyrophosphate-dependent phosphofructoki...    167   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385723.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    163   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGN30570.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    162   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EMT11805.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    153   2e-43   
ref|XP_004973257.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    159   2e-42   Setaria italica
ref|XP_003573791.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    158   5e-42   Brachypodium distachyon [annual false brome]
tpg|DAA49241.1|  TPA: hypothetical protein ZEAMMB73_624432              155   2e-41   
gb|ACL53065.1|  unknown                                                 155   4e-41   Zea mays [maize]
ref|XP_002459996.1|  hypothetical protein SORBIDRAFT_02g020400          155   6e-41   Sorghum bicolor [broomcorn]
ref|NP_001061602.1|  Os08g0345700                                       154   6e-41   
ref|NP_001130747.1|  uncharacterized protein LOC100191851               154   8e-41   Zea mays [maize]
dbj|BAJ94879.1|  predicted protein                                      151   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA44428.1|  TPA: hypothetical protein ZEAMMB73_728226              143   5e-38   
ref|XP_008652527.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    134   3e-33   Zea mays [maize]
gb|AGY61464.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    127   3e-33   Rorippa sylvestris
gb|AGY61463.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    127   3e-33   Rorippa amphibia
ref|XP_001773752.1|  predicted protein                                  129   8e-32   
gb|EMS49340.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    126   3e-30   Triticum urartu
dbj|BAJ85819.1|  predicted protein                                      124   9e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002970269.1|  hypothetical protein SELMODRAFT_171380             117   4e-27   
ref|XP_002978426.1|  hypothetical protein SELMODRAFT_108705             116   4e-27   
ref|XP_001755711.1|  predicted protein                                  116   4e-27   
ref|XP_006837413.1|  hypothetical protein AMTR_s00111p00148440          116   6e-27   
gb|AGY61461.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    108   1e-25   Rorippa amphibia
ref|XP_006660071.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    112   2e-25   
ref|XP_002462125.1|  hypothetical protein SORBIDRAFT_02g019555          100   1e-23   
ref|WP_006255527.1|  diphosphate--fructose-6-phosphate 1-phosphot...  90.1    9e-18   Alloprevotella tannerae
ref|WP_006952714.1|  diphosphate--fructose-6-phosphate 1-phosphot...  89.7    1e-17   Prevotella micans
gb|ABR16683.1|  unknown                                               89.0    2e-17   Picea sitchensis
ref|WP_025002795.1|  diphosphate--fructose-6-phosphate 1-phosphot...  88.2    4e-17   Prevotella dentasini
ref|XP_002444175.1|  hypothetical protein SORBIDRAFT_07g012720        87.8    5e-17   
ref|WP_025877362.1|  diphosphate--fructose-6-phosphate 1-phosphot...  87.8    6e-17   Prevotella corporis
ref|WP_014455241.1|  diphosphate--fructose-6-phosphate 1-phosphot...  87.8    6e-17   Spirochaeta africana
ref|WP_036877364.1|  diphosphate--fructose-6-phosphate 1-phosphot...  87.4    7e-17   Prevotella oryzae
ref|WP_019188428.1|  diphosphate--fructose-6-phosphate 1-phosphot...  87.0    1e-16   Prevotella conceptionensis
ref|WP_037983302.1|  diphosphate--fructose-6-phosphate 1-phosphot...  87.0    1e-16   
ref|WP_025798196.1|  diphosphate--fructose-6-phosphate 1-phosphot...  86.7    1e-16   Prevotella saccharolytica
ref|WP_037997392.1|  diphosphate--fructose-6-phosphate 1-phosphot...  86.7    1e-16   
ref|WP_009161991.1|  diphosphate--fructose-6-phosphate 1-phosphot...  86.7    1e-16   Prevotella saccharolytica
ref|WP_009346441.1|  diphosphate--fructose-6-phosphate 1-phosphot...  86.7    1e-16   Alloprevotella rava
ref|WP_037547210.1|  diphosphate--fructose-6-phosphate 1-phosphot...  86.7    1e-16   Spirochaeta lutea
ref|WP_024268710.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...  86.3    2e-16   Salinispira pacifica
ref|WP_009229809.1|  diphosphate--fructose-6-phosphate 1-phosphot...  85.9    3e-16   Prevotella sp. oral taxon 317
gb|AIN94596.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  85.5    3e-16   Treponema putidum
gb|ADQ78315.1|  pyrophosphate-dependent phosphofructokinase           85.1    5e-16   Paludibacter propionicigenes WB4
ref|WP_006947947.1|  diphosphate--fructose-6-phosphate 1-phosphot...  85.1    5e-16   Prevotella marshii
ref|WP_041620527.1|  diphosphate--fructose-6-phosphate 1-phosphot...  85.1    5e-16   Paludibacter propionicigenes
ref|WP_021909549.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    6e-16   
ref|WP_036897542.1|  diphosphate--fructose-6-phosphate 1-phosphot...  84.7    6e-16   Prevotella sp. S7 MS 2
gb|ABS72008.1|  putative 6-phosphofructokinase                        78.2    6e-16   Olea europaea
ref|WP_014709913.1|  diphosphate--fructose-6-phosphate 1-phosphot...  84.3    8e-16   Prevotella intermedia
ref|WP_028904978.1|  diphosphate--fructose-6-phosphate 1-phosphot...  84.3    9e-16   Prevotella intermedia
ref|WP_025278280.1|  diphosphate--fructose-6-phosphate 1-phosphot...  84.3    9e-16   Barnesiella viscericola
ref|WP_009437358.1|  diphosphate--fructose-6-phosphate 1-phosphot...  84.0    1e-15   Prevotella sp. oral taxon 473
ref|WP_008861193.1|  diphosphate--fructose-6-phosphate 1-phosphot...  84.0    1e-15   Barnesiella intestinihominis
ref|WP_021892263.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  84.0    1e-15   Bacteroides sp. AF14-46
ref|WP_021671600.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    1e-15   Prevotella sp. F0091
ref|WP_005923725.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  83.6    1e-15   Bacteroides salyersiae
ref|WP_004359492.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    1e-15   Prevotella melaninogenica
ref|WP_028909804.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    1e-15   Prevotella sp. AGR2160
ref|WP_036865072.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Prevotella melaninogenica
ref|WP_008121761.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Prevotella timonensis
ref|WP_025071710.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Prevotella timonensis
ref|WP_009010591.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Prevotella
ref|WP_036925131.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Prevotella sp. ICM33
ref|WP_013265533.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Prevotella melaninogenica
ref|WP_009235627.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Prevotella sp. oral taxon 472
ref|WP_039420029.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  83.6    2e-15   Porphyromonas
ref|WP_039426896.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Porphyromonas gulae
ref|WP_039419596.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.6    2e-15   Porphyromonas gulae
ref|WP_026292223.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    2e-15   Porphyromonas gulae
gb|EGV34403.1|  diphosphate-fructose-6-phosphate 1-phosphotransfe...  83.2    2e-15   Prevotella oulorum F0390
ref|WP_018966518.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    2e-15   Prevotella loescheii
ref|WP_040561026.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    2e-15   Prevotella oulorum
ref|WP_028896044.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    2e-15   Prevotella sp. HUN102
ref|WP_025070337.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    2e-15   Prevotella oulorum
ref|WP_010956991.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    2e-15   Treponema denticola
ref|WP_002678239.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  83.2    2e-15   Treponema denticola
ref|WP_002682935.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  83.2    2e-15   Treponema denticola
ref|WP_002689303.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  83.2    2e-15   Treponema denticola
ref|WP_010699412.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  83.2    2e-15   Treponema denticola
ref|WP_002693855.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  83.2    2e-15   Treponema denticola
ref|WP_002669081.1|  diphosphate--fructose-6-phosphate 1-phosphot...  83.2    2e-15   Treponema denticola
ref|WP_004365932.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.8    3e-15   Prevotella nigrescens
ref|WP_022385737.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.8    3e-15   
ref|WP_038563379.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.8    3e-15   Draconibacterium orientale
ref|WP_025001065.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.8    3e-15   Prevotella aurantiaca
ref|WP_010697336.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  82.8    3e-15   Treponema denticola
ref|WP_025839858.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.8    3e-15   Prevotella scopos
ref|WP_013968126.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.8    3e-15   Treponema caldarium
gb|EKE04636.1|  hypothetical protein ACD_20C00035G0001                82.4    4e-15   uncultured bacterium
ref|WP_025065627.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.4    4e-15   Prevotella enoeca
ref|WP_023058711.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  82.4    4e-15   Prevotella
ref|WP_021589756.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.4    4e-15   Prevotella baroniae
ref|WP_025881004.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.4    4e-15   Prevotella baroniae
ref|WP_007902847.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  82.4    4e-15   Prevotella stercorea
ref|WP_036872035.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    5e-15   Prevotella buccalis
ref|WP_004362686.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  82.0    5e-15   Prevotella nigrescens
ref|WP_025067563.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    5e-15   Prevotella denticola
ref|WP_004353492.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    5e-15   Prevotella denticola
ref|WP_036854388.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    5e-15   Prevotella denticola
ref|WP_039876710.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    5e-15   Prevotella pleuritidis
ref|WP_004350381.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    6e-15   Prevotella buccalis
ref|WP_021854968.1|  phosphofructokinase                              82.0    6e-15   
ref|WP_024991268.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    6e-15   Prevotella pleuritidis
ref|WP_027449768.1|  diphosphate--fructose-6-phosphate 1-phosphot...  82.0    6e-15   Prevotella brevis
ref|WP_009317720.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  81.6    6e-15   Bacteroidales
gb|ERK00034.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  82.0    6e-15   Prevotella pleuritidis F0068
ref|WP_029901822.1|  diphosphate--fructose-6-phosphate 1-phosphot...  81.6    6e-15   Prevotella sp. 10(H)
ref|WP_027456161.1|  diphosphate--fructose-6-phosphate 1-phosphot...  81.6    6e-15   Prevotella brevis
ref|XP_002984967.1|  hypothetical protein SELMODRAFT_234662           81.6    6e-15   Selaginella moellendorffii
ref|WP_022231625.1|  diphosphate--fructose-6-phosphate 1-phosphot...  81.6    7e-15   
ref|XP_010275338.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  81.6    7e-15   Nelumbo nucifera [Indian lotus]
ref|WP_023924546.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  81.6    7e-15   Prevotella nigrescens
ref|WP_036927708.1|  diphosphate--fructose-6-phosphate 1-phosphot...  81.3    8e-15   Prevotella timonensis
ref|WP_023983193.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  81.3    9e-15   Prevotella
ref|WP_004370527.1|  diphosphate--fructose-6-phosphate 1-phosphot...  81.3    1e-14   Prevotella oralis
ref|WP_022158214.1|  diphosphate--fructose-6-phosphate 1-phosphot...  81.3    1e-14   
ref|XP_009386806.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  78.2    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_006798230.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.9    1e-14   Dysgonomonas gadei
ref|WP_022102965.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.9    1e-14   
ref|WP_009036817.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  79.0    1e-14   
ref|WP_042372185.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.9    1e-14   Bacteroides neonati
ref|WP_002561703.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  80.9    1e-14   Bacteroides
gb|KJF43929.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  80.9    1e-14   Draconibacterium sediminis
ref|WP_036869025.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.9    2e-14   Prevotella histicola
ref|WP_010527175.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Thermophagus xiamenensis
ref|WP_032945214.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Bacteroides vulgatus
ref|WP_022353894.1|  hypothetical protein                             80.5    2e-14   
ref|WP_005846138.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  80.5    2e-14   Bacteroides
ref|WP_028899167.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Prevotella sp. HJM029
ref|WP_008652858.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  80.5    2e-14   Bacteroides
ref|WP_025017895.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Bacteroides sartorii
ref|WP_007842406.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  80.5    2e-14   Bacteroides
ref|WP_013672124.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Prevotella denticola
ref|WP_008822440.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Prevotella histicola
ref|WP_005936237.1|  MULTISPECIES: diphosphate-fructose-6-phospha...  80.5    2e-14   Bacteroides
ref|WP_036864816.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Prevotella bivia
ref|WP_008448175.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Prevotella amnii
ref|WP_025790489.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.5    2e-14   Prevotella histicola
ref|WP_022130193.1|  hypothetical protein                             80.5    2e-14   
ref|WP_018109477.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    2e-14   Bacteroides propionicifaciens
ref|WP_004357175.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    2e-14   Prevotella disiens
ref|WP_036856523.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    2e-14   Prevotella amnii
ref|WP_019036414.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    2e-14   Prevotella amnii
ref|XP_002986153.1|  hypothetical protein SELMODRAFT_234963           80.1    2e-14   Selaginella moellendorffii
ref|WP_036881935.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    2e-14   Prevotella disiens
ref|WP_021670104.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    2e-14   Prevotella disiens
ref|WP_024989602.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    3e-14   Prevotella albensis
ref|WP_006846630.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    3e-14   Prevotella copri
ref|WP_007366298.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    3e-14   
gb|EFB33295.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  80.1    3e-14   
ref|WP_006843040.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    3e-14   
ref|WP_018464632.1|  diphosphate--fructose-6-phosphate 1-phosphot...  80.1    3e-14   
ref|WP_018909818.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    3e-14   
ref|WP_009434216.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    3e-14   
ref|WP_004383638.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    3e-14   
ref|WP_022511727.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    3e-14   
ref|WP_007658653.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  79.7    3e-14   
ref|WP_004376175.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    3e-14   
ref|WP_026625143.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    3e-14   
ref|WP_007837134.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    3e-14   
ref|WP_018669292.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    4e-14   
ref|WP_038605987.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.7    4e-14   
ref|WP_008771783.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    4e-14   
ref|WP_022340120.1|  MULTISPECIES: hypothetical protein               79.3    4e-14   
ref|WP_007570582.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  79.3    4e-14   
ref|WP_036890490.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    4e-14   
ref|WP_026285932.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    4e-14   
ref|WP_036790212.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  79.3    4e-14   
ref|WP_018361565.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    4e-14   
ref|WP_016276863.1|  MULTISPECIES: diphosphate-fructose-6-phospha...  79.3    5e-14   
ref|WP_022406493.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  79.3    5e-14   
ref|WP_036866222.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    5e-14   
ref|WP_027470899.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    5e-14   
ref|WP_007133749.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    5e-14   
ref|WP_004337289.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.3    5e-14   
ref|WP_006044710.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    5e-14   
ref|WP_007172919.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_022121202.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_021980053.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_008627564.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_032590268.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_005815165.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_009227259.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_032583802.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    6e-14   
ref|WP_005788903.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  79.0    6e-14   
ref|WP_005780146.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  79.0    7e-14   
ref|WP_028727537.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    7e-14   
ref|WP_008158638.1|  diphosphate--fructose-6-phosphate 1-phosphot...  79.0    7e-14   
ref|WP_022480045.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    7e-14   
ref|WP_022150455.1|  phosphofructokinase                              78.6    8e-14   
ref|WP_008144348.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  78.6    8e-14   
ref|WP_006189908.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    8e-14   
ref|WP_004340656.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    8e-14   
ref|WP_005640886.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    8e-14   
ref|WP_004345857.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    8e-14   
ref|WP_007412056.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    8e-14   
ref|WP_021964522.1|  phosphofructokinase                              78.6    9e-14   
ref|WP_022322946.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    9e-14   
ref|WP_005647732.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    9e-14   
ref|WP_018028382.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    9e-14   
ref|WP_036869019.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.6    9e-14   
ref|WP_022053735.1|  hypothetical protein                             78.2    1e-13   
ref|WP_013617020.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.2    1e-13   
ref|WP_027951653.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.2    1e-13   
ref|WP_015711192.1|  diphosphate--fructose-6-phosphate 1-phosphot...  78.2    1e-13   
gb|AAO72618.1|  fructose-6-phosphate 1-phosphotransferase             77.4    1e-13   
ref|WP_007561750.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    1e-13   
ref|WP_036613717.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    1e-13   
ref|WP_010261490.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    1e-13   
ref|WP_016518245.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  77.8    1e-13   
ref|WP_007574011.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    1e-13   
ref|WP_008622743.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    1e-13   
ref|WP_005846772.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    1e-13   
ref|WP_005855923.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  77.8    1e-13   
ref|WP_023847292.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    2e-13   
ref|WP_036650726.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    2e-13   
emb|CBK21183.2|  unnamed protein product                              77.8    2e-13   
ref|WP_021662033.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    2e-13   
gb|EPT34726.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  77.8    2e-13   
ref|WP_008564004.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    2e-13   
ref|WP_036787718.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    2e-13   
ref|WP_022252312.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    2e-13   
ref|WP_013607434.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.8    2e-13   
ref|WP_008145850.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  77.4    2e-13   
ref|WP_035455514.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.4    2e-13   
ref|WP_036829398.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.4    2e-13   
ref|WP_021940332.1|  hypothetical protein                             77.0    2e-13   
ref|WP_022302275.1|  phosphofructokinase                              76.6    2e-13   
ref|WP_019967261.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.4    2e-13   
ref|WP_005798671.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.4    2e-13   
ref|WP_022040715.1|  diphosphate/fructose-6-phosphate 1-phosphotr...  77.4    2e-13   
ref|WP_022311541.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_028912949.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_044468201.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_025863645.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_022328315.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_013815410.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_021931216.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  77.0    3e-13   
ref|WP_021677112.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_010663795.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_004583807.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_006745515.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_012457385.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_021663363.1|  diphosphate--fructose-6-phosphate 1-phosphot...  77.0    3e-13   
ref|WP_021846571.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  77.0    3e-13   
ref|WP_021896515.1|  pyrophosphate-dependent phosphofructokinase      76.6    3e-13   
ref|WP_022111322.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.6    3e-13   
ref|WP_024752338.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.6    3e-13   
ref|WP_004292707.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.6    3e-13   
ref|WP_016524203.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  76.6    3e-13   
ref|WP_004290431.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.6    4e-13   
ref|WP_022020075.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  76.6    4e-13   
ref|WP_021687206.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.6    4e-13   
ref|WP_013758252.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.6    4e-13   
ref|WP_016661325.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  76.6    4e-13   
ref|WP_002701079.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.6    4e-13   
ref|WP_022103660.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  76.6    4e-13   
ref|XP_002869963.1|  predicted protein                                71.2    4e-13   
ref|WP_044227866.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.3    5e-13   
ref|WP_022163440.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  76.3    5e-13   
gb|EDS15317.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  76.3    5e-13   
ref|WP_010537577.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.3    5e-13   
ref|WP_024996790.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.3    5e-13   
ref|WP_005826644.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  76.3    5e-13   
ref|WP_021947313.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.3    6e-13   
ref|WP_028973346.1|  diphosphate--fructose-6-phosphate 1-phosphot...  76.3    6e-13   
ref|WP_025081450.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    6e-13   
ref|WP_028507542.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    6e-13   
ref|WP_022275035.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    7e-13   
ref|WP_013064630.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    7e-13   
ref|WP_033149315.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    7e-13   
ref|WP_028908471.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    7e-13   
dbj|BAG83826.1|  pyrophosphate--fructose-6-phosphate 1-phosphotra...  75.9    7e-13   
ref|WP_041572541.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    7e-13   
gb|AFW86518.1|  hypothetical protein ZEAMMB73_272382                  74.3    8e-13   
ref|WP_019893247.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    8e-13   
ref|WP_010422435.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.9    8e-13   
gb|EXZ67313.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  75.5    8e-13   
ref|WP_024986627.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.5    9e-13   
ref|WP_028903737.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  75.5    9e-13   
ref|WP_044233209.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.5    1e-12   
ref|WP_022081702.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  75.1    1e-12   
ref|WP_034449876.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    1e-12   
ref|WP_044190829.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    1e-12   
ref|WP_021851985.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    1e-12   
ref|WP_007757428.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    1e-12   
ref|WP_024994586.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    1e-12   
ref|WP_007758927.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    1e-12   
ref|WP_036911117.1|  diphosphate--fructose-6-phosphate 1-phosphot...  75.1    1e-12   
ref|WP_009120576.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.7    2e-12   
ref|WP_044160982.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.7    2e-12   
ref|WP_016777789.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.7    2e-12   
ref|WP_024467519.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    2e-12   
ref|WP_009433397.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    2e-12   
ref|WP_018358521.1|  diphosphate--fructose-6-phosphate 1-phosphot...  74.3    2e-12   
ref|WP_016318768.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  74.3    2e-12   
ref|WP_021990869.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.9    3e-12   
ref|WP_020966487.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.9    3e-12   
ref|WP_022458961.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.9    3e-12   
ref|WP_044115791.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.9    3e-12   
ref|WP_009123978.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_023939250.1|  pyrophosphate-fructose 6-phosphate 1-phospho...  73.6    4e-12   
ref|WP_040235710.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_012538601.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_012537796.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_038365814.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_014695934.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_036888374.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_044072458.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    4e-12   
ref|WP_023937210.1|  pyrophosphate-fructose 6-phosphate 1-phospho...  73.6    4e-12   
gb|KDU78280.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  73.6    5e-12   
ref|WP_022217804.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.6    5e-12   
ref|WP_020613720.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    5e-12   
ref|WP_010881989.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    6e-12   
ref|WP_044168564.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    6e-12   
ref|WP_013945180.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    6e-12   
ref|WP_014342471.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    6e-12   
ref|WP_031534286.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  73.2    6e-12   
ref|WP_005467407.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    6e-12   
ref|WP_024655758.1|  diphosphate--fructose-6-phosphate 1-phosphot...  73.2    7e-12   
ref|WP_022315998.1|  MULTISPECIES: phosphofructokinase                72.8    7e-12   
ref|XP_010935015.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  72.8    7e-12   
ref|WP_025407541.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    7e-12   
ref|WP_025375079.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    7e-12   
ref|XP_010935016.1|  PREDICTED: pyrophosphate--fructose 6-phospha...  72.8    8e-12   
ref|WP_022442023.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.8    8e-12   
ref|WP_013548412.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    9e-12   
ref|WP_014625405.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    9e-12   
ref|WP_013314522.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    1e-11   
ref|WP_025074602.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    1e-11   
ref|WP_036893684.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    1e-11   
ref|WP_013254833.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.4    1e-11   
ref|WP_014223699.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    1e-11   
ref|WP_021667347.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    1e-11   
ref|WP_026475518.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    1e-11   
ref|WP_022491531.1|  diphosphate--fructose-6-phosphate 1-phosphot...  72.0    2e-11   
ref|WP_025267586.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    2e-11   
ref|WP_025400472.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    2e-11   
ref|WP_016525088.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  71.6    2e-11   
ref|WP_011771984.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    2e-11   
ref|WP_044533074.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    2e-11   
gb|EFW24308.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  71.6    2e-11   
ref|WP_021916966.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.6    2e-11   
ref|WP_044264258.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    2e-11   
ref|WP_007214428.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  71.2    2e-11   
ref|WP_022454393.1|  phosphofructokinase                              71.2    2e-11   
ref|WP_040627712.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    2e-11   
ref|WP_028077990.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    2e-11   
ref|WP_027325820.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    2e-11   
ref|WP_020954416.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    3e-11   
ref|WP_022392567.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  71.2    3e-11   
ref|WP_018525631.1|  hypothetical protein                             71.2    3e-11   
ref|WP_007663913.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    3e-11   
ref|WP_021966993.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    3e-11   
ref|WP_015708501.1|  diphosphate--fructose-6-phosphate 1-phosphot...  71.2    3e-11   
ref|WP_012415175.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.9    4e-11   
ref|WP_009131195.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  70.9    4e-11   
ref|WP_021645136.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.9    4e-11   
ref|WP_025399380.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.5    4e-11   
ref|WP_025831498.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.5    5e-11   
ref|WP_021914328.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    6e-11   
ref|WP_034542387.1|  diphosphate--fructose-6-phosphate 1-phosphot...  70.1    7e-11   
ref|WP_016562813.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  70.1    7e-11   
ref|WP_016267907.1|  diphosphate-fructose-6-phosphate 1-phosphotr...  70.1    7e-11   
ref|WP_008760603.1|  MULTISPECIES: diphosphate--fructose-6-phosph...  69.7    7e-11   
ref|WP_004798470.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.7    8e-11   
dbj|GAE16760.1|  pyrophosphate-dependent fructose 6-phosphate-1-k...  69.7    8e-11   
ref|WP_007277807.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.7    8e-11   
ref|WP_036881252.1|  diphosphate--fructose-6-phosphate 1-phosphot...  69.7    8e-11   



