BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016B24

Length=232
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601464.1|  PREDICTED: molybdopterin biosynthesis protei...  89.0    2e-18   Nicotiana tomentosiformis
ref|XP_004228477.1|  PREDICTED: molybdopterin biosynthesis protei...  89.0    2e-18   Solanum lycopersicum
ref|XP_009765762.1|  PREDICTED: molybdopterin biosynthesis protei...  87.8    4e-18   Nicotiana sylvestris
gb|KDO47645.1|  hypothetical protein CISIN_1g0059001mg                80.9    4e-17   Citrus sinensis [apfelsine]
ref|XP_007015554.1|  Molybdopterin biosynthesis CNX1 protein / mo...  84.7    5e-17   
ref|XP_007015551.1|  Molybdopterin biosynthesis CNX1 protein / mo...  84.7    5e-17   
ref|XP_007015553.1|  Molybdopterin biosynthesis CNX1 protein / mo...  84.7    6e-17   
ref|XP_006362730.1|  PREDICTED: molybdopterin biosynthesis protei...  84.7    6e-17   Solanum tuberosum [potatoes]
ref|XP_006362729.1|  PREDICTED: molybdopterin biosynthesis protei...  84.7    6e-17   
ref|XP_011090256.1|  PREDICTED: molybdopterin biosynthesis protei...  84.7    7e-17   Sesamum indicum [beniseed]
ref|XP_006470155.1|  PREDICTED: molybdopterin biosynthesis protei...  81.6    6e-16   Citrus sinensis [apfelsine]
gb|EYU35987.1|  hypothetical protein MIMGU_mgv1a002507mg              81.3    1e-15   Erythranthe guttata [common monkey flower]
gb|KJB55513.1|  hypothetical protein B456_009G080100                  81.3    1e-15   Gossypium raimondii
ref|XP_011043840.1|  PREDICTED: molybdopterin biosynthesis protei...  80.9    1e-15   Populus euphratica
ref|XP_011043834.1|  PREDICTED: molybdopterin biosynthesis protei...  80.9    1e-15   Populus euphratica
ref|XP_006446683.1|  hypothetical protein CICLE_v10014503mg           79.7    3e-15   Citrus clementina [clementine]
gb|KHG12135.1|  Molybdopterin biosynthesis CNX1 -like protein         79.7    4e-15   Gossypium arboreum [tree cotton]
ref|XP_010926610.1|  PREDICTED: molybdopterin biosynthesis protei...  78.2    1e-14   Elaeis guineensis
ref|XP_010926611.1|  PREDICTED: molybdopterin biosynthesis protei...  77.8    1e-14   
ref|XP_006379351.1|  hypothetical protein POPTR_0009s15810g           77.4    2e-14   
ref|XP_002312858.1|  hypothetical protein POPTR_0009s15810g           77.4    2e-14   
ref|XP_010093278.1|  Molybdopterin biosynthesis protein CNX1          75.9    7e-14   Morus notabilis
gb|KCW50986.1|  hypothetical protein EUGRSUZ_J00614                   74.7    1e-13   Eucalyptus grandis [rose gum]
ref|XP_010031621.1|  PREDICTED: molybdopterin biosynthesis protei...  74.7    2e-13   
ref|XP_010031620.1|  PREDICTED: molybdopterin biosynthesis protei...  74.7    2e-13   Eucalyptus grandis [rose gum]
ref|XP_007204973.1|  hypothetical protein PRUPE_ppa002426mg           73.9    3e-13   Prunus persica
emb|CDP15575.1|  unnamed protein product                              73.9    3e-13   Coffea canephora [robusta coffee]
ref|XP_008231326.1|  PREDICTED: molybdopterin biosynthesis protei...  73.9    4e-13   
ref|XP_008787719.1|  PREDICTED: molybdopterin biosynthesis protei...  73.9    4e-13   Phoenix dactylifera
ref|XP_002515854.1|  molybdopterin biosynthesis protein, putative     73.6    5e-13   Ricinus communis
ref|XP_006400671.1|  hypothetical protein EUTSA_v10012894mg           73.6    5e-13   Eutrema salsugineum [saltwater cress]
emb|CDX70956.1|  BnaC03g10400D                                        73.2    7e-13   
gb|EPS66354.1|  hypothetical protein M569_08423                       72.0    1e-12   Genlisea aurea
ref|XP_002874027.1|  hypothetical protein ARALYDRAFT_489011           72.4    1e-12   
ref|XP_010493217.1|  PREDICTED: molybdopterin biosynthesis protei...  72.4    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009131833.1|  PREDICTED: molybdopterin biosynthesis protei...  72.0    2e-12   Brassica rapa
emb|CAN73067.1|  hypothetical protein VITISV_034888                   68.6    2e-12   Vitis vinifera
ref|XP_010420950.1|  PREDICTED: molybdopterin biosynthesis protei...  71.6    2e-12   Camelina sativa [gold-of-pleasure]
gb|KGN66382.1|  hypothetical protein Csa_1G600220                     68.6    2e-12   Cucumis sativus [cucumbers]
ref|XP_009383824.1|  PREDICTED: molybdopterin biosynthesis protei...  70.9    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX88829.1|  BnaA03g08200D                                        70.9    4e-12   
ref|XP_006286370.1|  hypothetical protein CARUB_v10000376mg           70.5    5e-12   