>ref|XP_004253113.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum lycopersicum]
Length=617

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ARELSDLQKLRSQY+PELPPCLQGTTVRVE GDATTAADPSG H ISR FPHT
Sbjct  1    MDADYGIARELSDLQKLRSQYQPELPPCLQGTTVRVELGDATTAADPSGEHVISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVSDAQIITEHPAKRVGIVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+DILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDILAT  146



>ref|XP_011074054.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Sesamum indicum]
Length=616

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRSQY+PELPPCLQGTTVRVEFGDAT AADPSG HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSQYQPELPPCLQGTTVRVEFGDATIAADPSGAHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQP+AHFLRA+AKVPDAQIITEHPA+RVG+VFCGRQSPGGHN +WGL +ALKVHNP S 
Sbjct  61   YGQPIAHFLRATAKVPDAQIITEHPAVRVGVVFCGRQSPGGHNVVWGLLEALKVHNPESV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+TD+ILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEVTDEILAT  146



>ref|XP_004238468.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Solanum lycopersicum]
Length=616

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ARELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1    MDADYGIARELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNPN+ 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPNNI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+LAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLAT  146



>ref|XP_007018640.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
 gb|EOY15865.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
Length=617

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRSQY+P LPPCL+GTTVRVEFGDATTA DP+  HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSQYQPGLPPCLEGTTVRVEFGDATTALDPADAHTISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPA+RVG+VFCGRQSPGGHN IWGL+ ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAMRVGLVFCGRQSPGGHNVIWGLHKALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG++GLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILST  146



>ref|XP_009777872.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ RELSDLQKLRSQY+PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSQYQPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHP IRVG++FCGRQSPGGHN +WGL+DALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPVIRVGVLFCGRQSPGGHNVLWGLHDALKVHNPNNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+D+LAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLAT  146



>ref|XP_006342524.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum tuberosum]
Length=617

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ARELSDLQKLRSQY+PELPPCLQGTTVRVE GDATTAAD SG H ISR FPHT
Sbjct  1    MDADYGIARELSDLQKLRSQYQPELPPCLQGTTVRVELGDATTAADHSGEHVISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVSDAQIITEHPAKRVGIVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+DILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDILAT  146



>ref|XP_009608062.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Nicotiana 
tomentosiformis]
Length=616

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ RELSDLQKLRSQY+PELPPCLQGTTVRVE  DAT AADPSG HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSQYQPELPPCLQGTTVRVELRDATIAADPSGEHTIKRFFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHP IRVG++FCGRQSPGGHN IWGL+DALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPVIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPNNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+D+LAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLAT  146



>gb|EYU41211.1| hypothetical protein MIMGU_mgv1a003012mg [Erythranthe guttata]
Length=616

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G ARELSDLQKLRS Y+PELPPCLQGTTV VEFGD TTAADP G HTISR FPHT
Sbjct  1    MDSDYGTARELSDLQKLRSHYQPELPPCLQGTTVSVEFGDVTTAADPLGAHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQP+AHFLRASAKVPDAQIIT+HPA+RVG+VFCGRQSPGGHN IWGL DALKVHNP ST
Sbjct  61   YGQPIAHFLRASAKVPDAQIITDHPAVRVGVVFCGRQSPGGHNVIWGLLDALKVHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD ILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDQILAT  146



>ref|XP_009759651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GDATTA+DPSG HTISR FPHT
Sbjct  1    MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDATTASDPSGEHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVTDAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+D+L+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLST  146



>ref|XP_009607500.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Nicotiana tomentosiformis]
Length=616

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GDATTA+DPSG HTISR FPHT
Sbjct  1    MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDATTASDPSGEHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNS+
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNSS  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+D+L+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLST  146



>sp|P21342.2|PFPA_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Solanum tuberosum]
Length=616

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ RELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPKNI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+LAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLAT  146



>gb|AHZ08764.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Nicotiana 
tabacum]
Length=616

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GD TTA+DPSG HTISR FPHT
Sbjct  1    MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDTTTASDPSGEHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVTDAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+D+L+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLST  146



>gb|KHG12069.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Gossypium arboreum]
Length=616

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G+PLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPAIRVGLVFCGRQSPGGHNVVWGLHKALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG++GLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILST  146



>ref|XP_006435470.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48710.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85269.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85270.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=494

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+T +IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEILST  146



>ref|NP_001275358.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Solanum tuberosum]
 gb|AAA63451.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha-subunit 
[Solanum tuberosum]
Length=616

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MD+D+G+ RELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADP+G HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPAGEHTIKRFFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPKNI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+LAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLAT  146



>ref|XP_011034779.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Populus euphratica]
Length=617

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADP+  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTCADPADVHAISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEG FAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGFFAQKTLEITDDILET  146



>gb|ADZ96380.2| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Eriobotrya 
japonica]
Length=617

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVGIVFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGIVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+ILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILAT  146



>ref|XP_008346428.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+ILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILAT  146



>ref|XP_010094500.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
 gb|EXB56254.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
Length=631

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRS Y+P LPPCL+GTTVRVEFGDATT  DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPVLPPCLEGTTVRVEFGDATTTLDPTDVHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDA IITEHPA RVGIVFCGRQSPGGHN IWGLY+ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAHIITEHPAKRVGIVFCGRQSPGGHNVIWGLYNALKLHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILAT  146



>ref|XP_011099944.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Sesamum indicum]
Length=626

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ARELS LQ LRSQY+P+LPPCLQGTTV VEFGDATTA DPS  HTISR FPHT
Sbjct  1    MDSDFGVARELSHLQNLRSQYQPQLPPCLQGTTVSVEFGDATTAPDPSDTHTISRFFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVP+AQ+ITE+PA+RVG+VFCGRQSPGGHN IWGL DALKVHNP ST
Sbjct  61   YGQPLAHFLRATAKVPNAQVITEYPAVRVGVVFCGRQSPGGHNVIWGLLDALKVHNPEST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILRT  146



>gb|KDO85265.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=588

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+T +IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEILST  146



>ref|XP_008373335.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+ILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILAT  146



>gb|KCW68157.1| hypothetical protein EUGRSUZ_F018231 [Eucalyptus grandis]
Length=520

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILST  146



>gb|KDP36731.1| hypothetical protein JCGZ_08022 [Jatropha curcas]
Length=617

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS+LQK RS Y+PELPPCLQGTTVRVEFGD T AAD +G HTISR FPHT
Sbjct  1    MDSDFGIPRELSELQKQRSHYQPELPPCLQGTTVRVEFGDGTIAADAAGAHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDA IITEHPA+RVGIVFCGRQSPGGHN IWGL +ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAHIITEHPAMRVGIVFCGRQSPGGHNVIWGLLNALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILST  146



>ref|XP_006435472.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006473868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Citrus sinensis]
 gb|ABY25305.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
sinensis x Citrus trifoliata]
 gb|ESR48712.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85266.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=615

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+T +IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEILST  146



>ref|XP_002510738.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF52925.1| phosphofructokinase, putative [Ricinus communis]
Length=617

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVE GD TTAAD +G HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTTVRVELGDGTTAADEAGAHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DA II+EHPA+RVG+VFCGRQSPGGHN +WGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVADAHIISEHPAMRVGVVFCGRQSPGGHNVVWGLHNALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+TDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEVTDDILST  146



>gb|EYU36601.1| hypothetical protein MIMGU_mgv1a003013mg [Erythranthe guttata]
Length=616

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ARELSDLQKLRS Y+PELPPCLQGTTVRV FGDAT AADP+G HTISR FP T
Sbjct  1    MDSDYGIARELSDLQKLRSHYQPELPPCLQGTTVRVHFGDATAAADPTGAHTISRSFPLT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR++AKVPDAQIITEH A+RVG+VFCGRQSPGGHN IWGL++ALKVHNP S 
Sbjct  61   YGQPLAHFLRSTAKVPDAQIITEHAAVRVGVVFCGRQSPGGHNVIWGLHEALKVHNPKSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGS+GLFAQKTLE+TD++LAT
Sbjct  121  LLGFLGGSDGLFAQKTLEVTDEVLAT  146



>gb|KJB29714.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=617

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG++GLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILST  146



>gb|KJB29713.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=616

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG++GLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILST  146



>gb|KJB29715.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=589

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG++GLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILST  146



>gb|KJB29716.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=586

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG++GLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILST  146



>gb|AIE47261.1| pyrophosphate-dependent phosphofructokinase [Hevea brasiliensis]
Length=617

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS+LQKLRS Y P+LPPCLQGTTVRVEFGD+TTAAD +G  TISR FPHT
Sbjct  1    MDSDFGIPRELSELQKLRSIYEPDLPPCLQGTTVRVEFGDSTTAADAAGARTISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDA IITEHPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAHIITEHPAMRVGIVFCGRQSPGGHNVVWGLLNALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQ+TLEITD++L+T
Sbjct  121  LLGFLGGSEGLFAQRTLEITDEVLST  146



>gb|KCW68155.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=575

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILST  146



>ref|XP_010061240.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
Length=617

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILST  146



>ref|XP_008453023.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Cucumis melo]
Length=619

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ R+LSDLQK+RS Y+P+LPPCLQGT VRVEFGDATTA DP+   TI R FPHT
Sbjct  1    MDSDYGIPRQLSDLQKIRSLYQPDLPPCLQGTAVRVEFGDATTAVDPADAPTICRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+DALK+HNPNS 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHDALKIHNPNSI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L GFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LFGFLGGSEGLFAQKTLEITDDILST  146



>gb|KCW68156.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=599

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD+IL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILST  146



>ref|XP_002307823.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE94819.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRASAKV DAQIIT+HPA RVGIVFCGRQSPGGHN IWGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRASAKVSDAQIITDHPAFRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILST  146



>gb|ABK93964.1| unknown [Populus trichocarpa]
Length=617

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRASAKV DAQIIT+HPA RVGIVFCGRQSPGGHN IWGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRASAKVSDAQIITDHPAFRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILST  146



>ref|XP_010266302.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X2 [Nelumbo nucifera]
Length=597

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ R+LSDLQK R+ Y PELPPCLQGTTVRVEFGDATT ADPSG H+ISR FPHT
Sbjct  1    MDSDFGIPRQLSDLQKYRALYEPELPPCLQGTTVRVEFGDATTTADPSGAHSISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR  A+VPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+ ALK+HN N+ 
Sbjct  61   YGQPLAHFLRPKAQVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHSALKIHNSNNV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFAQKTLEITDDIL++
Sbjct  121  LLGFIGGTEGLFAQKTLEITDDILSS  146



>ref|XP_002300615.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE79888.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+P LPPCLQGTTVRVEFGD TT ADP+  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPGLPPCLQGTTVRVEFGDVTTCADPADVHAISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEG FAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGFFAQKTLEITDDILET  146



>gb|AAC67587.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
x paradisi]
Length=615

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDA+K+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDAIKLHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+T +I +T
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEIFST  146



>ref|XP_006386123.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
 gb|ERP63920.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
Length=618

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+P LPPCLQGTTVRVEFGD TT ADP+  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPGLPPCLQGTTVRVEFGDVTTCADPADVHAISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEG FAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGFFAQKTLEITDDILET  146



>gb|KCW70371.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=520

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK RS Y PELPPCLQGTTVRVE+GDATTAADP+  H+ISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKQRSLYHPELPPCLQGTTVRVEYGDATTAADPADVHSISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+A VPDA IITEHP IRVGIVFCGRQSPGGHN IWGLY ALK+HNP + 
Sbjct  61   YGQPLAHFLRATANVPDALIITEHPPIRVGIVFCGRQSPGGHNVIWGLYHALKIHNPKNV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILST  146



>ref|XP_008796200.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Phoenix dactylifera]
Length=620

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK R+ Y+PELPPCLQGTTVRVEFGDATTA DP+  H I + FPHT
Sbjct  1    MDSDYGVPRELSDLQKQRALYQPELPPCLQGTTVRVEFGDATTAGDPASAHVIGQNFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKAHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFAQKTL+ITDDIL+T
Sbjct  121  LLGFVGGTEGLFAQKTLKITDDILST  146



>ref|XP_010266301.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Nelumbo nucifera]
Length=617

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ R+LSDLQK R+ Y PELPPCLQGTTVRVEFGDATT ADPSG H+ISR FPHT
Sbjct  1    MDSDFGIPRQLSDLQKYRALYEPELPPCLQGTTVRVEFGDATTTADPSGAHSISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR  A+VPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+ ALK+HN N+ 
Sbjct  61   YGQPLAHFLRPKAQVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHSALKIHNSNNV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFAQKTLEITDDIL++
Sbjct  121  LLGFIGGTEGLFAQKTLEITDDILSS  146



>ref|XP_010927304.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
 ref|XP_010927305.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=617

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK R+ Y+PELPPCLQGTTVRVEFGDATTAADP+  H I + FPHT
Sbjct  1    MDSDYGVPRELSDLQKQRTLYQPELPPCLQGTTVRVEFGDATTAADPASAHVIGQNFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HN NST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKAHNRNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFAQKTLEITDDIL+T
Sbjct  121  LLGFVGGTEGLFAQKTLEITDDILST  146



>ref|XP_009372651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Pyrus x bretschneideri]
Length=617

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKHRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD ILAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDQILAT  146



>sp|Q41140.1|PFPA_RICCO RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Ricinus communis]
 emb|CAA83682.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Ricinus 
communis]
Length=617

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVE GD TTA   +G HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYKPELPPCLQGTTVRVELGDGTTACSEAGAHTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DA II+EHPA+RVG+VFCGRQSPGGHN +WGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVADAHIISEHPAMRVGVVFCGRQSPGGHNVVWGLHNALKIHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+TDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEVTDDILST  146



>ref|XP_011041141.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Populus euphratica]
Length=617

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV DAQIIT HPA RVGIVFCGRQSPGGHN IWGL++ALKVHNPNST
Sbjct  61   YGQPLAHFLRATAKVSDAQIITYHPAFRVGIVFCGRQSPGGHNVIWGLHNALKVHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILST  146



>ref|XP_002276269.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Vitis vinifera]
Length=616

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQK R  Y PELPPCLQGTTVRVEFGDATTA+D SG  TISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKHRCLYEPELPPCLQGTTVRVEFGDATTASDLSGARTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQ+ITEHP IRVG+VFCGRQSPGGHN IWGL++ALK+HNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQVITEHPPIRVGVVFCGRQSPGGHNVIWGLHNALKIHNPKNI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILST  146



>ref|XP_010063177.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
 gb|KCW70370.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=616

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK RS Y PELPPCLQGTTVRVE+GDATTAADP+  H+ISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKQRSLYHPELPPCLQGTTVRVEYGDATTAADPADVHSISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+A VPDA IITEHP IRVGIVFCGRQSPGGHN IWGLY ALK+HNP + 
Sbjct  61   YGQPLAHFLRATANVPDALIITEHPPIRVGIVFCGRQSPGGHNVIWGLYHALKIHNPKNV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILST  146



>ref|XP_010684564.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQK RS Y+PELPPCLQGTTVRVE+GD TTA DPS  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKQRSLYQPELPPCLQGTTVRVEYGDGTTAIDPSDVHAISRYFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQIITEHP IRVGIVF GRQSPGGHN +WGLY+ALK+HN N+ 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPTIRVGIVFSGRQSPGGHNVVWGLYNALKIHNTNNI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG+EGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGTEGLFAQKTLEITDDILST  146



>ref|XP_007210294.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
 gb|EMJ11493.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
Length=657

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  45   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
            + MDSD+G+ RELSD+QK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTI R FP
Sbjct  39   ISMDSDYGIPRELSDVQKFRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDAHTIGRYFP  98

Query  225  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            HT+GQPLAHFLRA+AKVP AQ+ITEHP  RVG+VFCGRQSPGGHN IWGL++ALKVHNP 
Sbjct  99   HTYGQPLAHFLRATAKVPGAQVITEHPPFRVGVVFCGRQSPGGHNVIWGLHNALKVHNPK  158

Query  405  STllgflggseglfAQKTLEITDDILAT  488
            STLLGFLGGSEGLFAQKTLEITD+ILAT
Sbjct  159  STLLGFLGGSEGLFAQKTLEITDEILAT  186



>ref|XP_008237897.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Prunus mume]
Length=668

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  45   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
            + MDSD+G+ RELSD+QK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTI R FP
Sbjct  50   ISMDSDYGIPRELSDVQKFRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDAHTIGRYFP  109

Query  225  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            HT+GQPLAHFLRA+AKVP AQ+ITEHP  RVG+VFCGRQSPGGHN IWGL++ALKVHNP 
Sbjct  110  HTYGQPLAHFLRATAKVPGAQVITEHPPFRVGVVFCGRQSPGGHNVIWGLHNALKVHNPK  169

Query  405  STllgflggseglfAQKTLEITDDILAT  488
            STLLGFLGGSEGLFAQKTLEITD+ILAT
Sbjct  170  STLLGFLGGSEGLFAQKTLEITDEILAT  197



>ref|XP_003529192.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
Length=617

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT ADP+   TISR FP+T
Sbjct  1    MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTTADPTDALTISRAFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWGL++ALK+HNPNS 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+DIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITEDILST  146



>ref|XP_010913868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Elaeis guineensis]
Length=617

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SDFG+ RELS+LQ+ R++Y PELPPCLQGTTVRVEFGD+TT ADPS  H ISR FPHT
Sbjct  1    MNSDFGVPRELSELQQKRAEYHPELPPCLQGTTVRVEFGDSTTTADPSSAHVISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            F QPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN +WGLY+A+K+HNP+S 
Sbjct  61   FEQPLAHFLRATAKVPDAQIITEHPPMRVGVVFCGRQSPGGHNVVWGLYNAIKIHNPDSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EG FAQKTLEITDD+L+T
Sbjct  121  LLGFVGGTEGFFAQKTLEITDDVLST  146



>ref|XP_004300090.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Fragaria vesca subsp. vesca]
Length=618

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS +QKLRSQY+P+LPPCLQGTTVRVEFGD TTAADP+  +TISR FP+T
Sbjct  1    MDSDYGIPRELSAVQKLRSQYQPDLPPCLQGTTVRVEFGDTTTAADPTDANTISRYFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKV  AQ+I+EHPA+RVGIVFCGRQSPGGHN IWGL  ALK HNPNST
Sbjct  61   YGQPLAHFLRATAKVAGAQVISEHPAMRVGIVFCGRQSPGGHNVIWGLLKALKTHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+LAT
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLAT  146



>ref|XP_004145564.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Cucumis sativus]
 ref|XP_004157061.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Cucumis sativus]
 gb|KGN55545.1| hypothetical protein Csa_4G664520 [Cucumis sativus]
Length=619

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ R+LSDLQK+RS Y+P+LPPCLQGT VRVEFGD TTA DP+   T+SR FPHT
Sbjct  1    MDSDYGIPRQLSDLQKIRSLYQPDLPPCLQGTAVRVEFGDGTTAVDPADAPTVSRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQ LAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+DALKVHNPNS 
Sbjct  61   YGQRLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHDALKVHNPNSI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L GFLGGSEGLF+QKTLEITDDIL T
Sbjct  121  LFGFLGGSEGLFSQKTLEITDDILTT  146



>ref|XP_009391869.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=618

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SDFG+ RELS+LQK R++Y PELPPCLQGTTVRVEFGD+TT ADPS  H I R FPHT
Sbjct  1    MESDFGVPRELSELQKKRAEYHPELPPCLQGTTVRVEFGDSTTCADPSSEHVIGRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            FGQPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN +WGLY A+K+HNP+S 
Sbjct  61   FGQPLAHFLRATAKVPDAQIITEHPPMRVGVVFCGRQSPGGHNVVWGLYSAIKIHNPDSI  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFAQ+TLEITD++LAT
Sbjct  121  LLGFVGGTEGLFAQRTLEITDEVLAT  146



>ref|XP_003555655.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
 gb|KHM99024.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Glycine soja]
Length=617

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT ADP+   T+ R FP+T
Sbjct  1    MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTTADPTDALTVCRAFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWG+++ALK+HNPNS 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGIHNALKIHNPNSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL+T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILST  146



>ref|XP_010537247.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Tarenaya hassleriana]
Length=610

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD  T ++ +  H +SR FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGATVSEAADAHVVSRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            + QPLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGLY+AL+VHNP S 
Sbjct  61   YSQPLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLYEALQVHNPKSN  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GGSEGLFA+KTLEITDDIL T
Sbjct  121  LLGFVGGSEGLFAKKTLEITDDILQT  146



>ref|XP_004498195.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Cicer arietinum]
Length=616

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADPS   +ISR FP+T
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTTADPSDEPSISRSFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEHPPIRVGLVFCGRQSPGGHNVIWGLHSALKIHNPYSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGS+GLFAQKTLEIT+DIL+T
Sbjct  121  LLGFLGGSDGLFAQKTLEITEDILST  146



>ref|XP_010270592.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=617

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQK R+ Y PE+PPCLQGTTVRVEFGDATT ADP+G   I R FPHT
Sbjct  1    MDSDFGVPRELSDLQKKRALYEPEVPPCLQGTTVRVEFGDATTTADPAGSLGIIRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR  ++VPDAQIIT+HPAIRVG+VFCGRQSPGGHN +WGLY+ALK+HNPN+ 
Sbjct  61   YGQPLAHFLRPKSQVPDAQIITDHPAIRVGVVFCGRQSPGGHNVVWGLYNALKIHNPNNV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+L++
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLSS  146



>ref|XP_009410339.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Musa 
acuminata subsp. malaccensis]
Length=613

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLR+ Y+P LPPC+QGTTVRVEFGDATT +DP+G H IS+ FPHT
Sbjct  1    MDSDYGVLRELSDLQKLRALYQPGLPPCVQGTTVRVEFGDATTTSDPAGAHVISQAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +AKVPDAQII E PAIRVG+VFCGRQSPGGHN IWGL+ A+K HNPNST
Sbjct  61   YGQPLAHFLRPTAKVPDAQIIVEQPAIRVGVVFCGRQSPGGHNVIWGLHSAIKSHNPNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFA+KTLEIT+DIL+T
Sbjct  121  LLGFVGGTEGLFAKKTLEITNDILST  146



>ref|XP_010539758.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Tarenaya hassleriana]
Length=613

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD TT A+ +  H ISR FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGTTVAEAADAHIISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            + QPLAHFLRA++KVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLY+ALKVHNP S 
Sbjct  61   YSQPLAHFLRATSKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYEALKVHNPKSA  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GGSEGLFA+ TLEITDDIL T
Sbjct  121  LLGFVGGSEGLFAKNTLEITDDILQT  146



>ref|XP_010932134.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=622

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSD Q+ R+ Y+PELPPCLQGTTVRVEFGDATTAADP+  H I + FPHT
Sbjct  1    MDSDYGVPRELSDTQRQRTLYQPELPPCLQGTTVRVEFGDATTAADPASAHVIGQNFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQ LAHFLRA+AKVPDAQIITEHPA RVG+VF GRQSPGGHN +WGLYDA+K HNP+ST
Sbjct  61   YGQSLAHFLRATAKVPDAQIITEHPATRVGVVFSGRQSPGGHNVVWGLYDAIKAHNPHST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFAQKTLEITDDIL+T
Sbjct  121  LLGFVGGTEGLFAQKTLEITDDILST  146



>ref|XP_007153134.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
 gb|ESW25128.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
Length=617

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT+ADP+   TISR FP+T
Sbjct  1    MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTSADPTDALTISRAFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWGL++ALK HN NS 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGLHNALKTHNSNSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD +L++
Sbjct  121  LLGFLGGSEGLFAQKTLEITDSVLSS  146



>ref|XP_008775478.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SDFG+ RELS+LQ+ R++Y  ELPPCLQGTTVRVEFGD+TT ADPS  H ISR FPHT
Sbjct  1    MNSDFGVPRELSELQQKRAEYLAELPPCLQGTTVRVEFGDSTTTADPSSAHVISRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            FGQPLAHFLRA+AKVPDAQIITEHP +RVGIVF GRQSPGGHN +WGL++ALK+HNP+S 
Sbjct  61   FGQPLAHFLRATAKVPDAQIITEHPPMRVGIVFSGRQSPGGHNVVWGLHNALKIHNPDSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGG+EG FAQKTLEIT+D+L+T
Sbjct  121  LLGFLGGTEGFFAQKTLEITNDVLST  146



>ref|XP_008802157.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDS +G+ RELS LQK R+ Y+P LPPCLQ TTVRVEFGDATT+ADP+G H IS+ FP T
Sbjct  1    MDSAYGVPRELSGLQKQRALYQPGLPPCLQDTTVRVEFGDATTSADPAGAHVISQYFPRT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HN NST
Sbjct  61   YGQPLAHFLRAKAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKSHNHNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFAQKTLEITDDIL+T
Sbjct  121  LLGFVGGTEGLFAQKTLEITDDILST  146



>ref|XP_010527650.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Tarenaya hassleriana]
Length=614

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSD+Q+LRS Y PELPPCLQGTTVRVEFGDATT A+    H I+R FP+T
Sbjct  1    MDSDYGIPRELSDIQELRSHYEPELPPCLQGTTVRVEFGDATTVAEVDSAHIIARAFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQ L HFLRA+AKVP AQIITEH AIRVG +FCGRQSPGGHN IWGLYDALK+HNP ST
Sbjct  61   YGQRLVHFLRATAKVPGAQIITEHQAIRVGFLFCGRQSPGGHNVIWGLYDALKIHNPQST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILRT  146



>ref|XP_009149574.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Brassica rapa]
 emb|CDY67203.1| BnaA06g38560D [Brassica napus]
Length=619

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVEFGD TT A+ S  H ++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVEFGDGTTVAEASDSHIVARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN NST
Sbjct  61   LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNANST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>ref|XP_009414937.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415019.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=617

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS+LQK R+QY PELPPCLQG TVRVEFGD+TT ADPS  + I R FPHT
Sbjct  1    MDSDFGVPRELSELQKKRAQYHPELPPCLQGITVRVEFGDSTTCADPSSTNVIGRAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            FGQPLAHFLRA+AKVPDAQIITEHP +RVG++FCGRQSPGGHN +WGLY A+K+ NP+S 
Sbjct  61   FGQPLAHFLRATAKVPDAQIITEHPPMRVGVLFCGRQSPGGHNVVWGLYKAIKIRNPDSV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLF QKT EITD++LAT
Sbjct  121  LLGFVGGTEGLFTQKTREITDEVLAT  146



>ref|XP_006390180.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
 gb|ESQ27466.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
Length=617

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD++L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDNVLQT  146



>emb|CDX88295.1| BnaC06g37390D [Brassica napus]
Length=617

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ++RSQY P+LPPCLQGTTVRVEFGD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQIRSQYLPQLPPCLQGTTVRVEFGDGTTVAKAGDAHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQK LEITDD+L T
Sbjct  121  LLGFLGGSEGLFAQKALEITDDVLQT  146



>ref|XP_009106323.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Brassica rapa]
Length=617

 Score =   223 bits (567),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+P+LPPCLQG TVRVEFGD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGRTVRVEFGDGTTVAKSGDSHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRANAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKT+EITDD+L T
Sbjct  121  LLGFLGGSEGLFAQKTVEITDDVLQT  146



>ref|XP_006302013.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
 gb|EOA34911.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
Length=617

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRASAKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRASAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQT  146



>ref|NP_173519.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
 sp|Q9SYP2.1|PFPA1_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1; Short=PFP 1; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 1; AltName: Full=PPi-PFK 
1; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
1 [Arabidopsis thaliana]
 gb|AAD30596.1|AC007369_6 pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAL24337.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAP37733.1| At1g20950 [Arabidopsis thaliana]
 gb|AEE30045.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
Length=614

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +A+VPDA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAQVPDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNAKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>emb|CDX87587.1| BnaA07g32860D [Brassica napus]
Length=617

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+P+LPPCLQG TVRVEFGD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGRTVRVEFGDGTTVAKSGDSHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKT+EITD++L T
Sbjct  121  LLGFLGGSEGLFAQKTVEITDEVLQT  146



>ref|XP_006416345.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
 gb|ESQ34698.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
Length=619

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  H ++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEAADSHIMARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +AKV DAQIITE P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLREAAKVSDAQIITELPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>gb|KFK35354.1| hypothetical protein AALP_AA5G273800 [Arabis alpina]
Length=619

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  H ++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEATDSHIMARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +AKV DAQIITE P+IRVGIVFCGRQSPGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAKVSDAQIITELPSIRVGIVFCGRQSPGGHNVIWGLYEALKVHNAKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLE+TDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEMTDDILQT  146



>ref|XP_010471809.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQT  146



>ref|XP_010416575.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Camelina sativa]
Length=617

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQT  146



>emb|CDY33660.1| BnaC08g19600D [Brassica napus]
Length=598

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT ++ S  H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>emb|CDY67022.1| BnaC05g50320D [Brassica napus]
Length=619

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD TT A+ S  H I+R F HT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGTTVAEASDSHIIARAFTHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>ref|XP_010498548.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Camelina sativa]
Length=614

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+PE+PPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYKPEIPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>ref|XP_002889091.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65350.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
Length=617

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEIT+D+L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITEDVLQT  146



>ref|NP_177781.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
 sp|Q9C9K3.1|PFPA2_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2; Short=PFP 2; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 2; AltName: Full=PPi-PFK 
2; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
2 [Arabidopsis thaliana]
 gb|AAG51940.1|AC015450_1 putative pyrophosphate-dependent phosphofructokinase alpha subunit; 
63231-59202 [Arabidopsis thaliana]
 gb|AEE35858.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=617