ref|NP_197599.1|  molybdenum cofactor biosynthesis enzyme CNX1        70.5    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAA97413.1|  molybdenum cofactor biosynthesis enzyme               70.5    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26315.1|  hypothetical protein AALP_AA8G231600                  70.1    8e-12   Arabis alpina [alpine rockcress]
ref|XP_010685502.1|  PREDICTED: molybdopterin biosynthesis protei...  70.1    8e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN38452.1|  Molybdopterin biosynthesis protein CNX1               69.7    1e-11   Glycine soja [wild soybean]
ref|NP_001242529.1|  molybdopterin biosynthesis protein CNX1-like     69.7    1e-11   Glycine max [soybeans]
ref|XP_010240846.1|  PREDICTED: molybdopterin biosynthesis protei...  69.3    1e-11   Nelumbo nucifera [Indian lotus]
gb|KDP42916.1|  hypothetical protein JCGZ_23858                       68.9    2e-11   Jatropha curcas
ref|XP_008349828.1|  PREDICTED: molybdopterin biosynthesis protei...  68.2    3e-11   
ref|XP_004159365.1|  PREDICTED: LOW QUALITY PROTEIN: molybdopteri...  68.6    3e-11   
ref|XP_002276536.1|  PREDICTED: molybdopterin biosynthesis protei...  68.6    3e-11   Vitis vinifera
ref|XP_007141599.1|  hypothetical protein PHAVU_008G209600g           68.6    3e-11   Phaseolus vulgaris [French bean]
ref|XP_004144145.1|  PREDICTED: molybdopterin biosynthesis protei...  68.6    3e-11   
ref|XP_007141600.1|  hypothetical protein PHAVU_008G209600g           68.6    3e-11   Phaseolus vulgaris [French bean]
ref|XP_010454418.1|  PREDICTED: molybdopterin biosynthesis protei...  68.2    3e-11   Camelina sativa [gold-of-pleasure]
emb|CBI24388.3|  unnamed protein product                              68.2    4e-11   Vitis vinifera
ref|XP_009350884.1|  PREDICTED: molybdopterin biosynthesis protei...  67.8    4e-11   
gb|KEH28337.1|  molybdenum cofactor biosynthesis protein CNX1         67.4    5e-11   Medicago truncatula
gb|KEH28338.1|  molybdenum cofactor biosynthesis protein CNX1         67.4    6e-11   Medicago truncatula
ref|XP_003617060.1|  Molybdopterin biosynthesis CNX1 protein          67.4    6e-11   Medicago truncatula
ref|XP_008451034.1|  PREDICTED: molybdopterin biosynthesis protei...  67.4    7e-11   Cucumis melo [Oriental melon]
ref|XP_004291534.1|  PREDICTED: molybdopterin biosynthesis protei...  65.9    2e-10   Fragaria vesca subsp. vesca
ref|XP_001770478.1|  predicted protein                                62.8    3e-09   
gb|ABR17730.1|  unknown                                               61.2    8e-09   Picea sitchensis
ref|XP_006847466.1|  hypothetical protein AMTR_s00163p00018060        58.5    9e-08   Amborella trichopoda
ref|XP_002975554.1|  hypothetical protein SELMODRAFT_150666           57.4    2e-07   
ref|XP_002973522.1|  hypothetical protein SELMODRAFT_149120           57.0    3e-07   
gb|EWM26002.1|  molybdopterin biosynthesis protein cnx1               51.2    4e-06   Nannochloropsis gaditana
ref|XP_001698334.1|  molybdenum cofactor biosynthesis protein         51.6    2e-05   Chlamydomonas reinhardtii
ref|XP_009051622.1|  hypothetical protein LOTGIDRAFT_104386           49.7    5e-05   Lottia gigantea
ref|WP_008433293.1|  molybdopterin biosynthesis protein               49.7    5e-05   Rhodanobacter thiooxydans
ref|XP_002950060.1|  hypothetical protein VOLCADRAFT_90518            50.1    6e-05   Volvox carteri f. nagariensis
gb|ABC42492.1|  molybdenum cofactor biosynthesis protein Cnx1E        49.7    6e-05   Chlamydomonas reinhardtii
gb|ACM06338.1|  putative molybdopterin biosynthesis protein           48.1    2e-04   Thermomicrobium roseum DSM 5159
ref|XP_009820960.1|  hypothetical protein, variant 3                  48.1    2e-04   Aphanomyces astaci
ref|XP_009820959.1|  hypothetical protein, variant 2                  48.1    2e-04   Aphanomyces astaci
ref|XP_009820957.1|  hypothetical protein H257_00123                  48.1    3e-04   Aphanomyces astaci
ref|XP_011443432.1|  PREDICTED: gephyrin-like isoform X2              47.8    3e-04   Crassostrea gigas
gb|EKC33936.1|  Gephyrin                                              47.8    3e-04   Crassostrea gigas
ref|WP_041571812.1|  hypothetical protein                             47.0    5e-04   
ref|XP_002500333.1|  molybdenum cofactor biosynthesis protein CNX1E   47.0    6e-04   Micromonas commoda
ref|WP_022909178.1|  molybdopterin biosynthesis protein MoeA          46.6    7e-04   
ref|XP_005646314.1|  molybdopterin biosynthesis protein               46.2    9e-04   Coccomyxa subellipsoidea C-169