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKV DAQIITEHP  RVGIVFCGRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD++L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEVLQT  146



>dbj|BAF01310.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Arabidopsis thaliana]
Length=617

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKV DAQIITEHP  RVGIVFCGRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITD++L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEVLQT  146



>ref|XP_010477351.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=522

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SDFG+ RELS LQ+LRSQY+P+LPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MNSDFGIPRELSPLQQLRSQYKPDLPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>ref|XP_010428720.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+A VPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATANVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNVENT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDD+L T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQT  146



>gb|KFK42073.1| hypothetical protein AALP_AA2G207700 [Arabis alpina]
Length=617

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+P LPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPLLPPCLQGTTVRVELGDGTTGAKAGDAHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+AKV DAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRANAKVVDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKT+EITDD+L T
Sbjct  121  LLGFLGGSEGLFAQKTVEITDDVLQT  146



>ref|XP_002893141.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69400.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAQVADAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNTKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>emb|CBI40779.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 129/183 (70%), Gaps = 37/183 (20%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELSDLQK R  Y PELPPCLQGTTVRVEFGDATTA+D SG  TISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKHRCLYEPELPPCLQGTTVRVEFGDATTASDLSGARTISRSFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLRA+AKVPDAQ+ITEHP IRVG+VFCGRQSPGGHN IWGL++ALK+HNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQVITEHPPIRVGVVFCGRQSPGGHNVIWGLHNALKIHNPKNI  120

Query  411  llgflggsegl-------------------------------------fAQKTLEITDDI  479
            LLGFL   + +                                     FAQKTLEITDDI
Sbjct  121  LLGFLAQYDRMDNWAIMSSVMVMFEGYLASDAYNSNIHLSLFCGSEGLFAQKTLEITDDI  180

Query  480  LAT  488
            L+T
Sbjct  181  LST  183



>ref|XP_006306984.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
 gb|EOA39882.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
Length=639

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT A+ +  HT+ R FPHT
Sbjct  26   MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMVRAFPHT  85

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  86   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSKST  145

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  146  LLGFLGGSEGLFAQKTLEITDDILQT  171



>ref|XP_010459789.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=614

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRSQY+ +LPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYKSDLPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>emb|CDX96611.1| BnaA08g21540D [Brassica napus]
Length=598

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVE GD TT ++ S  H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSHYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLR + KV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLRETTKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQT  146



>dbj|BAJ92904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=616

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++Q+ R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQQKRTLYQPELPPCLQGTTVRVEYGDVAIAADPAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAANVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGG++GL AQKTLEIT+++L++
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSS  146



>ref|XP_010235882.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Brachypodium distachyon]
Length=618

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKQRTLYQPELPPCLQGTTVRVEYGDVAIAADPTGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA++I+EHPA+RVG+VFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAAIVPDAKVISEHPAVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGG++GL AQKTLEIT+++L++
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSS  146



>ref|XP_003570229.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Brachypodium distachyon]
Length=617

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKQRTLYQPELPPCLQGTTVRVEYGDVAIAADPTGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA++I+EHPA+RVG+VFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAAIVPDAKVISEHPAVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGG++GL AQKTLEIT+++L++
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSS  146



>gb|EMS68198.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
 gb|EMT25737.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=581

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++Q+ R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  +PHT
Sbjct  1    MDSDYGVPRELSEVQQNRTLYQPELPPCLQGTTVRVEYGDVAIAADPAGAHVISHAYPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAANVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLHEAIKAHNVNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGG++GL AQKTLEIT+++L++
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSS  146



>gb|EPS71673.1| hypothetical protein M569_03082, partial [Genlisea aurea]
Length=608

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRS Y+PELPPC+QGTTVRVEFGDAT AADP+G HTISR  PHT
Sbjct  1    MDSDYGVPRELSDLQKLRSHYKPELPPCVQGTTVRVEFGDATAAADPAGAHTISRSLPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN-PNS  407
            +GQPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN IWGL+DALK+HN  N 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPPVRVGVVFCGRQSPGGHNVIWGLFDALKLHNSKNV  120

Query  408  TllgflggseglfAQKTLEITDDILAT  488
             L     GSEGLFAQKTLEITD+ILAT
Sbjct  121  LLGFLGRGSEGLFAQKTLEITDEILAT  147



>ref|XP_009417287.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=616

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M+SD+G+ R+LS LQK R+ Y+PELP CLQGTTVRVEFGD T AADP+  H I + FPHT
Sbjct  1    MESDYGVPRDLSGLQKQRALYQPELPLCLQGTTVRVEFGDTTIAADPADDHAIRQAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             GQPLAHFLRA+A VPDAQII EHPAIRVGIVFCGRQSPGGHN IWGLY+A+K HNP ST
Sbjct  61   SGQPLAHFLRATANVPDAQIIEEHPAIRVGIVFCGRQSPGGHNVIWGLYNAIKSHNPEST  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L GF+GG+EGLFA++ L+ITDDIL+T
Sbjct  121  LFGFVGGTEGLFARRILKITDDILST  146



>ref|XP_006849934.1| hypothetical protein AMTR_s00022p00121950 [Amborella trichopoda]
 gb|ERN11515.1| hypothetical protein AMTR_s00022p00121950 [Amborella trichopoda]
Length=615

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  60   DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
            DFG+ RELSDLQK R+ Y+P  PPCLQGTTVRVEFGD TT AD S  HTISR FP T+GQ
Sbjct  2    DFGIPRELSDLQKERTLYQPVPPPCLQGTTVRVEFGDGTTTADASDAHTISRSFPLTYGQ  61

Query  240  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
            PL HFLRA+A+VPDA+II EHP IRVG+VF GRQSPGGHN IWGLYDA+K HNPNSTLLG
Sbjct  62   PLVHFLRATAQVPDAKIIQEHPVIRVGVVFSGRQSPGGHNVIWGLYDAIKCHNPNSTLLG  121

Query  420  flggseglfAQKTLEITDDILAT  488
            F+GG++GLFA +TLE+T+ +L+T
Sbjct  122  FVGGTDGLFALQTLEVTEKVLST  144



>ref|XP_004498196.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Cicer arietinum]
Length=604

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 12/146 (8%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADPS   +I+      
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTTADPSDEPSIT------  54

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
                  HFLRA+AKVPDAQIITEHP IRVG+VFCGRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  55   ------HFLRATAKVPDAQIITEHPPIRVGLVFCGRQSPGGHNVIWGLHSALKIHNPYSV  108

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGS+GLFAQKTLEIT+DIL+T
Sbjct  109  LLGFLGGSDGLFAQKTLEITEDILST  134



>ref|XP_004953678.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=616

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PE+PPCLQGTTVRVE+GDA  AADP+G H IS+ FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPEVPPCLQGTTVRVEYGDAAIAADPAGAHVISQAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGLY+A+K HN NS 
Sbjct  61   YGQPLAHFLRKTAVVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLYEAIKAHNQNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQKTLEITD++L++
Sbjct  121  LIGFLGGSDGLLAQKTLEITDEVLSS  146



>ref|NP_001047918.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAD07793.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
alpha chain [Oryza sativa Japonica Group]
 dbj|BAF09832.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAG91865.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73886.1| hypothetical protein OsI_08678 [Oryza sativa Indica Group]
 gb|EEE57680.1| hypothetical protein OsJ_08132 [Oryza sativa Japonica Group]
Length=617

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA +I+EHP +RVG+VFCGRQSPGGHN IWGL++A+K HNPNS 
Sbjct  61   YGQPLAHFLRKTANVPDATVISEHPVVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNPNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQKTLEITD++L++
Sbjct  121  LIGFLGGSDGLLAQKTLEITDEVLSS  146



>ref|XP_002452651.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
 gb|EES05627.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
Length=616

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS +FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHVFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPLAHFLRKTAVVPDAKVISEHLAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQ+TLEITD++LA+
Sbjct  121  LIGFLGGSDGLLAQRTLEITDEVLAS  146



>ref|XP_006659170.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=622

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
            G V MDSD+G+ RELS LQK R+ YRP LPPCLQGTTVRVE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDSDYGVPRELSALQKARALYRPGLPPCLQGTTVRVEYGDAAVAADVAGAHVISHA  61

Query  219  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
            FPHT+GQPLAHFLR ++ VPDA +I EHP +RVGIVF GRQSPGGHN IWGL+DA+K HN
Sbjct  62   FPHTYGQPLAHFLRKTSVVPDATVIREHPVVRVGIVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  399  PNSTllgflggseglfAQKTLEITDDILAT  488
            PNS L+GFLGG++GLFAQKTLEITD++L++
Sbjct  122  PNSKLIGFLGGTDGLFAQKTLEITDEVLSS  151



>ref|NP_001057528.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAF19442.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAG89341.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65619.1| hypothetical protein OsJ_21179 [Oryza sativa Japonica Group]
Length=622

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
            G V MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHA  61

Query  219  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
            FPHT+GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN
Sbjct  62   FPHTYGQPLAHFLRKTAAVPDATVITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  399  PNSTllgflggseglfAQKTLEITDDILAT  488
             NS L+GFLGG++GLFAQKTLEI+D++L++
Sbjct  122  ANSKLIGFLGGTDGLFAQKTLEISDEVLSS  151



>gb|EEC80509.1| hypothetical protein OsI_22776 [Oryza sativa Indica Group]
Length=622

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
            G V MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHA  61

Query  219  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
            FPHT+GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN
Sbjct  62   FPHTYGQPLAHFLRKTAAVPDATVITEHPLVRVGVVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  399  PNSTllgflggseglfAQKTLEITDDILAT  488
             NS L+GFLGG++GLFAQKTLEI+D++L++
Sbjct  122  ANSKLIGFLGGTDGLFAQKTLEISDEVLSS  151



>ref|XP_006648988.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=617

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VP+A +I EHP +RVG+VFCGRQSPGGHN IWGLY+A+K HNPNS 
Sbjct  61   YGQPLAHFLRKTANVPEATVIAEHPTVRVGVVFCGRQSPGGHNVIWGLYEAIKAHNPNSM  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQK  EIT+++L++
Sbjct  121  LIGFLGGSDGLLAQKAFEITEEVLSS  146



>gb|AFW73096.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 1 [Zea mays]
 gb|AFW73097.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 2 [Zea mays]
Length=618

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQ+TLEITD ++A+
Sbjct  121  LIGFLGGSDGLLAQRTLEITDKVIAS  146



>gb|ACN26363.1| unknown [Zea mays]
Length=616

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQ+TLEITD ++A+
Sbjct  121  LIGFLGGSDGLLAQRTLEITDKVIAS  146



>ref|XP_004965353.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=622

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
            G V M+SD+G+ RELS LQK R+ Y+PELPPCLQGTTVRVE+GDA  AAD +G H IS+ 
Sbjct  2    GSVAMESDYGVPRELSSLQKARALYQPELPPCLQGTTVRVEYGDAAIAADVAGAHVISQA  61

Query  219  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
            FPHT+GQPLAHFL  +A V DA I+TEHP +RVGIVF GRQSPGGHN IWGLYDA+K HN
Sbjct  62   FPHTYGQPLAHFLGKTANVQDATIMTEHPVVRVGIVFSGRQSPGGHNVIWGLYDAIKAHN  121

Query  399  PNSTllgflggseglfAQKTLEITDDILAT  488
            PNS L+GFLGG++GLFAQKT++I+D+ LA+
Sbjct  122  PNSKLIGFLGGTDGLFAQKTMDISDEALAS  151



>ref|NP_001146841.1| LOC100280449 [Zea mays]
 gb|ACG23899.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
 gb|ACN28159.1| unknown [Zea mays]
 gb|AFW63610.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=616

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PE+PPCLQGTTVRVE+GDA  AAD +G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPEVPPCLQGTTVRVEYGDAAIAADQAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A V DA++I+EHP +RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPLAHFLRKTAVVLDAKVISEHPVVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQ+TLEIT+++LA+
Sbjct  121  LIGFLGGSDGLLAQRTLEITNEVLAS  146



>dbj|BAD33246.1| putative Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
alpha subunit [Oryza sativa Japonica Group]
Length=617

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  FPHT
Sbjct  1    MDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            +GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN NS 
Sbjct  61   YGQPLAHFLRKTAAVPDATVITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAHNANSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGG++GLFAQKTLEI+D++L++
Sbjct  121  LIGFLGGTDGLFAQKTLEISDEVLSS  146



>ref|NP_001131947.1| uncharacterized protein LOC100193340 [Zea mays]
 gb|ACG24291.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=618

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            + QP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YAQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            L+GFLGGS+GL AQ+TLEITD ++A+
Sbjct  121  LIGFLGGSDGLLAQRTLEITDKVIAS  146



>ref|XP_006435471.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48711.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
Length=502

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  135  LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  314
            +QGTTVRVEFGD+TT ADP+  H+ISR FPHT+GQPLAHFLRA+AKVPDAQIITEHPAIR
Sbjct  37   MQGTTVRVEFGDSTTTADPADTHSISRSFPHTYGQPLAHFLRATAKVPDAQIITEHPAIR  96

Query  315  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  488
            VGIVFCGRQSPGGHN +WGLYDALK+HNP STLLGFLGGSEGLFAQKTLE+T +IL+T
Sbjct  97   VGIVFCGRQSPGGHNVVWGLYDALKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEILST  154



>ref|XP_006435473.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006435474.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48713.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48714.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85267.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85268.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=623

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  135  LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  314
            +QGTTVRVEFGD+TT ADP+  H+ISR FPHT+GQPLAHFLRA+AKVPDAQIITEHPAIR
Sbjct  37   MQGTTVRVEFGDSTTTADPADTHSISRSFPHTYGQPLAHFLRATAKVPDAQIITEHPAIR  96

Query  315  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  488
            VGIVFCGRQSPGGHN +WGLYDALK+HNP STLLGFLGGSEGLFAQKTLE+T +IL+T
Sbjct  97   VGIVFCGRQSPGGHNVVWGLYDALKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEILST  154



>dbj|BAK04583.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
            G V MDSD+G  RELS LQK R+ YRPELPPCLQGT VRVE GDA  AAD +  H I   
Sbjct  2    GSVAMDSDYGATRELSPLQKERALYRPELPPCLQGTAVRVEHGDAAIAADGADAHVIGHA  61

Query  219  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
            FPHT+GQPLAHFL  +A  PDA +IT+HPA+RVG+VF GRQSPGGHN IWGL++A+  HN
Sbjct  62   FPHTYGQPLAHFLPKTANAPDATVITKHPAVRVGVVFSGRQSPGGHNVIWGLHNAINSHN  121

Query  399  PNSTllgflggseglfAQKTLEITDDILAT  488
            P+S L+GFLGG++GLFAQKTLEITD++L++
Sbjct  122  PSSKLIGFLGGTDGLFAQKTLEITDEVLSS  151



>ref|XP_003563894.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=626

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCL---QGTTVRVEFGDATTAADPSGGHTI  209
            G   ++SD+G  RELS LQK R+ YRPELPPCL   QGT VRVE+GDAT AAD +  H I
Sbjct  2    GSTAVNSDYGATRELSALQKERALYRPELPPCLHGNQGTAVRVEYGDATIAADGADAHVI  61

Query  210  SRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALK  389
               FPHT+GQPLAHFL  +A   DA IITEHP +RVG+VF GRQSPGGHN IWGL+DAL 
Sbjct  62   GNAFPHTYGQPLAHFLPEAANAADAAIITEHPVVRVGVVFSGRQSPGGHNVIWGLHDALS  121

Query  390  VHNPNSTllgflggseglfAQKTLEITDDILAT  488
             HNP+S L+GFLGG++GLFAQKTLEIT+++L++
Sbjct  122  AHNPSSKLIGFLGGTDGLFAQKTLEITEEVLSS  154



>ref|XP_003589697.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Medicago truncatula]
Length=596

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 114/146 (78%), Gaps = 20/146 (14%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGD TT ADP+            
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDGTTTADPAD-----------  49

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
                      A+AKVPDAQIITEHP IRVGIVF GRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  50   ---------EATAKVPDAQIITEHPPIRVGIVFSGRQSPGGHNVIWGLHSALKIHNPKSV  100

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLF+QKTLEITDDIL+T
Sbjct  101  LLGFLGGSEGLFSQKTLEITDDILST  126



>gb|AES59948.2| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=597

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 114/146 (78%), Gaps = 19/146 (13%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGD TT ADP+   TI+      
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDGTTTADPADEPTIT------  54

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
                         KVPDAQIITEHP IRVGIVF GRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  55   -------------KVPDAQIITEHPPIRVGIVFSGRQSPGGHNVIWGLHSALKIHNPKSV  101

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGFLGGSEGLF+QKTLEITDDIL+T
Sbjct  102  LLGFLGGSEGLFSQKTLEITDDILST  127



>ref|XP_004956505.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Setaria italica]
Length=620

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M++D G  REL+ LQ+ R+ Y+PELPPCLQGT VRVEFGD+TT+ DP     ++++FP T
Sbjct  1    MNADQGSPRELTGLQRRRALYQPELPPCLQGTRVRVEFGDSTTSIDPKCADIVAQVFPQT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            FGQ L HFL  ++KV DAQ+I EHP IRVG++F GRQSPGGHN IWG YDA+K  NP++ 
Sbjct  61   FGQKLVHFLEPNSKVSDAQVIKEHPPIRVGVLFSGRQSPGGHNVIWGTYDAMKAQNPHNV  120

Query  411  llgflggseglfAQKTLEITDDILAT  488
            LLGF+GG+EGLFA+K LEITDD+L++
Sbjct  121  LLGFIGGTEGLFAKKMLEITDDVLSS  146



>gb|AEZ53899.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant, partial [Zea mays]
 gb|AEZ53900.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant [Zea mays]
Length=587

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
            G V MD+D+G  RELS LQK R+ YRPE PPCLQG TV VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDADYGAPRELSPLQKARALYRPETPPCLQGPTVSVEYGDAAIAADVAGAHVISHA  61

Query  219  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
            FPHT+GQPL HFL  +A V DA I+TEHP +R+G+VF GRQSPGGHN IWGLYD +K HN
Sbjct  62   FPHTYGQPLVHFLTKTANVHDATIVTEHPVVRIGVVFSGRQSPGGHNVIWGLYDVVKAHN  121

Query  399  PNSTllgflggseglfAQKTLEITDDIL  482
             NS ++GFLGG++GLFAQKT+EITD+ L
Sbjct  122  SNSKIIGFLGGTDGLFAQKTIEITDEAL  149



>ref|XP_008659507.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Zea mays]
Length=622

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  39   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  218
            G V MD+D+G  RELS LQK R+ YRPE PPCLQG TV VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDADYGAPRELSPLQKARALYRPETPPCLQGPTVSVEYGDAAIAADVAGAHVISHA  61

Query  219  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
            FPHT+GQPL HFL  +A V DA I+TEHP +R+G+VF GRQSPGGHN IWGLYD +K HN
Sbjct  62   FPHTYGQPLVHFLTKTANVHDATIVTEHPVVRIGVVFSGRQSPGGHNVIWGLYDVVKAHN  121

Query  399  PNSTllgflggseglfAQKTLEITDDIL  482
             NS ++GFLGG++GLFAQKT+EITD+ L
Sbjct  122  SNSKIIGFLGGTDGLFAQKTIEITDEAL  149



>ref|XP_006660512.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=620

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = +3

Query  45   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
            + M++D G  REL+ LQ+ R+ Y+PELPPCLQG  +RVE GDATT  DP+  + +++ FP
Sbjct  1    MSMNADLGKPRELTGLQQRRALYQPELPPCLQGKAIRVELGDATTTIDPTCVNMVAQEFP  60

Query  225  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            HTFGQPL HFL+++    DAQ    H +IRVG+VF GRQSPGGHN IWG+YDA+K  NP 
Sbjct  61   HTFGQPLVHFLKSNKL--DAQATDAHTSIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNPQ  118

Query  405  STllgflggseglfAQKTLEITDDILA  485
            S LLGF+GG+EGLF  KTL+ITDD+L+
Sbjct  119  SVLLGFIGGTEGLFTNKTLKITDDVLS  145



>gb|EEC84297.1| hypothetical protein OsI_30782 [Oryza sativa Indica Group]
Length=581

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = +3

Query  45   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  224
            + M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP
Sbjct  1    MSMNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFP  60

Query  225  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            +TFGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  
Sbjct  61   NTFGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQ  118

Query  405  STllgflggseglfAQKTLEITDDILA  485
            S LLGF+GG+EGLFA +TLEITDD+L+
Sbjct  119  SVLLGFIGGTEGLFANQTLEITDDVLS  145



>gb|EEE69397.1| hypothetical protein OsJ_28754 [Oryza sativa Japonica Group]
Length=579

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP+T
Sbjct  1    MNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            FGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  S 
Sbjct  61   FGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQSV  118

Query  411  llgflggseglfAQKTLEITDDILA  485
            LLGF+GG+EGLFA +TLEITDD+L+
Sbjct  119  LLGFIGGTEGLFANQTLEITDDVLS  143



>dbj|BAD33224.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAD32985.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
Length=618

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP+T
Sbjct  1    MNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFPNT  60

Query  231  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
            FGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  S 
Sbjct  61   FGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQSV  118

Query  411  llgflggseglfAQKTLEITDDILA  485
            LLGF+GG+EGLFA +TLEITDD+L+
Sbjct  119  LLGFIGGTEGLFANQTLEITDDVLS  143



>ref|XP_009385723.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +3

Query  60   DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
            +FG   E S LQK RS Y P+LPPCLQG+ V+VEFGDATT  DP    +I R FP T+GQ
Sbjct  2    EFGAGIEFSTLQKQRSLYVPQLPPCLQGSHVQVEFGDATTVPDPLDAESIKRSFPLTYGQ  61

Query  240  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
            PL HF+ +  K P   +  + P +RVG+VFCGRQSPGGHN I GLYDA+K+HNP STLLG
Sbjct  62   PLVHFVSSLEKPPPNGVQDQQPPLRVGVVFCGRQSPGGHNIICGLYDAMKLHNPKSTLLG  121

Query  420  flggseglfAQKTLEITDDILA  485
            F GG+EGLF QKTL I+DDI+A
Sbjct  122  FCGGTEGLFVQKTLVISDDIVA  143



>gb|AGN30570.1| pyrophosphate-fructose-6-phosphate-phosphotransferase PFPA4 [Oryza 
sativa Japonica Group]
Length=627

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 113/154 (73%), Gaps = 9/154 (6%)
 Frame = +3

Query  45   VKMDSDFGLARELSDLQKLRSQYRPELPPCL-------QGTTVRVEFGDATTAADPSGGH  203
            + M++D G  REL+ LQ+ R+ Y+PELPPCL       QG  +RVEFGD+TT  DP+  +
Sbjct  1    MSMNADLGKPRELTGLQQRRALYQPELPPCLEFFNQHVQGKAIRVEFGDSTTTIDPTCAN  60

Query  204  TISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDA  383
             + + FP+TFGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA
Sbjct  61   MVVQEFPNTFGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDA  118

Query  384  LKVHNPNSTllgflggseglfAQKTLEITDDILA  485
            +K  N  S LLGF+GG+EGLFA +TLEITDD+L+
Sbjct  119  MKTQNLQSVLLGFIGGTEGLFANQTLEITDDVLS  152



>gb|EMT11805.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=171

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +3

Query  69   LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  248
            +  E+S LQK R++YRPELPP LQGT V+VE+GDA  AAD +  H I R FPHT+GQ LA
Sbjct  1    MGNEMSPLQKHRAEYRPELPPWLQGTAVKVEYGDAAIAADGADAHVIRRAFPHTYGQRLA  60

Query  249  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            HFL  +A  PDA +ITEHPA+RVG+VF GRQSPGGHN +WGLY+A+  HNP+S
Sbjct  61   HFLPKTANAPDATVITEHPAVRVGVVFSGRQSPGGHNVVWGLYNAINSHNPSS  113



>ref|XP_004973257.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=618

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +3

Query  51   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DPS  + +++ FP+
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPSCANVVAQAFPN  60

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            TFGQPL  F+  +     A+   E P IRVG+VF GRQSPGGHN +WGL+DALK +NP+S
Sbjct  61   TFGQPLVSFVAPADAAAAAE---ERPPIRVGVVFSGRQSPGGHNVVWGLHDALKAYNPHS  117

Query  408  TllgflggseglfAQKTLEITDDILAT  488
             L GF+GG+EGLFA KTLEITDD+LA+
Sbjct  118  VLYGFVGGTEGLFANKTLEITDDVLAS  144



>ref|XP_003573791.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=617

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 111/147 (76%), Gaps = 5/147 (3%)
 Frame = +3

Query  51   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
            M++D+G + EL   LQ+ R+ Y+P LPPCLQG TVRVE+GDATT  DP+G   ++R FP 
Sbjct  1    MNADYGASTELEGPLQQRRALYQPRLPPCLQGATVRVEYGDATTTIDPAGAPEVARAFPR  60

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            T+GQPL +FL A+A         E P IRVG+VF GRQSPGGHN +WGL+DALK HNP+ 
Sbjct  61   TYGQPLVNFLAAAADKAAG----ERPPIRVGVVFSGRQSPGGHNLVWGLHDALKAHNPHC  116

Query  408  TllgflggseglfAQKTLEITDDILAT  488
             L GF+GG+EGLFA KTLEIT+D+LA+
Sbjct  117  ALYGFIGGTEGLFANKTLEITNDVLAS  143



>tpg|DAA49241.1| TPA: hypothetical protein ZEAMMB73_624432 [Zea mays]
Length=488

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 4/147 (3%)
 Frame = +3

Query  51   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQAFPH  60

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61   TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  408  TllgflggseglfAQKTLEITDDILAT  488
             L GF+GG+EGLFA KTLEITDD+LA+
Sbjct  118  LLYGFVGGTEGLFANKTLEITDDVLAS  144



>gb|ACL53065.1| unknown [Zea mays]
 gb|ACN27719.1| unknown [Zea mays]
 tpg|DAA49242.1| TPA: hypothetical protein ZEAMMB73_624432 [Zea mays]
Length=618

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 4/147 (3%)
 Frame = +3

Query  51   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQAFPH  60

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61   TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  408  TllgflggseglfAQKTLEITDDILAT  488
             L GF+GG+EGLFA KTLEITDD+LA+
Sbjct  118  LLYGFVGGTEGLFANKTLEITDDVLAS  144



>ref|XP_002459996.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
 gb|EER96517.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
Length=626

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +3

Query  60   DFGLARELSDLQKLRSQYRPELPPCL-QGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  236
            D G  REL+ LQ+ R+ Y+PELPPCL QGT +RVEFGD+TT  D      +++ FPH FG
Sbjct  5    DLGSPRELTGLQRRRALYQPELPPCLVQGTRIRVEFGDSTTTIDSKCADIVAQAFPHIFG  64

Query  237  QPLAHFLR----ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            Q L  FL           DAQ+I E+  IRVG+VF GRQSPGGHN IWG YDALK  NP+
Sbjct  65   QKLVRFLEPHMDTVVSESDAQVIQENSPIRVGVVFSGRQSPGGHNVIWGTYDALKAQNPH  124

Query  405  STllgflggseglfAQKTLEITDDILAT  488
            + LLGF+GG+EGLFA+KTLEITDD+L++
Sbjct  125  NVLLGFIGGTEGLFAKKTLEITDDVLSS  152



>ref|NP_001061602.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAC75438.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAF23516.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAG94900.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83431.1| hypothetical protein OsI_28900 [Oryza sativa Indica Group]
 gb|EEE68536.1| hypothetical protein OsJ_26990 [Oryza sativa Japonica Group]
Length=617

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = +3

Query  51   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
            M++DFG  ++L+  LQ+ RS Y+P LPPCLQG TV+VE+GDATT  DP+  + +++ FP 
Sbjct  1    MNADFGAPKDLAGGLQQRRSLYQPTLPPCLQGATVKVEYGDATTTIDPTCANVVAQAFPR  60

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            T+GQPL  F+   A  PDA +  +   IRVG+VF GRQSPGGHN IWGL+DALK +NP+S
Sbjct  61   TYGQPLVSFV---APPPDA-VDKDRAPIRVGVVFSGRQSPGGHNVIWGLHDALKAYNPHS  116

Query  408  TllgflggseglfAQKTLEITDDILAT  488
             L GF+GG+EGLFA KT+EITDD+LA+
Sbjct  117  VLYGFVGGTEGLFANKTIEITDDVLAS  143



>ref|NP_001130747.1| uncharacterized protein LOC100191851 [Zea mays]
 gb|ACF79089.1| unknown [Zea mays]
Length=618

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 4/147 (3%)
 Frame = +3

Query  51   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQPFPH  60

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61   TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  408  TllgflggseglfAQKTLEITDDILAT  488
             L GF+GG+EGLFA KTLEITDD+LA+
Sbjct  118  LLYGFVGGTEGLFANKTLEITDDVLAS  144



>dbj|BAJ94879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +3

Query  51   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  227
            M++D+G    L+  LQ+ R+ Y+P LPPCLQG TVR E+G+ATT  DP+G H +++ FP 
Sbjct  1    MNADYGAPTALAGPLQQRRALYQPRLPPCLQGATVRAEYGEATTTIDPAGAHAVAQAFPR  60

Query  228  TFGQPLAHFLRASAKVPDAQI-ITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            T+GQ L  FL         +  + E P IRVG+VF GRQSPGGHN +WGL+DAL+ +NP+
Sbjct  61   TYGQRLVTFLAPDDAAGADKAAVHERPPIRVGVVFSGRQSPGGHNVVWGLHDALRAYNPH  120

Query  405  STllgflggseglfAQKTLEITDDILAT  488
            S L GF+GG+EGLFA KTLEITDD+LA+
Sbjct  121  SVLYGFIGGTEGLFANKTLEITDDVLAS  148



>tpg|DAA44428.1| TPA: hypothetical protein ZEAMMB73_728226 [Zea mays]
Length=316

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  QGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRV  317
            +GTTVRVE+GDA   ADP G H IS  FPH +GQP+AHFLR +A VP+A+ I+EH  +RV
Sbjct  107  KGTTVRVEYGDAAIVADPPGAHVISHAFPHIYGQPIAHFLRKTAVVPNAKAISEHQVVRV  166

Query  318  GIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            GIVFCGRQSPGGHN +WGLY+A+K HN N
Sbjct  167  GIVFCGRQSPGGHNVVWGLYEAIKAHNQN  195



>ref|XP_008652527.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit alpha [Zea mays]
Length=623

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 12/150 (8%)
 Frame = +3

Query  60   DFGLARELSDLQKLRSQYRPELPPCL-QGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  236
            D G  REL+ LQ+ R+ Y+PELPPCL QGT  RVEFGD TT  D      +++ FPHTFG
Sbjct  5    DLGSPRELTGLQRRRALYQPELPPCLLQGT--RVEFGDPTTTIDSKCADIVAQAFPHTFG  62

Query  237  QPLAHFLR-----ASAKVPDAQIITEHPAIRVGIVFCGRQSP-GGHNAIWGLYDALKVHN  398
            Q L  FL        +   DAQ   E P +R+G+VF GRQSP GGHN IWG +DA+K  N
Sbjct  63   QRLVRFLEPHPDTVVSGSSDAQ---ERPPVRLGVVFSGRQSPRGGHNVIWGTFDAMKARN  119

Query  399  PNSTllgflggseglfAQKTLEITDDILAT  488
            P+S LLGFLGG+EGLFA+KTLEIT+D+L++
Sbjct  120  PHSVLLGFLGGTEGLFAKKTLEITEDMLSS  149



>gb|AGY61464.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha1, 
partial [Rorippa sylvestris]
Length=185

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            T GQPLAHFLRA+AKV DA IITE P+IRVGIVF GRQ+PGGHN IWGLY+ALKVHN  S
Sbjct  1    TLGQPLAHFLRATAKVSDAHIITELPSIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKS  60

Query  408  TllgflggseglfAQKTLEITDDILAT  488
            TLLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  61   TLLGFLGGSEGLFAQKTLEITDDILQT  87



>gb|AGY61463.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha1, 
partial [Rorippa amphibia]
Length=185

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  228  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            T GQPLAHFLRA+AKV DA IITE P+IRVGIVF GRQ+PGGHN IWGLY+ALKVHN  S
Sbjct  1    TLGQPLAHFLRATAKVSDAHIITELPSIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKS  60

Query  408  TllgflggseglfAQKTLEITDDILAT  488
            TLLGFLGGSEGLFAQKTLEITDDIL T
Sbjct  61   TLLGFLGGSEGLFAQKTLEITDDILQT  87



>ref|XP_001773752.1| predicted protein [Physcomitrella patens]
 gb|EDQ61369.1| predicted protein [Physcomitrella patens]
Length=613

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 93/133 (70%), Gaps = 7/133 (5%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            +L  L  LR+QY P++PP L+G  V+V  GD TTAADPS    +SR +PHT+GQPL H +
Sbjct  11   KLQGLSALRAQYEPQIPPALKGGNVKVSKGDNTTAADPSDRLAVSRAYPHTYGQPLVHLV  70

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                         +H  +R+G+ FCGRQSPGGHN I GL+DALK  N +S L+GF+GG+E
Sbjct  71   SEDKA-------AKHSTLRIGVAFCGRQSPGGHNVITGLFDALKSQNADSVLIGFVGGTE  123

Query  438  glfAQKTLEITDD  476
            G+FAQKT+E+T+D
Sbjct  124  GIFAQKTVELTND  136



>gb|EMS49340.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
Length=794

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +3

Query  141  GTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVG  320
            G TVRVE+GDAT   DP+G H +++ FP  +GQ L  FL         + + E P IRVG
Sbjct  141  GATVRVEYGDATATIDPTGAHAVAQAFPRPYGQRLVTFLAPDGTAGAGKAVDERPPIRVG  200

Query  321  IVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  488
            +VF GRQSPGGHN +WGL+DALK +NP S L GF+GG+EGLFA KTLEITDD+LA+
Sbjct  201  VVFSGRQSPGGHNVVWGLHDALKAYNPQSILYGFIGGTEGLFANKTLEITDDVLAS  256



>dbj|BAJ85819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +3

Query  138  QGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQI-ITEHPAIR  314
            QG TVR E+G+ATT  DP+G H +++ FP T+GQ L  FL         +  + E P IR
Sbjct  7    QGATVRAEYGEATTTIDPAGAHAVAQAFPRTYGQRLVTFLAPDDAAGADKAAVHERPPIR  66

Query  315  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  488
            VG+VF GRQSPGGHN +WGL+DAL+ +NP+S L GF+GG+EGLFA KTLEITDD+LA+
Sbjct  67   VGVVFSGRQSPGGHNVVWGLHDALRAYNPHSVLYGFIGGTEGLFANKTLEITDDVLAS  124



>ref|XP_002970269.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
 gb|EFJ28399.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
Length=616

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = +3

Query  90   LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASA  269
            +Q +R  Y+  LPP L+   V++  GDATTA D S    I R F  T+GQPL H L    
Sbjct  7    IQGIRRGYKVSLPPALEAPNVQLVCGDATTAMDASDALAIQRSFSLTYGQPLVHLLPGKK  66

Query  270  KV------PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  431
                    P   ++ +  A RVG+VFCGRQSPGGHN + GL+DALK HNP++ L+G +GG
Sbjct  67   STGEKKLSPLRSVLCDAFAGRVGVVFCGRQSPGGHNIVAGLFDALKAHNPDNVLIGIVGG  126

Query  432  seglfAQKTLEITDDILAT  488
            ++GLFAQK++EIT D+LA 
Sbjct  127  TDGLFAQKSVEITADVLAV  145



>ref|XP_002978426.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
 gb|EFJ20412.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
Length=616