>ref|XP_009601464.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
tomentosiformis]
Length=667

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +2

Query  56   MSENGEAPIS-KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M ENG   IS KM+   EAL+IVLSVAQRLPPV++P+H+ALG++LAEDITAPDPLPPYP
Sbjct  1    MGENGGTQISNKMIPVEEALDIVLSVAQRLPPVALPIHEALGKILAEDITAPDPLPPYP  59



>ref|XP_004228477.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Solanum lycopersicum]
Length=670

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 4/62 (6%)
 Frame = +2

Query  56   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  223
            M ENG   IS    KM++  EALEIVL+VAQRLPPV++P+H+ LG+VLAEDITAPDPLPP
Sbjct  1    MGENGGTQISTNTNKMITVEEALEIVLNVAQRLPPVTLPIHEVLGKVLAEDITAPDPLPP  60

Query  224  YP  229
            YP
Sbjct  61   YP  62



>ref|XP_009765762.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nicotiana 
sylvestris]
Length=667

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +2

Query  56   MSENGEAPIS-KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M ENG   IS KM+   EAL++VLSVAQRLPPV++P+H+ALG++LAEDITAPDPLPPYP
Sbjct  1    MGENGGTQISNKMIPVEEALDMVLSVAQRLPPVTLPIHEALGKILAEDITAPDPLPPYP  59



>gb|KDO47645.1| hypothetical protein CISIN_1g0059001mg, partial [Citrus sinensis]
 gb|KDO47646.1| hypothetical protein CISIN_1g0059001mg, partial [Citrus sinensis]
Length=152

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            KM+S+ EAL+ VLSVAQRLPPV+VPL++ALG+VLAEDI APDPLPPYP
Sbjct  15   KMISAEEALQKVLSVAQRLPPVTVPLYEALGKVLAEDIRAPDPLPPYP  62



>ref|XP_007015554.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
 gb|EOY33173.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 4, partial [Theobroma 
cacao]
Length=607

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            KM+S++EAL+IVLSVA++LPPV+VPLHQALG+VLA+DI APDPLPPYP
Sbjct  10   KMISADEALQIVLSVAKQLPPVTVPLHQALGKVLAQDIRAPDPLPPYP  57



>ref|XP_007015551.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 ref|XP_007015552.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33170.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
 gb|EOY33171.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 1 [Theobroma cacao]
Length=676

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 4/62 (6%)
 Frame = +2

Query  56   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  223
            M+E+G         KM+S++EAL+IVLSVA++LPPV+VPLHQALG+VLA+DI APDPLPP
Sbjct  1    MAESGCVTCGSTDRKMISADEALQIVLSVAKQLPPVTVPLHQALGKVLAQDIRAPDPLPP  60

Query  224  YP  229
            YP
Sbjct  61   YP  62



>ref|XP_007015553.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
 gb|EOY33172.1| Molybdopterin biosynthesis CNX1 protein / molybdenum cofactor 
biosynthesis enzyme CNX1 (CNX1) isoform 3 [Theobroma cacao]
Length=630

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 4/62 (6%)
 Frame = +2

Query  56   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  223
            M+E+G         KM+S++EAL+IVLSVA++LPPV+VPLHQALG+VLA+DI APDPLPP
Sbjct  1    MAESGCVTCGSTDRKMISADEALQIVLSVAKQLPPVTVPLHQALGKVLAQDIRAPDPLPP  60

Query  224  YP  229
            YP
Sbjct  61   YP  62



>ref|XP_006362730.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X2 [Solanum tuberosum]
Length=670

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 4/62 (6%)
 Frame = +2

Query  56   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  223
            M E G   IS    KM++  EALEIVL+VAQRLPPVS+P+H+  G+VLAEDITAPDPLPP
Sbjct  1    MGEKGGTQISTNTNKMITVEEALEIVLNVAQRLPPVSLPIHEVSGKVLAEDITAPDPLPP  60

Query  224  YP  229
            YP
Sbjct  61   YP  62



>ref|XP_006362729.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 4/62 (6%)
 Frame = +2

Query  56   MSENGEAPIS----KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPP  223
            M E G   IS    KM++  EALEIVL+VAQRLPPVS+P+H+  G+VLAEDITAPDPLPP
Sbjct  1    MGEKGGTQISTNTNKMITVEEALEIVLNVAQRLPPVSLPIHEVSGKVLAEDITAPDPLPP  60

Query  224  YP  229
            YP
Sbjct  61   YP  62



>ref|XP_011090256.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Sesamum indicum]
Length=660

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 2/54 (4%)
 Frame = +2

Query  68   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            GEA  SKMVS +EAL+ VL VAQRLPPV+VP+HQALG+VLA+D+ APDPLPPYP
Sbjct  2    GEA--SKMVSVDEALQTVLRVAQRLPPVTVPIHQALGKVLAQDVAAPDPLPPYP  53



>ref|XP_006470155.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Citrus 
sinensis]
Length=671

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            KM+S+ EAL+ VLSVAQRLPPV+VPL++ALG+VLAEDI APDPLPPYP
Sbjct  15   KMISAEEALQKVLSVAQRLPPVTVPLYEALGKVLAEDIRAPDPLPPYP  62



>gb|EYU35987.1| hypothetical protein MIMGU_mgv1a002507mg [Erythranthe guttata]
Length=665

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = +2

Query  68   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            GEA  SKMVS  EALEI+L  AQRLPPV+VPLH ALG++LA+D+ APDPLPPYP
Sbjct  2    GEA--SKMVSVEEALEILLKAAQRLPPVTVPLHVALGKILAQDVAAPDPLPPYP  53



>gb|KJB55513.1| hypothetical protein B456_009G080100 [Gossypium raimondii]
Length=657

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+  +EAL+IVLSVAQ+LPPV+VPLHQALG+VLA+DI APDPLPPYP
Sbjct  1    MIPVDEALQIVLSVAQKLPPVTVPLHQALGKVLAQDIVAPDPLPPYP  47



>ref|XP_011043840.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Populus euphratica]
Length=641

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S+ EAL+ +L VAQRLPPVSVPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MISAEEALQTILKVAQRLPPVSVPLHDALGKVLAEDIRAPDPLPPYP  47



>ref|XP_011043834.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Populus euphratica]
Length=653

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S+ EAL+ +L VAQRLPPVSVPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MISAEEALQTILKVAQRLPPVSVPLHDALGKVLAEDIRAPDPLPPYP  47



>ref|XP_006446683.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
 gb|ESR59923.1| hypothetical protein CICLE_v10014503mg [Citrus clementina]
Length=671

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            K++S+ EAL+ VLSVAQRLPPV+VPL++ALG+VLAEDI APDPLPPYP
Sbjct  15   KIISAEEALQKVLSVAQRLPPVTVPLYEALGKVLAEDIRAPDPLPPYP  62



>gb|KHG12135.1| Molybdopterin biosynthesis CNX1 -like protein [Gossypium arboreum]
Length=657

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+  +EAL+IVLSVAQ+LPP +VPLHQALG+VLA+DI APDPLPPYP
Sbjct  1    MIPVDEALQIVLSVAQKLPPATVPLHQALGKVLAQDIVAPDPLPPYP  47



>ref|XP_010926610.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Elaeis guineensis]
Length=671

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S+ EAL IVLSVA+RLPPV+VPLH+ALG VLAED+ APDPLPPY
Sbjct  14   MISAEEALRIVLSVAERLPPVTVPLHEALGLVLAEDVCAPDPLPPY  59



>ref|XP_010926611.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Elaeis guineensis]
Length=652

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S+ EAL IVLSVA+RLPPV+VPLH+ALG VLAED+ APDPLPPY
Sbjct  14   MISAEEALRIVLSVAERLPPVTVPLHEALGLVLAEDVCAPDPLPPY  59



>ref|XP_006379351.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|ERP57148.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=641

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S+ EAL+ +L VAQRL PVSVPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MISAEEALQTILKVAQRLLPVSVPLHDALGKVLAEDIRAPDPLPPYP  47



>ref|XP_002312858.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
 gb|EEE86813.1| hypothetical protein POPTR_0009s15810g [Populus trichocarpa]
Length=653

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S+ EAL+ +L VAQRL PVSVPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MISAEEALQTILKVAQRLLPVSVPLHDALGKVLAEDIRAPDPLPPYP  47



>ref|XP_010093278.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
 gb|EXB53803.1| Molybdopterin biosynthesis protein CNX1 [Morus notabilis]
Length=674

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            MVS +EAL +VL+VAQ LPPV+VPLH ALG VLAED+ APDPLPPYP
Sbjct  19   MVSVDEALRMVLAVAQGLPPVTVPLHNALGMVLAEDVRAPDPLPPYP  65



>gb|KCW50986.1| hypothetical protein EUGRSUZ_J00614 [Eucalyptus grandis]
Length=502

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +2

Query  56   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+EN     +K  ++   EAL IVL  A+RLPPV+VPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MAENAGTAAAKPALIPPEEALRIVLGAARRLPPVAVPLHDALGKVLAEDIRAPDPLPPYP  60



>ref|XP_010031621.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X2 
[Eucalyptus grandis]
Length=610

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +2

Query  56   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+EN     +K  ++   EAL IVL  A+RLPPV+VPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MAENAGTAAAKPALIPPEEALRIVLGAARRLPPVAVPLHDALGKVLAEDIRAPDPLPPYP  60



>ref|XP_010031620.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Eucalyptus grandis]
 gb|KCW50985.1| hypothetical protein EUGRSUZ_J00614 [Eucalyptus grandis]
Length=669

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +2

Query  56   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+EN     +K  ++   EAL IVL  A+RLPPV+VPLH ALG+VLAEDI APDPLPPYP
Sbjct  1    MAENAGTAAAKPALIPPEEALRIVLGAARRLPPVAVPLHDALGKVLAEDIRAPDPLPPYP  60



>ref|XP_007204973.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
 gb|EMJ06172.1| hypothetical protein PRUPE_ppa002426mg [Prunus persica]
Length=674

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++VS  EALE VL V QRLPPV+VPLH ALG+VLAEDI A DPLPPYP
Sbjct  18   EVVSVEEALETVLRVVQRLPPVTVPLHDALGKVLAEDIRARDPLPPYP  65



>emb|CDP15575.1| unnamed protein product [Coffea canephora]
Length=664

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S +EAL+IVLS +Q+LPP++VPL  ALG++LAEDI APDPLPPYP
Sbjct  1    MISVDEALQIVLSQSQKLPPITVPLKDALGKILAEDIHAPDPLPPYP  47



>ref|XP_008231326.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Prunus mume]
Length=640

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++VS  EALE VL V QRLPPV+VPLH ALG+VLAEDI A DPLPPYP
Sbjct  18   EVVSVEEALETVLRVVQRLPPVTVPLHDALGKVLAEDIRARDPLPPYP  65



>ref|XP_008787719.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Phoenix dactylifera]
Length=671

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S+ EAL IVLSVA+RLP V+VPLH+A G VLAED+ APDPLPPY
Sbjct  14   MISAEEALRIVLSVAERLPAVTVPLHEAFGLVLAEDVRAPDPLPPY  59



>ref|XP_002515854.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
 gb|EEF46523.1| molybdopterin biosynthesis protein, putative [Ricinus communis]
Length=668