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = +3

Query  90   LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASA  269
            +Q +R  Y+  LPP L+   V++  GDATTA D S    I R F  T+GQPL H L    
Sbjct  7    IQGIRRGYKVSLPPALEAPNVQLVCGDATTAMDASDALAIQRSFSLTYGQPLVHLLPGKK  66

Query  270  KV------PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  431
                    P   ++ +  A RVG+VFCGRQSPGGHN + GL+DALK HNP++ L+G +GG
Sbjct  67   STGEKKLSPLRSVLCDAFAGRVGVVFCGRQSPGGHNIVAGLFDALKAHNPDNVLIGIVGG  126

Query  432  seglfAQKTLEITDDILAT  488
            ++GLFAQK++EIT D+LA 
Sbjct  127  TDGLFAQKSVEITADVLAV  145



>ref|XP_001755711.1| predicted protein [Physcomitrella patens]
 gb|EDQ79384.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 96/141 (68%), Gaps = 5/141 (4%)
 Frame = +3

Query  69   LARELSDLQKL---RSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
            L R++S LQ L   R+QY+P +PP L+  +V+V  GDA+  A+ S    +S  +PHT+G 
Sbjct  5    LHRKVSKLQGLSAVRAQYQPRVPPALKCGSVKVSVGDASATAELSDRLAVSEAYPHTYGL  64

Query  240  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
            PL   + +    P+A      P  R+G+ FCGRQSPGGHN I GL+DALK  N NS L+G
Sbjct  65   PLVQLMSSGG--PNATTAKHLPLSRIGVAFCGRQSPGGHNVITGLFDALKSQNANSILIG  122

Query  420  flggseglfAQKTLEITDDIL  482
            F+GG+EG+F+Q+T+E+T+D+L
Sbjct  123  FIGGTEGIFSQRTVELTNDML  143



>ref|XP_006837413.1| hypothetical protein AMTR_s00111p00148440 [Amborella trichopoda]
 gb|ERN00267.1| hypothetical protein AMTR_s00111p00148440 [Amborella trichopoda]
Length=589

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +3

Query  162  FGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQ  341
            F DAT  ++P    +I R FP T+GQPL HFL  S  V DA ++ E   IRVG+VFCGRQ
Sbjct  16   FADATITSNPL--DSIGRSFPLTYGQPLLHFLAESDNVIDAHVVQELTPIRVGVVFCGRQ  73

Query  342  SPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILA  485
            SPGGHN I GL++A+K+HNP STLLGF+GGSEGLFAQKTLEIT D+++
Sbjct  74   SPGGHNVICGLHEAIKIHNPKSTLLGFVGGSEGLFAQKTLEITKDVVS  121



>gb|AGY61461.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha2, 
partial [Rorippa amphibia]
 gb|AGY61462.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha2, 
partial [Rorippa sylvestris]
Length=267

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
            RA+AKVPDAQIITEH   RVGIVF GRQ+PGGHN IWGLYDALKVHN  +TLLGFLGGSE
Sbjct  1    RATAKVPDAQIITEHSPKRVGIVFSGRQAPGGHNVIWGLYDALKVHNAKNTLLGFLGGSE  60

Query  438  glfAQKTLEITDDILAT  488
            GLFAQKTLEITDD+L T
Sbjct  61   GLFAQKTLEITDDVLQT  77



>ref|XP_006660071.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=631

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 3/118 (3%)
 Frame = +3

Query  135  LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  314
            + G TV+VE+GD TT  DP+  + ++  FP T+GQPL  F+   A    A        +R
Sbjct  43   MSGATVKVEYGDPTTTIDPTCANVVADAFPCTYGQPLVSFVAPPAD---AAADEARKPLR  99

Query  315  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  488
            VG+VF GRQSPGGHN IWGL+DALK +NP+S L GF+GG+EGLFA KT+EITDD+LA+
Sbjct  100  VGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYGFVGGTEGLFANKTIEITDDVLAS  157



>ref|XP_002462125.1| hypothetical protein SORBIDRAFT_02g019555 [Sorghum bicolor]
 gb|EER98646.1| hypothetical protein SORBIDRAFT_02g019555 [Sorghum bicolor]
Length=104

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = +3

Query  60   DFGLARELSDLQKLRSQYRPELPPCL-QGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  236
            D G  REL+ LQ+ R+ Y+PELPPCL QGT +RVEFGD+TT  D      +++ FPH FG
Sbjct  5    DLGSPRELTGLQRRRALYQPELPPCLVQGTRIRVEFGDSTTTIDSKCADIVAQAFPHIFG  64

Query  237  QPLAHFLR----ASAKVPDAQIITEHPAIRVGIVFCGRQ  341
            Q L  FL           DAQ+I E+  IRVG+VF GRQ
Sbjct  65   QKLVRFLEPHMDTVVSESDAQVIQENSPIRVGVVFSGRQ  103



>ref|WP_006255527.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Alloprevotella 
tannerae]
 gb|EEX71434.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
tannerae ATCC 51259]
Length=550

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK RS Y+P+LP  L+G    +E     +  D +    I RLFPHT+G PL  F 
Sbjct  2    EISALQKARSSYQPKLPKGLRGNVDIIEGAPTESVGDQA---EIKRLFPHTYGMPLVEF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
                    A+ + E+  I VGI+  G Q+PGGHN I GL+D LK  NP S
Sbjct  58   ------APAKEVKEYAPINVGIILSGGQAPGGHNVICGLFDELKKQNPKS  101



>ref|WP_006952714.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
micans]
 gb|EHO69628.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
micans F0438]
Length=547

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 81/135 (60%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I +LFP+T+G PL  F 
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKIKEGEPTKSVDNQ--DDIKKLFPNTYGMPLVEF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                 VP  +  TE  A+ VG++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  
Sbjct  58   -----VPTDK--TESKAVNVGVILSGGQAPGGHNVISGLFDELKKLNPNNRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EIT D +
Sbjct  111  GLVDHNYIEITADFV  125



>gb|ABR16683.1| unknown [Picea sitchensis]
Length=558

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 92/151 (61%), Gaps = 15/151 (10%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  230
            M++D G+      +QKLRS + P++PP L+G  V++  GD T+AA       I + F  T
Sbjct  3    MENDTGI------MQKLRSLFVPQIPPALEGGRVQLLRGDTTSAAHSDDEDEIRKSFNFT  56

Query  231  FGQPLAHFLRASAKVPDAQIITEH---PAI-RVGIVF-CGRQSPGGHNAIWGLYDALKVH  395
            +GQPL  F+  S  + D +   E    PA+ RVG+VF    +SPG HN I G++DALK H
Sbjct  57   YGQPLVQFV--SQNLVDGE--NEENICPAVTRVGVVFGMEAESPGAHNVIAGIFDALKAH  112

Query  396  NPNSTllgflggseglfAQKTLEITDDILAT  488
            N  S L GF+GG+EGL +Q  L +TDD+L +
Sbjct  113  NNKSILFGFVGGTEGLCSQNALVVTDDMLKS  143



>ref|WP_025002795.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
dentasini]
Length=547

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 11/133 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQGT V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAAYQPKLPKALQGT-VKIQEGEPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             ++        +T    + VG++  G Q+PGGHN I GL+D +K  NP S L GFL G  
Sbjct  59   PSN--------VTNGKKVNVGVILSGGQAPGGHNVISGLFDEIKKLNPESRLYGFLMGPG  110

Query  438  glfAQKTLEITDD  476
            GL     +EIT+D
Sbjct  111  GLVNHNYIEITED  123



>ref|XP_002444175.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
 gb|EES13670.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
Length=582

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +3

Query  225  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  404
            HTFGQPL  F+  SA    A+    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP 
Sbjct  24   HTFGQPLVSFVAPSADAAAAE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQ  80

Query  405  STllgflggseglfAQKTLEITDDILAT  488
            S L GF+GG+EGLFA KTL +TDD+LA+
Sbjct  81   SVLYGFVGGTEGLFANKTLVLTDDVLAS  108



>ref|WP_025877362.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
corporis]
Length=553

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R++Y+P+LP  LQG  V+++ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERAKYQPKLPKALQGA-VKIKEGKPTQSVDDY--EEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A ++        +  +I VG++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  
Sbjct  59   PADSQ--------DSLSINVGVILSGGQAPGGHNVISGLFDELKKINPNNRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EIT D++
Sbjct  111  GLVDHNYIEITSDLI  125



>ref|WP_014455241.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
africana]
 gb|AFG37252.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
africana DSM 8902]
Length=554

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 13/138 (9%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTA-ADPSGGHTISRLFPHTFGQPLA  248
            +LS LQK R +Y+P+LP  LQ    ++ VEFG AT A AD +    +  LF  T+G+P+A
Sbjct  5    QLSPLQKARYEYQPKLPKALQSDLASISVEFGAATEAIADQA---RLKELFAKTYGKPIA  61

Query  249  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
             F   S  V           +RVG++  G Q+PGGHN I G+YD LK  NP S L+GF G
Sbjct  62   SFTSGSNDVSS-------KLLRVGVILSGGQAPGGHNVIAGIYDGLKKGNPESVLIGFKG  114

Query  429  gseglfAQKTLEITDDIL  482
            G  GL  +  +EITD  +
Sbjct  115  GPSGLLEKDYVEITDSFM  132



>ref|WP_036877364.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oryzae]
Length=546

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 11/136 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F 
Sbjct  2    EKSALQKARAAYQPKLPKALQGA-VKVKEGAPTKSVDNQ--EEIKKLFPNTYGMPLVEF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                 VP  +  T   A+ VG++  G Q+PGGHN I GL+D +K  N N+ L GFL G  
Sbjct  58   -----VPGEE--TAQKAMNVGVILSGGQAPGGHNVISGLFDEIKKLNSNNRLFGFLMGPG  110

Query  438  glfAQKTLEITDDILA  485
            GL   K +EIT+D LA
Sbjct  111  GLVDHKYVEITEDFLA  126



>ref|WP_019188428.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus 
Prevotella conceptionensis]
Length=546

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 79/135 (59%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D  G   I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAPTKSVDNQG--EIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
            +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EIT D +
Sbjct  111  GLVDHNYIEITADFI  125



>ref|WP_037983302.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063]
 gb|ETK00674.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 2]
 gb|ETK04037.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 5]
 gb|ETK06766.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 1/3]
 gb|ETK08124.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 6/7/9]
Length=548

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 73/133 (55%), Gaps = 10/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y P++P  L+G+   VE G AT AA       I RLFPHT+G P   F R 
Sbjct  4    SALQIARAAYVPKMPVALRGSVRAVE-GAATEAAGDK--EEIKRLFPHTYGMPAVTFERG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             A  P        P I  G++  G Q+PGGHN I GL+D LK  NP S L GF+ G  GL
Sbjct  61   DAADP-------MPPINAGVILSGGQAPGGHNVIAGLFDGLKAANPESRLFGFILGPGGL  113

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  114  VEHKYMELTADII  126



>ref|WP_025798196.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
Length=546

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 80/135 (59%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V++  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKIAEGAPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
            + + ++P         AI VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGN-EIPAK-------AINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL   K +EIT D L
Sbjct  111  GLVDHKYIEITADFL  125



>ref|WP_037997392.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063]
 gb|ETK12975.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 8/11]
Length=548

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 73/133 (55%), Gaps = 10/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y P++P  L+G+   VE G AT AA       I RLFPHT+G P   F R 
Sbjct  4    SALQIARAAYVPKMPVALRGSVRAVE-GAATEAAGDK--EEIKRLFPHTYGMPAVTFERG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             A  P        P I  G++  G Q+PGGHN I GL+D LK  NP S L GF+ G  GL
Sbjct  61   DAADP-------MPPINAGVILSGGQAPGGHNVIAGLFDGLKAANPESRLFGFILGPGGL  113

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  114  VEHKYMELTADII  126



>ref|WP_009161991.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
 gb|EKY02337.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica F0055]
Length=546

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 80/135 (59%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V++  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKIAEGAPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
            + + ++P         AI VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGN-EIPAK-------AINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL   K +EIT D L
Sbjct  111  GLVDHKYIEITADFL  125



>ref|WP_009346441.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Alloprevotella 
rava]
 gb|EHG25079.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Alloprevotella 
rava F0323]
Length=550

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 55/134 (41%), Positives = 78/134 (58%), Gaps = 10/134 (7%)
 Frame = +3

Query  81   LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  260
            +S LQK R+ Y+P+LP  L+G  V ++ G+ T + D      I  LFP+T+G PL  F+ 
Sbjct  3    ISALQKARAAYQPKLPQGLRGN-VEIKEGEPTQSVDNQ--EEIKELFPNTYGMPLVEFIP  59

Query  261  ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  440
               K        E+  I +G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  G
Sbjct  60   TDTK-------KEYAPINIGVILSGGQAPGGHNVICGLFDELKKQNPNNKLYGFLMGPGG  112

Query  441  lfAQKTLEITDDIL  482
            L   + LEIT +++
Sbjct  113  LVDHQYLEITSEVV  126



>ref|WP_037547210.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
sp. JC230]
 gb|KGE72441.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
sp. JC230]
Length=552

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 80/137 (58%), Gaps = 11/137 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGT--TVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAH  251
            E+S LQK R +Y P+LPP L G    + V FGD T +   +    + +LF  T+G+P+A 
Sbjct  2    EISALQKARLEYSPKLPPALSGAIDAIAVSFGDPTESI--ANQAELKQLFAKTYGKPIAA  59

Query  252  FLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  431
            F     K  +  +  E   +RVG++  G Q+PGGHN I GLYD LK  NPNS L GFLGG
Sbjct  60   F----GKGANPNVGKE---LRVGVILSGGQAPGGHNVITGLYDGLKKANPNSVLFGFLGG  112

Query  432  seglfAQKTLEITDDIL  482
              GL   + +E TD+ +
Sbjct  113  PSGLIDDEAVEFTDEFI  129



>ref|WP_024268710.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Salinispira pacifica]
 gb|AHC15807.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Salinispira pacifica]
Length=553

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 63/114 (55%), Gaps = 13/114 (11%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLA  248
            E+S LQK R +Y+P+LP  L    + +RVE GD T + AD      +  LFPH++G P+A
Sbjct  2    EISSLQKARYEYQPKLPAALDSAISDIRVELGDPTESVADQD---QVKSLFPHSYGAPIA  58

Query  249  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  410
             F     K       T    +RVG++  G Q+PGGHN I GLYD LK  N  S 
Sbjct  59   VFASGKGK-------TSQNPLRVGVILSGGQAPGGHNVITGLYDGLKKANSQSN  105



>ref|WP_009229809.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317]
 gb|EFC69384.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317 str. F0108]
Length=546

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAPTKSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
            +   K+P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGD-KMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EIT D +
Sbjct  111  GLVDHNYIEITADFI  125



>gb|AIN94596.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
putidum]
Length=563

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P   +   + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYHYEPKIPKVFEEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  +PNS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGSPNS  104



>gb|ADQ78315.1| pyrophosphate-dependent phosphofructokinase [Paludibacter propionicigenes 
WB4]
Length=551

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  L+G  V  E     + AD +    I  LFP+T+G PL  F   
Sbjct  7    SPLQIARASYQPKLPTALKGNVVLKEGAATESVADQA---DIKTLFPNTYGMPLISF---  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
                 +A +  E+PA+  G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  GL
Sbjct  61   -----EAGVKKEYPAVAAGVILSGGQAPGGHNVICGLFDGLKALNPNNKLYGFLAGPSGL  115

Query  444  fAQKTLEITDDIL  482
                 +E+T +I+
Sbjct  116  VDHNYIELTKEIV  128



>ref|WP_006947947.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
marshii]
 gb|EFM02863.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
marshii DSM 16973 = JCM 13450]
Length=546

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 66/112 (59%), Gaps = 15/112 (13%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ YRP+LP  LQG  V++E G  T + D      I +LFPHT+G PL  F+
Sbjct  2    EKSALQKERAAYRPKLPKALQGA-VKIEEGTPTQSVDNK--DEIKKLFPHTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIR--VGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  +          HP+ R  VG++  G Q+PGGHN I GL DA+K  +P++
Sbjct  59   KGES----------HPSKRLNVGVILSGGQAPGGHNVICGLVDAVKQLHPDN  100



>ref|WP_041620527.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paludibacter 
propionicigenes]
Length=548

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  L+G  V  E     + AD +    I  LFP+T+G PL  F   
Sbjct  4    SPLQIARASYQPKLPTALKGNVVLKEGAATESVADQA---DIKTLFPNTYGMPLISF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
                 +A +  E+PA+  G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  GL
Sbjct  58   -----EAGVKKEYPAVAAGVILSGGQAPGGHNVICGLFDGLKALNPNNKLYGFLAGPSGL  112

Query  444  fAQKTLEITDDIL  482
                 +E+T +I+
Sbjct  113  VDHNYIELTKEIV  125



>ref|WP_021909549.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:755]
 emb|CCY15228.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:755]
Length=357

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 74/133 (56%), Gaps = 10/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  L+G     E     + AD      I +LFP+T+G PL  F+ +
Sbjct  4    SALQIARAAYQPKLPQGLRGNVTIKEGAPTQSVADQ---EEIQKLFPNTYGMPLVEFVPS  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
            S K        E+  + +G++  G Q+PGGHN I GLYD LK  NP + L GF+ G  GL
Sbjct  61   SEK-------REYAPMNIGVILSGGQAPGGHNVICGLYDELKKQNPANKLYGFILGPGGL  113

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  114  VDHKYMELTGDII  126



>ref|WP_036897542.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
 gb|KGI60529.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
Length=546

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKIKEGEPTQSVDNQ--EEIKKLFPNTYGMPLVEFI  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
                K            + VGI+  G Q+PGGHN I GL+DA+K  NPN+
Sbjct  59   PGDEK--------NSLEMNVGIILSGGQAPGGHNVISGLFDAVKNLNPNN  100



>gb|ABS72008.1| putative 6-phosphofructokinase [Olea europaea]
Length=41

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  51   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDA  173
            MDSD+G+ RELS LQKLRSQY+P+LPPCLQGTTVRVEFGDA
Sbjct  1    MDSDYGIPRELSGLQKLRSQYQPQLPPCLQGTTVRVEFGDA  41