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            S M+S  +AL  +L VAQRL P++VPLH A G+VLAEDI APDPLPPYP
Sbjct  12   STMISVEDALSTILKVAQRLQPITVPLHDAFGKVLAEDIRAPDPLPPYP  60



>ref|XP_006400671.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
 gb|ESQ42124.1| hypothetical protein EUTSA_v10012894mg [Eutrema salsugineum]
Length=669

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +2

Query  65   NGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
             GE   S+M+ + EAL IVLSV++RLPPV V L +ALG+VLAEDI APDPLPPYP
Sbjct  9    GGEGK-SEMIPTEEALRIVLSVSERLPPVVVSLQEALGKVLAEDIRAPDPLPPYP  62



>emb|CDX70956.1| BnaC03g10400D [Brassica napus]
Length=672

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            S+M+ + EAL IVLSV++RLPPV V L +ALG+VLAEDI APDPLPPYP
Sbjct  14   SEMIPTEEALRIVLSVSERLPPVVVSLQEALGKVLAEDIRAPDPLPPYP  62



>gb|EPS66354.1| hypothetical protein M569_08423, partial [Genlisea aurea]
Length=471

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S +EALE+VL VAQRLPPV+VPL QAL +VLA+D++A +PLPPYP
Sbjct  1    MISVDEALEVVLRVAQRLPPVTVPLDQALCKVLAQDVSADEPLPPYP  47



>ref|XP_002874027.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50286.1| hypothetical protein ARALYDRAFT_489011 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  65   NGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            +G    ++M+ + EAL IVL V++RLPPV V L++ALG+VLAEDI APDPLPPYP
Sbjct  9    SGGGGKTEMIPTEEALRIVLGVSKRLPPVIVSLYEALGKVLAEDIRAPDPLPPYP  63



>ref|XP_010493217.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=671

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++M+ + EAL IVL V++RLPPVSV L +ALG+VLAEDI APDPLPPYP
Sbjct  14   TEMIPTEEALRIVLGVSKRLPPVSVSLLEALGKVLAEDICAPDPLPPYP  62



>ref|XP_009131833.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Brassica 
rapa]
Length=672

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++M+ + EAL IVLSV++RLPPV V L +ALG+VLAEDI APDPLPPYP
Sbjct  14   TEMIPTEEALRIVLSVSERLPPVVVSLQEALGKVLAEDIRAPDPLPPYP  62



>emb|CAN73067.1| hypothetical protein VITISV_034888 [Vitis vinifera]
Length=146

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = +2

Query  56   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M E G      M+S  +AL+IV +V+Q+L PV VP+H+ALG+VLA+DI APDPLPP+P
Sbjct  1    MCEKG-----AMISVEDALQIVKTVSQQLSPVIVPIHEALGKVLAQDIHAPDPLPPFP  53



>ref|XP_010420950.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Camelina 
sativa]
Length=670

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++M+ + EAL IVL V++RLPPVSV L +ALG+VLAEDI APDPLPPYP
Sbjct  14   TEMIPTEEALRIVLGVSKRLPPVSVSLLEALGKVLAEDIRAPDPLPPYP  62



>gb|KGN66382.1| hypothetical protein Csa_1G600220 [Cucumis sativus]
Length=155

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  56   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+++     + M+SS+EAL+ VL VA+ LPP+ V LH A+G+VLA+DI A DPLPPYP
Sbjct  1    MADHSCVKSTAMISSDEALKTVLEVARCLPPIVVSLHDAMGKVLAQDIRASDPLPPYP  58



>ref|XP_009383824.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+  +EAL IVLSVA+RLPPV+VPLH+ALG +LAED+ A DPLPPY
Sbjct  1    MIPVDEALRIVLSVAERLPPVAVPLHEALGLILAEDVRAADPLPPY  46



>emb|CDX88829.1| BnaA03g08200D [Brassica napus]
Length=670

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            S+M+ + EAL+IVLSV++RL PV V L +ALG+VLAEDI APDPLPPYP
Sbjct  14   SEMIPTEEALKIVLSVSERLAPVVVSLQEALGKVLAEDIRAPDPLPPYP  62



>ref|XP_006286370.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
 gb|EOA19268.1| hypothetical protein CARUB_v10000376mg, partial [Capsella rubella]
Length=684

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  65   NGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
             GE   ++M+ + EAL IVL V+ RLPPV V L +ALG+VLAEDI APDPLPPYP
Sbjct  24   GGEGK-TEMIPTEEALRIVLGVSHRLPPVMVSLQEALGKVLAEDIRAPDPLPPYP  77



>ref|NP_197599.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
 sp|Q39054.2|CNX1_ARATH RecName: Full=Molybdopterin biosynthesis protein CNX1; AltName: 
Full=Molybdenum cofactor biosynthesis enzyme CNX1; Includes: 
RecName: Full=Molybdopterin molybdenumtransferase; Short=MPT 
Mo-transferase; AltName: Full=Domain E; Includes: RecName: 
Full=Molybdopterin adenylyltransferase; Short=MPT adenylyltransferase; 
AltName: Full=Domain G [Arabidopsis thaliana]
 gb|AED92917.1| molybdenum cofactor biosynthesis enzyme CNX1 [Arabidopsis thaliana]
Length=670

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++M+ + EAL IV  V++RLPPV V L++ALG+VLAEDI APDPLPPYP
Sbjct  14   TEMIPTEEALRIVFGVSKRLPPVIVSLYEALGKVLAEDIRAPDPLPPYP  62



>gb|AAA97413.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
 emb|CAB38312.1| molybdenum cofactor biosynthesis enzyme [Arabidopsis thaliana]
Length=670

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++M+ + EAL IV  V++RLPPV V L++ALG+VLAEDI APDPLPPYP
Sbjct  14   TEMIPTEEALRIVFGVSKRLPPVIVSLYEALGKVLAEDIRAPDPLPPYP  62



>gb|KFK26315.1| hypothetical protein AALP_AA8G231600 [Arabis alpina]
Length=670

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  80   ISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            +++M+ + EAL IVL  ++RL PV V LH+ALG+VLAEDI APDPLPPYP
Sbjct  14   MTEMIPTEEALRIVLGASERLSPVVVSLHEALGKVLAEDIRAPDPLPPYP  63



>ref|XP_010685502.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Beta vulgaris 
subsp. vulgaris]
Length=649

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S +EAL+I+L VAQRL  V+VP+H+A G+ LA+DI APDPLPPYP
Sbjct  1    MISVDEALKIILEVAQRLEEVTVPIHEAQGKTLAQDIHAPDPLPPYP  47



>gb|KHN38452.1| Molybdopterin biosynthesis protein CNX1 [Glycine soja]
Length=652

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S  +AL+ VL+ ++RLPP++VPLH ALG+VLA+D+ APDPLPPYP
Sbjct  1    MISVIDALQTVLNASKRLPPLTVPLHDALGKVLAQDVRAPDPLPPYP  47



>ref|NP_001242529.1| molybdopterin biosynthesis protein CNX1-like [Glycine max]
 gb|AEO14873.1| rfls1 protein [Glycine max]
Length=652

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S  +AL+ VL+ ++RLPP++VPLH ALG+VLA+D+ APDPLPPYP
Sbjct  1    MISVIDALQTVLNASKRLPPLTVPLHDALGKVLAQDVRAPDPLPPYP  47



>ref|XP_010240846.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Nelumbo nucifera]
Length=587

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            S M+S   AL IVLS+AQRL  V++PLH  LG+VLAEDI APDPLPPY
Sbjct  21   STMLSMENALRIVLSIAQRLQTVTLPLHDTLGKVLAEDIRAPDPLPPY  68



>gb|KDP42916.1| hypothetical protein JCGZ_23858 [Jatropha curcas]
Length=674

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S+ EAL+ VL VAQ+L P++V LH ALG+VLAEDI APDPLPPY
Sbjct  19   MISAVEALQTVLKVAQQLRPITVSLHDALGKVLAEDIRAPDPLPPY  64



>ref|XP_008349828.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Malus 
domestica]
Length=507

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
              ++S  +ALE VL V QRLPPV+VPLH A G+VLAEDI A +PLPPYP
Sbjct  12   GTVISXEDALETVLRVVQRLPPVTVPLHDAAGKVLAEDIRAREPLPPYP  60



>ref|XP_004159365.1| PREDICTED: LOW QUALITY PROTEIN: molybdopterin biosynthesis protein 
CNX1-like [Cucumis sativus]
Length=662

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  68   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            G +  + M+SS+EAL+ VL VA+ LPP+ V LH A+G+VLA+DI A DPLPPYP
Sbjct  6    GNSMSTAMISSDEALKTVLEVARCLPPIVVSLHDAMGKVLAQDIRASDPLPPYP  59



>ref|XP_002276536.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
 ref|XP_010651618.1| PREDICTED: molybdopterin biosynthesis protein CNX1 isoform X1 
[Vitis vinifera]
Length=658

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = +2

Query  56   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M E G      M+S  +AL+IV +V+Q+L PV VP+H+ALG+VLA+DI APDPLPP+P
Sbjct  1    MCEKG-----AMISVEDALQIVKTVSQQLSPVIVPIHEALGKVLAQDIHAPDPLPPFP  53



>ref|XP_007141599.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13593.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=650

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S   A++ +L+V++RLPP++VPLH ALG+VLA+D+ APDPLPPY
Sbjct  1    MISVTHAIQTILNVSKRLPPLTVPLHDALGKVLAQDVRAPDPLPPY  46



>ref|XP_004144145.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Cucumis 
sativus]
Length=662

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  68   GEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            G +  + M+SS+EAL+ VL VA+ LPP+ V LH A+G+VLA+DI A DPLPPYP
Sbjct  6    GNSMSTAMISSDEALKTVLEVARCLPPIVVSLHDAMGKVLAQDIRASDPLPPYP  59



>ref|XP_007141600.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
 gb|ESW13594.1| hypothetical protein PHAVU_008G209600g [Phaseolus vulgaris]
Length=669

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S   A++ +L+V++RLPP++VPLH ALG+VLA+D+ APDPLPPY
Sbjct  1    MISVTHAIQTILNVSKRLPPLTVPLHDALGKVLAQDVRAPDPLPPY  46



>ref|XP_010454418.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like [Camelina 
sativa]
Length=666

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++M+ + EAL IVL V +RL PVSV L +ALG+VLAEDI APDPLPPYP
Sbjct  14   TEMIPTEEALRIVLGVTKRLSPVSVSLPEALGKVLAEDIRAPDPLPPYP  62



>emb|CBI24388.3| unnamed protein product [Vitis vinifera]
Length=652

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S  +AL+IV +V+Q+L PV VP+H+ALG+VLA+DI APDPLPP+P
Sbjct  1    MISVEDALQIVKTVSQQLSPVIVPIHEALGKVLAQDIHAPDPLPPFP  47