>ref|WP_014709913.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
intermedia]
 gb|AFJ09212.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
intermedia 17]
Length=552

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  L+G  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERASYQPKLPKALKGA-VKIKEGEPTQSVDNH--EEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A  +        E   I VG++  G Q+PGGHN I GLYD LK  NP + L GFL G  
Sbjct  59   PAEKQ--------ESFRINVGVILSGGQAPGGHNVISGLYDELKKLNPENRLFGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EITD ++
Sbjct  111  GLVDHNYIEITDVLM  125



>ref|WP_028904978.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
intermedia]
Length=552

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  L+G  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERASYQPKLPKALKGA-VKIKEGEPTQSVDNH--EEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A  +        E   I VG++  G Q+PGGHN I GLYD LK  NP + L GFL G  
Sbjct  59   PAEKQ--------ESFRINVGVILSGGQAPGGHNVISGLYDELKKLNPENRLFGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EITD ++
Sbjct  111  GLVDHNYIEITDVLM  125



>ref|WP_025278280.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
viscericola]
 gb|AHF12352.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
viscericola DSM 18177]
Length=550

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4    SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQ---EAIAKLFPNTYGMPVLRFEAA  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
              K        E+PAI VG++  G Q+PGGHN I GL+D LK  N +S L GFL G  GL
Sbjct  61   PKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKAMNKDSRLFGFLLGPGGL  112

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  113  IDHKYMELTADII  125



>ref|WP_009437358.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 473]
 gb|EKX89943.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 473 str. F0040]
Length=546

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 59/135 (44%), Positives = 75/135 (56%), Gaps = 10/135 (7%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQ  R+ Y+P+LP  L+G    VE G  T + D      I  LFP+T+G PL +F 
Sbjct  2    EKSALQIARAAYQPKLPAGLRGNVKIVE-GAPTQSVDNQ--EEIKALFPNTYGMPLVNFE  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                K        E+  I +GI+  G Q+PGGHN I GLYD LK  NPNS L GFL G  
Sbjct  59   PTDEK-------KEYAPINIGIILSGGQAPGGHNVICGLYDGLKKQNPNSKLYGFLMGPG  111

Query  438  glfAQKTLEITDDIL  482
            GL     LE+TD+++
Sbjct  112  GLVDHNYLEMTDELI  126



>ref|WP_008861193.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
intestinihominis]
 gb|EJZ66519.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Barnesiella 
intestinihominis YIT 11860]
Length=549

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4    SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQEA---IAKLFPNTYGMPVLRFEAA  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
            + K        E+PAI VG++  G Q+PGGHN I GL+D LK  N  S L GFL G  GL
Sbjct  61   AKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKALNKESRLFGFLLGPGGL  112

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  113  IEHKYMELTADII  125



>ref|WP_021892263.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:20]
 emb|CCX94843.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:20]
Length=549

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4    SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQEA---IAKLFPNTYGMPVLRFEAA  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
            + K        E+PAI VG++  G Q+PGGHN I GL+D LK  N  S L GFL G  GL
Sbjct  61   AKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKALNKESRLFGFLLGPGGL  112

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  113  IEHKYMELTADII  125



>ref|WP_021671600.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. F0091]
 gb|ERJ79916.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. F0091]
Length=547

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKVQEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             A +          +  I VGI+  G Q+PGGHN I GL+D +K  NP +
Sbjct  59   PADS--------ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPEN  100



>ref|WP_005923725.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EIY62959.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
salyersiae CL02T12C01]
 gb|EOA51424.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
salyersiae WAL 10018 = DSM 18765 = JCM 12988]
 emb|CCY51654.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:189]
Length=547

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  L+G    VE     + AD      I +LFP+T+G PL  F   
Sbjct  4    SALQIARAAYQPKLPKALKGAVKAVEGAATQSVADQ---EAIQKLFPNTYGMPLIKFEAG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             A         + PA+ VG++  G Q+PGGHN I GL+D +K  NP+S L GF+ G  GL
Sbjct  61   EA--------VKLPAMNVGVILSGGQAPGGHNVISGLFDGIKALNPDSKLYGFILGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +E+T DI+
Sbjct  113  VDHNYMELTSDII  125



>ref|WP_004359492.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica]
 gb|EFC73632.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica D18]
Length=547

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKVQEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             A +          +  I VGI+  G Q+PGGHN I GL+D +K  NP +
Sbjct  59   PADS--------VNNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPEN  100



>ref|WP_028909804.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. AGR2160]
Length=549

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 57/136 (42%), Positives = 78/136 (57%), Gaps = 11/136 (8%)
 Frame = +3

Query  75   RELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
            +E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F
Sbjct  2    KEISALQKERAAYQPKLPKALQGA-VKVQEGAPTQSVDNQ--EEIKKLFPNTYGMPLIEF  58

Query  255  LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
                  VP  +       + +G++  G Q+PGGHN I GL+D LK  NP + L GFL G 
Sbjct  59   ------VPGDE--ENRAKMNIGVILSGGQAPGGHNVITGLFDTLKKLNPENRLYGFLMGP  110

Query  435  eglfAQKTLEITDDIL  482
             GL     +EIT+D L
Sbjct  111  GGLVDHNYIEITEDFL  126



>ref|WP_036865072.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica]
 gb|KGF47636.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica DNF00666]
Length=547

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 78/137 (57%), Gaps = 11/137 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKVQEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A +          +  I VGI+  G Q+PGGHN I GL+D +K  NP + L GFL G  
Sbjct  59   PADS--------ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPENRLYGFLMGPG  110

Query  438  glfAQKTLEITDDILAT  488
            GL     +EIT + L T
Sbjct  111  GLVDHNYIEITAENLQT  127



>ref|WP_008121761.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis]
 gb|EFA98541.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis CRIS 5C-B1]
Length=546

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFPHT+G PL  F   
Sbjct  4    SALQVERAAYQPKLPKALQGA-VKVQEGAPTQSVDDQ--EEIQKLFPHTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               VP     TE   + VG++  G Q+PGGHN I GL+DA+K  NP + L GFL G  GL
Sbjct  58   ---VPGEH--TESKRLNVGVILSGGQAPGGHNVISGLFDAVKKLNPENQLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +EIT D L
Sbjct  113  VEHHYVEITKDFL  125



>ref|WP_025071710.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis]
Length=546

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFPHT+G PL  F   
Sbjct  4    SALQVERAAYQPKLPKALQGA-VKVQEGAPTQSVDDQ--EEIQKLFPHTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               VP     TE   + VG++  G Q+PGGHN I GL+DA+K  NP + L GFL G  GL
Sbjct  58   ---VPGEH--TESKRLNVGVILSGGQAPGGHNVISGLFDAVKKLNPENQLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +EIT D L
Sbjct  113  VEHHYVEITKDFL  125



>ref|WP_009010591.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. C561]
 gb|EGW48516.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. C561]
Length=547

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKVQEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             A +          +  I VGI+  G Q+PGGHN I GL+D +K  NP +
Sbjct  59   PADS--------ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPEN  100



>ref|WP_036925131.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. ICM33]
 gb|ETS96328.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. ICM33]
Length=547

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKVQEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             A +          +  I VGI+  G Q+PGGHN I GL+D +K  NP +
Sbjct  59   PADS--------ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPEN  100



>ref|WP_013265533.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica]
 gb|ADK97073.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
melaninogenica ATCC 25845]
Length=547

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKVQEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             A +          +  I VGI+  G Q+PGGHN I GL+D +K  NP +
Sbjct  59   PADS--------ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPEN  100



>ref|WP_009235627.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 472]
 gb|EEX52180.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 472 str. F0295]
Length=546

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAPTQSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+
Sbjct  59   QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNN  100



>ref|WP_039420029.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Porphyromonas]
 gb|KGL55500.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
sp. COT-052 OH4946]
 gb|KGN67618.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN75569.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN87751.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN92373.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGO02288.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 61/108 (56%), Gaps = 10/108 (9%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDS  101



>ref|WP_039426896.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN83538.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 61/108 (56%), Gaps = 10/108 (9%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDS  101



>ref|WP_039419596.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGL47250.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN72678.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGO04092.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 61/108 (56%), Gaps = 10/108 (9%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDS  101



>ref|WP_026292223.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN77932.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 61/108 (56%), Gaps = 10/108 (9%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDS  101



>gb|EGV34403.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
oulorum F0390]
Length=547

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/110 (45%), Positives = 62/110 (56%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK RS Y+P+LP  LQG    VE G  T + D      I  LFP+T+G PL  F 
Sbjct  3    EISALQKARSAYQPKLPKALQGAVKIVE-GAPTQSVDNQ--EEIKNLFPNTYGMPLVEF-  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
                 VP  +  T    + VGI+  G Q+PGGHN I GL+DA+K  NP +
Sbjct  59   -----VPGNE--TNQKKMNVGIILSGGQAPGGHNVISGLFDAVKKLNPEN  101



>ref|WP_018966518.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
loescheii]
 gb|KDR53753.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
loescheii DSM 19665 = JCM 12249 = ATCC 15930]
Length=546

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAHTQSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
            +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EIT D +
Sbjct  111  GLVDHDYIEITADFV  125



>ref|WP_040561026.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oulorum]
Length=546

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/110 (45%), Positives = 62/110 (56%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK RS Y+P+LP  LQG    VE G  T + D      I  LFP+T+G PL  F 
Sbjct  2    EISALQKARSAYQPKLPKALQGAVKIVE-GAPTQSVDNQ--EEIKNLFPNTYGMPLVEF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
                 VP  +  T    + VGI+  G Q+PGGHN I GL+DA+K  NP +
Sbjct  58   -----VPGNE--TNQKKMNVGIILSGGQAPGGHNVISGLFDAVKKLNPEN  100



>ref|WP_028896044.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. HUN102]
Length=547

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 76/135 (56%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I  LFP+T+G PL  F+
Sbjct  2    ETSALQKARAAYQPKLPKALQGA-VKIQEGEPTQSVDNH--EEIKNLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A  +            I VG++  G Q+PGGHN I GL+D LK  NP + L GF  G  
Sbjct  59   PADKE--------NALRINVGVILSGGQAPGGHNVISGLFDQLKKLNPENRLYGFQMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL   K LEIT +++
Sbjct  111  GLVDHKYLEITPELM  125



>ref|WP_025070337.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oulorum]
Length=546

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/110 (43%), Positives = 61/110 (55%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK RS Y+P+LP  LQG    VE G  T + D      I  LFP+T+G PL  F+
Sbjct  2    EISALQKARSAYQPKLPKALQGAVKIVE-GAPTQSVDNQ--EEIKNLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
              +         T    + VGI+  G Q+PGGHN I GL+DA+K  NP +
Sbjct  59   LGNE--------TNQKKMNVGIILSGGQAPGGHNVISGLFDAVKKLNPEN  100



>ref|WP_010956991.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 ref|NP_972156.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ATCC 35405]
 gb|AAS12067.1| phosphofructokinase, pyrophosphate-dependent [Treponema denticola 
ATCC 35405]
Length=560

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_002678239.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB43331.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ASLM]
 gb|EMD56694.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola US-Trep]
Length=560

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_002682935.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB36139.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola H-22]
Length=560

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_002689303.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB28300.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola MYR-T]
 gb|EMB29042.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola H1-T]
 gb|EMB39731.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ATCC 33520]
Length=560

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_010699412.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB21050.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP37]
 gb|EPF33080.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP44]
 gb|EPF40558.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP23]
Length=560

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_002693855.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB19415.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola OTK]
Length=560

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_002669081.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EGC77300.1| phosphofructokinase [Treponema denticola F0402]
 gb|EMB46853.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola AL-2]
Length=560

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_004365932.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
nigrescens]
 gb|EGQ17094.1| phosphofructokinase [Prevotella nigrescens ATCC 33563]
Length=552

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  L+G  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERASYQPKLPKALKGA-VKIKEGEPTQSVDNH--DEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A  +        +   I VG++  G Q+PGGHN I GLYD LK  NP + L GFL G  
Sbjct  59   PAEKQ--------DSVRINVGVILSGGQAPGGHNVISGLYDELKKLNPENRLFGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EITD ++
Sbjct  111  GLVDHNYIEITDILM  125



>ref|WP_022385737.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:462]
 emb|CDD83168.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:462]
Length=549

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 60/108 (56%), Gaps = 10/108 (9%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R  Y+P+LP  L+G    VE G    A        + +LFP+T+G P+  F+ +
Sbjct  6    SALQLARKSYQPKLPKALRGAIEVVELGKTEPATHK---EELKKLFPNTYGMPILRFVES  62

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            + +        E+PAI VGI+  G  +PGGHN I GLYD LK +N +S
Sbjct  63   TKQ-------KEYPAINVGIILSGGPAPGGHNVISGLYDGLKTNNKDS  103



>ref|WP_038563379.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Draconibacterium 
orientale]
 gb|AHW61396.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Draconibacterium 
orientale]
Length=550

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 78/134 (58%), Gaps = 10/134 (7%)
 Frame = +3

Query  81   LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  260
            +S LQK R++Y+P+LP  L+G    VE     + AD      I+ LFP+T+G PL  F  
Sbjct  3    ISALQKERAKYQPKLPKSLKGNVKLVEGAKTESVADQK---EIAELFPNTYGMPLITFEA  59

Query  261  ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  440
            A A        T+   + VG++  G Q+PGGHN I G++D +K  +P+S L GFLGG  G
Sbjct  60   ADAA-------TDRQPVNVGVILSGGQAPGGHNVISGIFDGIKNIHPDSKLYGFLGGPGG  112

Query  441  lfAQKTLEITDDIL  482
            L   K +E+T DI+
Sbjct  113  LVDHKYMELTADII  126



>ref|WP_025001065.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
aurantiaca]
Length=552

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  L+G  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERASYQPKLPNALKGA-VKIKEGEPTQSVDNH--DEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             A  +        E   I VG++  G Q+PGGHN I GLYD LK  NP +
Sbjct  59   PAEEQ--------ESIRINVGVILSGGQAPGGHNVISGLYDELKKLNPEN  100



>ref|WP_010697336.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB21954.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP33]
 gb|EPF35925.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP32]
Length=560

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 11/110 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYHYEPKIPKVFAEPLSLIKPEIGEATHAQ--SDQAELKEIFPHTYGMPIIRFV  61

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS
Sbjct  62   KGKSEV-------EHTPLKFGVILSGGQAPGGHNVISGLFDALKKGNANS  104



>ref|WP_025839858.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
scopos]
Length=547

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKVKEGAPTQSVDNQ--EEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
             + A          +  I VGI+  G Q+PGGHN I GL+D +K  NP +
Sbjct  59   PSDA--------ANNAKINVGIILSGGQAPGGHNVISGLFDEVKKLNPEN  100



>ref|WP_013968126.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
caldaria]
 gb|AEJ18814.1| diphosphate/fructose-6-phosphate1-phosphotransfe rase [Treponema 
caldaria DSM 7334]
Length=551

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 81/138 (59%), Gaps = 13/138 (9%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLA  248
            E+S LQK R  YRP+LP  L G  + + +EFG  T + AD +    +  LF H++G+PLA
Sbjct  2    EISALQKARYAYRPKLPVILTGPVSDIAIEFGTPTESVADQA---DLRALFKHSYGKPLA  58

Query  249  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  428
             F++          IT    + VG++  G Q+PGGHN I GLYD LK  N +S LLGFLG
Sbjct  59   RFVKGKN-----DKITRR--LTVGVILSGGQAPGGHNVIAGLYDGLKKGNKDSKLLGFLG  111

Query  429  gseglfAQKTLEITDDIL  482
            G  GL   K +EITD  +
Sbjct  112  GPSGLIENKVVEITDAFM  129



>gb|EKE04636.1| hypothetical protein ACD_20C00035G0001 [uncultured bacterium]
Length=566

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 65/115 (57%), Gaps = 11/115 (10%)
 Frame = +3

Query  69   LARELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQP  242
            + RELS LQK R  Y+P+LP  L+     + +E+G  T A   +    +  LFP+++G+P
Sbjct  12   MTRELSALQKARLGYKPKLPKVLRNGIKNLNLEYGVPTQAI--ADADDVQELFPNSYGKP  69

Query  243  LAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            +A F      VP+           VG++  G Q+PGGHN I GL+DALK  NP++
Sbjct  70   MATFTSKHDAVPNK-------TTNVGVILSGGQAPGGHNVIAGLFDALKEANPDN  117



>ref|WP_025065627.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
enoeca]
Length=546

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK RS Y+P+LP  LQG  V+V+ G  T +   S    I +LFP+T+G PL  F   
Sbjct  4    SLLQKERSSYQPKLPKGLQGA-VKVKEGAPTQSV--SDREEIQKLFPNTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               VP  +    H A+ VG++  G Q+PGGHN I G++D +K  NPN+ L GFL G  GL
Sbjct  58   ---VPGNE--ANHEAMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +E+T +I+
Sbjct  113  VEHNYIELTSEII  125



>ref|WP_023058711.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Prevotella]
 gb|ERT56306.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. BV3P1]
 gb|KGF42411.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis DNF00985]
Length=546

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 11/105 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK R+ Y+P+LP  LQG  V+++ G  T + D      I +LFPHT+G PL  F   
Sbjct  4    SALQKERASYQPKLPKALQGA-VKIKEGAPTESVDDQ--EEIKKLFPHTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
               VP  +   EH  + VG++  G Q+PGGHN I GL+DA+K  N
Sbjct  58   ---VPGDK--CEHKLMNVGVILSGGQAPGGHNVISGLFDAVKKLN  97



>ref|WP_021589756.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
baroniae]
 gb|ERK39212.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
baroniae F0067]
Length=548

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 11/136 (8%)
 Frame = +3

Query  75   RELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
            +E+S LQK R+ Y+P+LP  L G  V+V+ G+ T +   +    I  LFP+T+G PL  F
Sbjct  2    KEISALQKERAAYQPKLPKALMGA-VKVKEGEPTQSV--ANQQEIKELFPNTYGMPLVEF  58