>ref|XP_009350884.1| PREDICTED: molybdopterin biosynthesis protein CNX1-like, partial 
[Pyrus x bretschneideri]
Length=588

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +2

Query  56   MSENGEAPISK--MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M E      SK  ++S  +ALE VL V QRLPPV+VPLH A G+VLAEDI A +PLPPYP
Sbjct  1    MGETAREDSSKGTVISVEDALETVLRVVQRLPPVTVPLHDAAGKVLAEDIRAREPLPPYP  60



>gb|KEH28337.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=475

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S   ALE VL+ A+RLPP+SV LH+ALG+VLA+++ A DPLPPYP
Sbjct  1    MISVTHALETVLNAAKRLPPISVSLHEALGKVLAQNVHAVDPLPPYP  47



>gb|KEH28338.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=582

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S   ALE VL+ A+RLPP+SV LH+ALG+VLA+++ A DPLPPYP
Sbjct  1    MISVTHALETVLNAAKRLPPISVSLHEALGKVLAQNVHAVDPLPPYP  47



>ref|XP_003617060.1| Molybdopterin biosynthesis CNX1 protein [Medicago truncatula]
 gb|AET00019.1| molybdenum cofactor biosynthesis protein CNX1 [Medicago truncatula]
Length=653

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S   ALE VL+ A+RLPP+SV LH+ALG+VLA+++ A DPLPPYP
Sbjct  1    MISVTHALETVLNAAKRLPPISVSLHEALGKVLAQNVHAVDPLPPYP  47



>ref|XP_008451034.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Cucumis melo]
Length=661

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  56   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+++     + M+S +EAL+ VL VAQ LPP+ V LH A+G+VLA+DI A DPLPPYP
Sbjct  1    MADHSCVKSTAMISPDEALKTVLEVAQCLPPIVVSLHDAIGKVLAQDIRASDPLPPYP  58



>ref|XP_004291534.1| PREDICTED: molybdopterin biosynthesis protein CNX1 [Fragaria 
vesca subsp. vesca]
Length=666

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +2

Query  56   MSENGEAPISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M++    PI  ++S+ EAL+IVL V Q+LP V+VPLH ALG+VLAEDI A +P P +P
Sbjct  1    MTDGSTKPI--LLSAEEALQIVLKVVQKLPHVTVPLHDALGKVLAEDIRAGEPFPAFP  56



>ref|XP_001770478.1| predicted protein [Physcomitrella patens]
 gb|EDQ64647.1| predicted protein [Physcomitrella patens]
Length=677

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            +V+  +A  I+LSVA+RL PV+VPL++A G  LAEDITAP+P+PP+P
Sbjct  13   LVTVQQATNIILSVAKRLSPVTVPLYEASGATLAEDITAPEPIPPFP  59



>gb|ABR17730.1| unknown [Picea sitchensis]
Length=677

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   APISKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
             P S M+S  +A  IVLS+ + L PV+V LH+ALG +LA D+ APDPLPPYP
Sbjct  14   CPPSTMLSVEDATHIVLSITKCLEPVTVQLHEALGLILAMDLHAPDPLPPYP  65



>ref|XP_006847466.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
 gb|ERN09047.1| hypothetical protein AMTR_s00163p00018060 [Amborella trichopoda]
Length=675

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S  +A  IVLS AQ L P++VPL +ALG +LAEDI APDPLPP+
Sbjct  17   MLSIEDATHIVLSRAQGLEPITVPLPEALGLILAEDIKAPDPLPPF  62



>ref|XP_002975554.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
 gb|EFJ23183.1| hypothetical protein SELMODRAFT_150666 [Selaginella moellendorffii]
Length=641

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            MVS  EA+ + LSVA R  PV + L QALG VLAED+ A DPLPPYP
Sbjct  1    MVSVAEAVSLALSVAARREPVEIELLQALGLVLAEDLQASDPLPPYP  47



>ref|XP_002973522.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
 gb|EFJ25182.1| hypothetical protein SELMODRAFT_149120 [Selaginella moellendorffii]
Length=641

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            MVS  EA+ + LSVA R  PV + L QALG +LAED+ A DPLPPYP
Sbjct  1    MVSVAEAVSLALSVAARREPVEIELLQALGLILAEDLQASDPLPPYP  47



>gb|EWM26002.1| molybdopterin biosynthesis protein cnx1 [Nannochloropsis gaditana]
Length=163

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            MVS ++AL +VL       P+ V L +ALG VLA+DITAP+PLPP+P
Sbjct  29   MVSVDDALTMVLQQTPTSAPMQVSLQEALGCVLADDITAPEPLPPFP  75



>ref|XP_001698334.1| molybdenum cofactor biosynthesis protein [Chlamydomonas reinhardtii]
 gb|EDP07827.1| molybdopterin biosynthesis protein [Chlamydomonas reinhardtii]
Length=446

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            KM+S  EA +IVLS  + L  V+V L  ALGRVLAE++ APD LPP+P
Sbjct  7    KMISIPEAQDIVLSHTRPLGAVTVGLAGALGRVLAEEVRAPDSLPPFP  54



>ref|XP_009051622.1| hypothetical protein LOTGIDRAFT_104386, partial [Lottia gigantea]
 gb|ESO97774.1| hypothetical protein LOTGIDRAFT_104386, partial [Lottia gigantea]
Length=421

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            ++S  EAL+IVL  +Q +   SV + +ALGR LAEDI A D LPP+P
Sbjct  7    LISVTEALKIVLEHSQIMKTESVSITEALGRYLAEDIFAKDALPPFP  53