Query  255  LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
            +    K  +A++        VG++  G Q+PGGHN I GL+DA+K  NPN+ L GFL G 
Sbjct  59   VSGD-KANEAEM-------NVGVILSGGQAPGGHNVISGLFDAVKKLNPNNRLFGFLMGP  110

Query  435  eglfAQKTLEITDDIL  482
             GL     +EIT D +
Sbjct  111  GGLVDHNYVEITSDFI  126



>ref|WP_025881004.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
baroniae]
Length=548

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 11/136 (8%)
 Frame = +3

Query  75   RELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHF  254
            +E+S LQK R+ Y+P+LP  L G  V+V+ G+ T +   +    I  LFP+T+G PL  F
Sbjct  2    KEISALQKERAAYQPKLPKALMGA-VKVKEGEPTQSV--ANQQEIKELFPNTYGMPLVEF  58

Query  255  LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  434
            +    K  +A++        VG++  G Q+PGGHN I GL+DA+K  NPN+ L GFL G 
Sbjct  59   VSGD-KANEAEM-------NVGVILSGGQAPGGHNVISGLFDAVKKLNPNNRLFGFLMGP  110

Query  435  eglfAQKTLEITDDIL  482
             GL     +EIT D +
Sbjct  111  GGLVDHNYVEITSDFI  126



>ref|WP_007902847.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Prevotella]
 gb|EHJ36393.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
stercorea DSM 18206]
 emb|CDE33446.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
stercorea CAG:629]
Length=549

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQ  R+ Y+P+LP  LQG    VE G+AT +        I  LFP+T+G P+  F 
Sbjct  2    EISALQIARAAYQPKLPKALQGPVKAVE-GEATQSV--GNQEEIKALFPNTYGMPVITF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                   +A   TE PA  VG++  G Q+PGGHN I GL+D +K  NP + L GF+ G  
Sbjct  58   -------EAGEKTELPAFNVGVILSGGQAPGGHNVISGLFDGVKSLNPENKLYGFILGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL   K +EIT +++
Sbjct  111  GLVDHKYIEITSELM  125



>ref|WP_036872035.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis]
 gb|KGF35998.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis DNF00853]
Length=546

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 11/105 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK R+ Y+P+LP  LQG  V+++ G  T + D      I +LFPHT+G PL  F   
Sbjct  4    SALQKERASYQPKLPKALQGA-VKIKEGAPTESVDNQ--EEIRKLFPHTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
               VP  +   EH  + VG++  G Q+PGGHN I GL+DA+K  N
Sbjct  58   ---VPGDK--CEHKLMNVGVILSGGQAPGGHNVISGLFDAVKKLN  97



>ref|WP_004362686.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
nigrescens]
 gb|ELX68004.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
nigrescens F0103]
Length=552

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  L+G  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERASYQPKLPKALKGA-VKIKEGEPTQSVDNH--DEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A  +        +   I VG++  G Q+PGGHN I GL+D LK  NP + L GFL G  
Sbjct  59   PAEKQ--------DSVRINVGVILSGGQAPGGHNVISGLFDELKKLNPENRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EITD ++
Sbjct  111  GLVDHNYIEITDSLI  125



>ref|WP_025067563.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola]
Length=547

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 11/137 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK RS Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F 
Sbjct  2    EISALQKERSGYQPKLPKALQGA-VKVKEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFE  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A +          +  + VG++  G Q+PGGHN I GL+D +K  NP + L GFL G  
Sbjct  59   PAES--------ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPG  110

Query  438  glfAQKTLEITDDILAT  488
            GL     +EIT D L +
Sbjct  111  GLVDHNYVEITADYLQS  127



>ref|WP_004353492.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola]
 gb|EGC86256.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola CRIS 18C-A]
Length=547

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 11/137 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK RS Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F 
Sbjct  2    EISALQKERSGYQPKLPKALQGA-VKVKEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFE  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A +          +  + VG++  G Q+PGGHN I GL+D +K  NP + L GFL G  
Sbjct  59   PAES--------ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPG  110

Query  438  glfAQKTLEITDDILAT  488
            GL     +EIT D L +
Sbjct  111  GLVDHNYVEITADYLQS  127



>ref|WP_036854388.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola]
 gb|KGF42223.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
denticola DNF00960]
Length=547

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 11/137 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQK RS Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F 
Sbjct  2    EISALQKERSGYQPKLPKALQGA-VKVKEGAPTQSVDNQ--EDIKKLFPNTYGMPLVEFE  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A +          +  + VG++  G Q+PGGHN I GL+D +K  NP + L GFL G  
Sbjct  59   PAES--------ANNAKMNVGVILSGGQAPGGHNVISGLFDEIKKLNPENRLYGFLMGPG  110

Query  438  glfAQKTLEITDDILAT  488
            GL     +EIT D L +
Sbjct  111  GLVDHNYVEITADYLQS  127



>ref|WP_039876710.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
pleuritidis]
Length=546

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK RS Y+P+LP  LQG  V+V+ G  T +   S    I +LFP+T+G PL  F   
Sbjct  4    SLLQKERSSYQPKLPKGLQGA-VKVKEGAPTQSV--SDREEIQKLFPNTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               VP  +    H A+ VG++  G Q+PGGHN I G++D +K  NPN+ L GFL G  GL
Sbjct  58   ---VPGNE--ANHEAMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +E+T +I+
Sbjct  113  VEHNYIELTAEII  125



>ref|WP_004350381.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis]
 gb|EFA91285.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
buccalis ATCC 35310]
Length=546

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 11/105 (10%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK R+ Y+P+LP  LQG  V+++ G  T + D      I +LFPHT+G PL  F   
Sbjct  4    SALQKERASYQPKLPKALQGA-VKIKEGAPTESVDDQ--DEIKKLFPHTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  398
               VP  +   EH  + VG++  G Q+PGGHN I GL+DA+K  N
Sbjct  58   ---VPGDK--CEHKLMNVGVILSGGQAPGGHNVISGLFDAVKKLN  97



>ref|WP_021854968.1| phosphofructokinase [Prevotella sp. CAG:255]
 emb|CCX70505.1| phosphofructokinase [Prevotella sp. CAG:255]
Length=546

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R  Y P+LP  LQG+ V+V+ G  T + D      I +LFP+T+G P+  F 
Sbjct  2    EKSALQKARIDYAPKLPTSLQGS-VKVKEGAPTQSVDDQ--EDIKKLFPNTYGMPVVEFE  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             ++         T+   + VG++  G Q+PGGHN I GL+D +K  NPN+ L GF+ G  
Sbjct  59   PSNE--------TQTCEMNVGVILSGGQAPGGHNVITGLFDTIKRLNPNNKLYGFILGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL   K +EIT+D +
Sbjct  111  GLVDHKYIEITEDYI  125



>ref|WP_024991268.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
pleuritidis]
Length=546

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK RS Y+P+LP  LQG  V+V+ G  T +   S    I +LFP+T+G PL  F   
Sbjct  4    SLLQKERSSYQPKLPKGLQGA-VKVKEGAPTQSV--SDREEIQKLFPNTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               VP  +    H A+ VG++  G Q+PGGHN I G++D +K  NPN+ L GFL G  GL
Sbjct  58   ---VPGNE--ANHEAMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +E+T +I+
Sbjct  113  VEHNYIELTAEII  125



>ref|WP_027449768.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
brevis]
Length=545

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQ  R+ Y+P+LP  LQG  V+V+ G  T + D      I  LFP+T+G PL  F 
Sbjct  2    EKSALQIARAAYQPKLPLGLQGA-VKVQEGAPTQSVDNQ--EEIKALFPNTYGMPLVEF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                 VP  +  T H  + VGI+  G Q+PGGHN I GL+DA+K  NP + L GF+ G  
Sbjct  58   -----VPGQE--TAHEKMNVGIILSGGQAPGGHNVITGLFDAVKKLNPENRLFGFILGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +E+T DI+
Sbjct  111  GLVDHNYMELTADII  125



>ref|WP_009317720.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Porphyromonadaceae]
 gb|EHL86687.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. 6_1_58FAA_CT1]
 emb|CDD89335.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. CAG:51]
 gb|ERM88959.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Coprobacter 
fastidiosus NSB1]
Length=547

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 76/133 (57%), Gaps = 10/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  L+G+    E     + AD      I++LFP+T+G P+  F+ +
Sbjct  4    SALQIARAAYQPKLPKALKGSLKIQEGAPTQSVADQDA---IAKLFPNTYGMPVLSFIES  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
            +        +  +PAI  G++  G Q+PGGHN I GL+D LK  N +S L GFL G  GL
Sbjct  61   NE-------VKNYPAINAGVILSGGQAPGGHNVIAGLFDGLKALNKDSRLYGFLLGPGGL  113

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  114  VDHKYIELTQDII  126



>gb|ERK00034.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
pleuritidis F0068]
Length=600

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK RS Y+P+LP  LQG  V+V+ G  T +   S    I +LFP+T+G PL  F   
Sbjct  58   SLLQKERSSYQPKLPKGLQGA-VKVKEGAPTQSV--SDREEIQKLFPNTYGMPLVEF---  111

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               VP  +    H A+ VG++  G Q+PGGHN I G++D +K  NPN+ L GFL G  GL
Sbjct  112  ---VPGNE--ANHEAMNVGVILSGGQAPGGHNVICGIFDEVKKLNPNNRLYGFLMGPGGL  166

Query  444  fAQKTLEITDDIL  482
                 +E+T +I+
Sbjct  167  VEHNYIELTAEII  179



>ref|WP_029901822.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. 10(H)]
Length=548

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P++P  L G+ V++E G AT +   +    + +LFP+T+G P   F+  
Sbjct  4    SALQIARATYKPKMPKALYGS-VKIEEGAATQSV--ADQEEVKKLFPNTYGMPTLKFVET  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            S KV       ++PAI VG++  G Q+PGGHN I GL+D +K  N  S
Sbjct  61   SEKV-------DYPAINVGVILSGGQAPGGHNVIAGLFDGIKNLNSGS  101



>ref|WP_027456161.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
brevis]
Length=545

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQ  R+ Y+P+LP  LQG  V+V+ G  T + D      I  LFP+T+G PL  F 
Sbjct  2    EKSALQIARAAYQPKLPLGLQGA-VKVQEGAPTQSVDNQ--EEIKALFPNTYGMPLVEF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
                 VP  +  T H  + VGI+  G Q+PGGHN I GL+DA+K  NP + L GF+ G  
Sbjct  58   -----VPGQE--TAHEKMNVGIILSGGQAPGGHNVITGLFDAVKKLNPENRLFGFILGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +E+T DI+
Sbjct  111  GLVDHNYMELTADII  125



>ref|XP_002984967.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
 gb|EFJ13842.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
Length=560

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 77/133 (58%), Gaps = 8/133 (6%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S +Q  R  Y+P +P  L+G   +VE G +T+AA  +G   I++LFP  FGQP  H +  
Sbjct  22   SPVQSSRLDYKPPMPSVLEGH-FKVEHGSSTSAAGDAG--AIAQLFPKLFGQPSVHIVPC  78

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
            +A         E   +R+G+V  G Q+PGGHN I GL+D L+ H P S LLGF GG  G+
Sbjct  79   AAAA-----FKEEVKLRIGVVLSGGQAPGGHNVIAGLFDYLQKHAPGSLLLGFRGGPAGI  133

Query  444  fAQKTLEITDDIL  482
               K +EIT + L
Sbjct  134  MRCKYVEITSEFL  146



>ref|WP_022231625.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:443]
 emb|CDB99241.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:443]
Length=547

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I +LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVQEGEPTQSV--ADQEAIKKLFPNTYGMPLIKFVEG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
             AK        E+  + VG++  G Q+PGGHN I GL+D +K  NP + L GF+ G  GL
Sbjct  61   EAK--------EYAPMNVGVILSGGQAPGGHNVISGLFDGIKKLNPANKLYGFILGPGGL  112

Query  444  fAQKTLEITDDIL  482
               K +E+T DI+
Sbjct  113  VDHKYMELTADII  125



>ref|XP_010275338.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=562

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 74/143 (52%), Gaps = 51/143 (36%)
 Frame = +3

Query  60   DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  239
            +F    ELS LQK RS Y PELP CLQ                                 
Sbjct  2    EFAAVMELSGLQKQRSSYIPELPLCLQCY-------------------------------  30

Query  240  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  419
             L H+                   R+G++FCGRQSPGGHN + GL+DA+K HNP STLLG
Sbjct  31   -LKHY-------------------RIGVIFCGRQSPGGHNIVCGLHDAIKSHNPKSTLLG  70

Query  420  flggseglfAQKTLEITDDILAT  488
            F GG+EGLF+QKT+EIT+DI+ +
Sbjct  71   FCGGTEGLFSQKTIEITEDIVLS  93



>ref|WP_023924546.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
nigrescens]
 gb|ETD29837.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
nigrescens CC14M]
Length=552

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQK R+ Y+P+LP  L+G  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERASYQPKLPKALKGA-VKIKEGEPTQSVDNH--DEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
             A  +        +   I VG++  G Q+PGGHN I GL+D LK  NP + L GFL G  
Sbjct  59   PAGKQ--------DSVRINVGVILSGGQAPGGHNVISGLFDELKKLNPENRLYGFLMGPG  110

Query  438  glfAQKTLEITDDIL  482
            GL     +EITD ++
Sbjct  111  GLVDHNYIEITDTLI  125



>ref|WP_036927708.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis]
 gb|KGI21925.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
timonensis S9-PR14]
Length=546

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFPHT+G PL  F   
Sbjct  4    SALQVERAVYQPKLPKALQGA-VKVQEGAPTQSVDDQ--EEIQKLFPHTYGMPLVEF---  57

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
               VP     TE   + VG++  G Q+PGGHN I GL+DA+K  NP + L GFL G  GL
Sbjct  58   ---VPGEH--TESKRLNVGVILSGGQAPGGHNVISGLFDAVKKLNPENQLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +EIT + L
Sbjct  113  VEHHYVEITKEFL  125



>ref|WP_023983193.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
oralis]
 gb|ETD21271.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
oralis CC98A]
Length=546

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I +LFP+T+G PL  F+  
Sbjct  4    SALQKARAAYQPKLPVALQGA-VKIKKGEPTRSVDNQ--EEIKKLFPNTYGMPLVEFVPG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
            + K            + VG++  G Q+PGGHN I GL+D +K  NP + L GFL G  GL
Sbjct  61   TEK--------NTTRMNVGVILSGGQAPGGHNVISGLFDGIKKLNPENKLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +EIT D L
Sbjct  113  VDHNYIEITADFL  125



>ref|WP_004370527.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oralis]
 gb|EFZ36229.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oralis ATCC 33269]
 gb|EPH19307.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
oralis HGA0225]
Length=546

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 75/133 (56%), Gaps = 11/133 (8%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I +LFP+T+G PL  F+  
Sbjct  4    SALQKARAAYQPKLPVALQGA-VKIKEGEPTRSVDNQ--EKIKKLFPNTYGMPLVEFVPG  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  443
            + K            + VG++  G Q+PGGHN I GL+D +K  NP + L GFL G  GL
Sbjct  61   TEK--------NTTRMNVGVILSGGQAPGGHNVISGLFDGIKKLNPENKLYGFLMGPGGL  112

Query  444  fAQKTLEITDDIL  482
                 +EIT D L
Sbjct  113  VDHNYIEITADFL  125



>ref|WP_022158214.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:520]
 emb|CDB04212.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:520]
Length=549

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 62/110 (56%), Gaps = 11/110 (10%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E+S LQ  R+ Y+P+LP  LQG    VE G+AT +        I  LFP+T+G P+  F 
Sbjct  2    EISALQIARAAYQPKLPKALQGPVKAVE-GEATQSV--GNQEEIKALFPNTYGMPVITF-  57

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
                   +A   TE PA  VG++  G Q+PGGHN I GL+D +K  NP +
Sbjct  58   -------EAGEKTEFPAFNVGVILSGGQAPGGHNVISGLFDGIKSLNPEN  100



>ref|XP_009386806.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=205

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  312  RVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  488
            RVG+VFCGRQSPGGHN IWGL+ ALK HNP  TLLGF+GG+EGLF +KTL+IT+DIL+T
Sbjct  5    RVGVVFCGRQSPGGHNVIWGLHSALKSHNPKGTLLGFVGGTEGLFVKKTLDITNDILST  63



>ref|WP_006798230.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
gadei]
 gb|EGK03145.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
gadei ATCC BAA-286]
Length=548

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 10/108 (9%)
 Frame = +3

Query  84   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  263
            S LQ  R+ Y+P++P  L G+ V++E G AT +   +    + +LFP+T+G P   F+ A
Sbjct  4    SALQVARAAYKPKMPKALYGS-VKIEEGAATQSV--ADQEEVKKLFPNTYGMPTLKFVEA  60

Query  264  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  407
            S K         +PAI VG++  G Q+PGGHN I GL+D +K  N  S
Sbjct  61   SEK-------ANYPAINVGVILSGGQAPGGHNVIAGLFDGIKNLNSGS  101



>ref|WP_022102965.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:5226]
 emb|CDA44849.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:5226]
Length=546

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 55/135 (41%), Positives = 77/135 (57%), Gaps = 10/135 (7%)
 Frame = +3

Query  78   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  257
            E S LQ  R+ Y+P+LP  L+G  V ++ G+ T +        I +LFP+T+G PL  F+
Sbjct  2    EKSALQIARAAYQPKLPAGLRGN-VSIKEGEPTQSVGDQ--EEIKKLFPNTYGMPLVEFV  58

Query  258  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  437
              + K        E+  + +GI+  G Q+PGGHN I GLYD LK  NP + L GFL G  
Sbjct  59   PTNEK-------KEYAPMNIGIILSGGQAPGGHNVICGLYDELKKQNPANKLYGFLMGPG  111

Query  438  glfAQKTLEITDDIL  482
            GL   K +E+TD I+
Sbjct  112  GLVDHKYIELTDAII  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960