>ref|WP_008433293.1| molybdopterin biosynthesis protein [Rhodanobacter thiooxydans]
 gb|EIM02908.1| molybdopterin biosynthesis [Rhodanobacter thiooxydans LCS2]
Length=417

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M++ +EAL ++L+ A+RLP  S PL QALGR+LA  +++P  LPP+
Sbjct  1    MIAYHEALALILARARRLPERSCPLEQALGRLLARPVSSPAELPPF  46



>ref|XP_002950060.1| hypothetical protein VOLCADRAFT_90518 [Volvox carteri f. nagariensis]
 gb|EFJ48728.1| hypothetical protein VOLCADRAFT_90518 [Volvox carteri f. nagariensis]
Length=488

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S  EA +IVLS    L  V+V L  ALGRVLAED+ APD LPP+P
Sbjct  1    MISIPEAQDIVLSHTLPLGAVTVHLSDALGRVLAEDVHAPDSLPPFP  47



>gb|ABC42492.1| molybdenum cofactor biosynthesis protein Cnx1E [Chlamydomonas 
reinhardtii]
Length=450

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S  EA +IVLS  + L  V+V L  ALGRVLAE++ APD LPP+P
Sbjct  1    MISIPEAQDIVLSHTRPLGAVTVGLAGALGRVLAEEVRAPDSLPPFP  47



>gb|ACM06338.1| putative molybdopterin biosynthesis protein [Thermomicrobium 
roseum DSM 5159]
Length=408

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            S+M++  EAL+I+L+  QRLP   V L  A GRVLAE + AP+  PP+P
Sbjct  5    SRMLTPQEALDIILAHVQRLPSEEVGLMDAAGRVLAEPLYAPEDHPPFP  53



>ref|XP_009820960.1| hypothetical protein, variant 3 [Aphanomyces astaci]
 gb|ETV88560.1| hypothetical protein, variant 3 [Aphanomyces astaci]
Length=443

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+   EA++ V+ +AQ L   SVPLH+ALG VLAE I + +PLPP+
Sbjct  19   MIPMKEAIDTVIRLAQPLLKTSVPLHEALGCVLAETIKSKEPLPPF  64



>ref|XP_009820959.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV88559.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=509

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+   EA++ V+ +AQ L   SVPLH+ALG VLAE I + +PLPP+
Sbjct  19   MIPMKEAIDTVIRLAQPLLKTSVPLHEALGCVLAETIKSKEPLPPF  64



>ref|XP_009820957.1| hypothetical protein H257_00123 [Aphanomyces astaci]
 gb|ETV88557.1| hypothetical protein H257_00123 [Aphanomyces astaci]
Length=631

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+   EA++ V+ +AQ L   SVPLH+ALG VLAE I + +PLPP+
Sbjct  19   MIPMKEAIDTVIRLAQPLLKTSVPLHEALGCVLAETIKSKEPLPPF  64



>ref|XP_011443432.1| PREDICTED: gephyrin-like isoform X2 [Crassostrea gigas]
Length=689

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S +EAL IVL  AQ L    + L + L R LA+D+ A DPLPP+P
Sbjct  279  MISVDEALRIVLEHAQPLGAEEIGLRECLCRFLADDVHAIDPLPPFP  325



>gb|EKC33936.1| Gephyrin [Crassostrea gigas]
Length=521

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            M+S +EAL IVL  AQ L    + L + L R LA+D+ A DPLPP+P
Sbjct  42   MISVDEALRIVLEHAQPLGAEEIGLRECLCRFLADDVHAIDPLPPFP  88



>ref|WP_041571812.1| hypothetical protein [Wolinella succinogenes]
Length=413

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = +2

Query  80   ISKMVSSNEALEIVLSVAQRLPPV-SVPLHQALGRVLAEDITAPDPLPPYP  229
            + + VS  EALEI+ S   RL     + LH ALGRVLA DI AP  +PP+P
Sbjct  1    MKRGVSYEEALEILSSSGVRLKGEEKLFLHDALGRVLARDIIAPSDMPPFP  51



>ref|XP_002500333.1| molybdenum cofactor biosynthesis protein CNX1E [Micromonas sp. 
RCC299]
 gb|ACO61591.1| molybdenum cofactor biosynthesis protein CNX1E [Micromonas sp. 
RCC299]
Length=438

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  89   MVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            M+S NEA++ V+S A  LP  SV    A+GRV+AED  AP P PP+
Sbjct  1    MISMNEAVDRVISRAHPLPQESVAFVDAVGRVVAEDFVAPRPHPPF  46



>ref|WP_022909178.1| molybdopterin biosynthesis protein MoeA [Aestuariimicrobium kwangyangense]
Length=420

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  83   SKMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPY  226
            S ++S  + LE VL++ QRLPP   P+ + LGRVLA+D++A   +PP+
Sbjct  3    SPLLSVEDHLEQVLALGQRLPPQWCPIDEGLGRVLADDVSARVAVPPF  50



>ref|XP_005646314.1| molybdopterin biosynthesis protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21770.1| molybdopterin biosynthesis protein [Coccomyxa subellipsoidea 
C-169]
Length=436

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  86   KMVSSNEALEIVLSVAQRLPPVSVPLHQALGRVLAEDITAPDPLPPYP  229
            +MVS  EA + VL+  + LP +S+ L  A+G +L ED+ A +PLPP+P
Sbjct  3    RMVSIAEAQKTVLNAIEPLPSISLGLSDAVGHILGEDVIAREPLPPFP  50



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566855288900