BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF016B15

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008793237.1|  PREDICTED: 60S ribosomal protein L13a-4            190   2e-58   Phoenix dactylifera
ref|XP_010923627.1|  PREDICTED: 60S ribosomal protein L13a-2-like       191   2e-58   Elaeis guineensis
ref|XP_002268901.1|  PREDICTED: 60S ribosomal protein L13a-4            190   2e-58   Vitis vinifera
ref|XP_011073788.1|  PREDICTED: 60S ribosomal protein L13a-4            190   3e-58   Sesamum indicum [beniseed]
ref|XP_011091425.1|  PREDICTED: 60S ribosomal protein L13a-4-like       189   6e-58   Sesamum indicum [beniseed]
ref|XP_010920859.1|  PREDICTED: 60S ribosomal protein L13a-4-like       189   6e-58   Elaeis guineensis
ref|XP_010937848.1|  PREDICTED: 60S ribosomal protein L13a-4            189   6e-58   Elaeis guineensis
ref|XP_008786013.1|  PREDICTED: 60S ribosomal protein L13a-4-like       189   6e-58   Phoenix dactylifera
gb|EYU31410.1|  hypothetical protein MIMGU_mgv1a013934mg                189   7e-58   Erythranthe guttata [common monkey flower]
gb|EYU32659.1|  hypothetical protein MIMGU_mgv1a013922mg                189   9e-58   Erythranthe guttata [common monkey flower]
ref|XP_009789164.1|  PREDICTED: 60S ribosomal protein L13a-1            188   1e-57   Nicotiana sylvestris
emb|CDP03876.1|  unnamed protein product                                188   1e-57   Coffea canephora [robusta coffee]
ref|XP_009625303.1|  PREDICTED: 60S ribosomal protein L13a-4-like       188   2e-57   Nicotiana tomentosiformis
gb|AIC33046.1|  60S ribosomal protein L13a                              186   2e-57   Panax ginseng [Asiatic ginseng]
ref|XP_009392721.1|  PREDICTED: 60S ribosomal protein L13a-4-like       188   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG08426.1|  60S ribosomal L13a-4 -like protein                      188   2e-57   Gossypium arboreum [tree cotton]
gb|EPS58218.1|  hypothetical protein M569_16597                         188   2e-57   Genlisea aurea
gb|KHG07795.1|  60S ribosomal L13a-4 -like protein                      187   2e-57   Gossypium arboreum [tree cotton]
ref|XP_003559332.1|  PREDICTED: 60S ribosomal protein L13a-4            187   2e-57   Brachypodium distachyon [annual false brome]
ref|XP_009404653.1|  PREDICTED: 60S ribosomal protein L13a-4-like       187   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421391.1|  PREDICTED: 60S ribosomal protein L13a-4            187   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011045655.1|  PREDICTED: 60S ribosomal protein L13a-2            187   2e-57   Populus euphratica
ref|XP_008805147.1|  PREDICTED: 60S ribosomal protein L13a-2-like       187   2e-57   Phoenix dactylifera
gb|KJB72096.1|  hypothetical protein B456_011G159000                    187   2e-57   Gossypium raimondii
gb|KHG26825.1|  60S ribosomal L13a-4 -like protein                      187   3e-57   Gossypium arboreum [tree cotton]
emb|CDY52083.1|  BnaCnng21840D                                          187   3e-57   Brassica napus [oilseed rape]
ref|XP_002267491.1|  PREDICTED: 60S ribosomal protein L13a-4            187   3e-57   Vitis vinifera
ref|XP_009102457.1|  PREDICTED: 60S ribosomal protein L13a-2-like       187   3e-57   Brassica rapa
gb|ACJ02350.1|  60S ribosomal protein L13A                              187   3e-57   Vernicia fordii [tung oil tree]
ref|XP_010279449.1|  PREDICTED: 60S ribosomal protein L13a-4-like       187   3e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009622553.1|  PREDICTED: 60S ribosomal protein L13a-4-like       187   3e-57   Nicotiana tomentosiformis
ref|XP_007223449.1|  hypothetical protein PRUPE_ppa011551mg             187   3e-57   Prunus persica
gb|KDO61166.1|  hypothetical protein CISIN_1g028623mg                   187   4e-57   Citrus sinensis [apfelsine]
ref|XP_006369799.1|  60S ribosomal protein L13a-2                       187   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006420899.1|  hypothetical protein CICLE_v10005900mg             187   4e-57   Citrus clementina [clementine]
ref|XP_002518107.1|  60S ribosomal protein L13a, putative               187   4e-57   Ricinus communis
ref|XP_010937601.1|  PREDICTED: 60S ribosomal protein L13a-2-like       187   4e-57   Elaeis guineensis
ref|XP_010023711.1|  PREDICTED: 60S ribosomal protein L13a-4-like       187   4e-57   Eucalyptus grandis [rose gum]
ref|XP_009403869.1|  PREDICTED: 60S ribosomal protein L13a-4-like       187   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007034382.1|  Ribosomal protein L13 family protein isoform 1     187   4e-57   
ref|XP_009112682.1|  PREDICTED: 60S ribosomal protein L13a-2-like       187   5e-57   Brassica rapa
gb|KJB72097.1|  hypothetical protein B456_011G159000                    185   6e-57   Gossypium raimondii
ref|XP_009795999.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   6e-57   Nicotiana sylvestris
ref|XP_006418685.1|  hypothetical protein EUTSA_v10002667mg             186   6e-57   Eutrema salsugineum [saltwater cress]
pdb|3J61|O  Chain O, Localization Of The Large Subunit Ribosomal ...    186   7e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010524687.1|  PREDICTED: 60S ribosomal protein L13a-1            186   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_008789105.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   9e-57   Phoenix dactylifera
ref|XP_006650608.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   9e-57   Oryza brachyantha
ref|XP_004252998.1|  PREDICTED: 60S ribosomal protein L13a-4            186   9e-57   Solanum lycopersicum
ref|XP_006349931.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   9e-57   Solanum tuberosum [potatoes]
ref|XP_006407868.1|  hypothetical protein EUTSA_v10021532mg             186   9e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010532891.1|  PREDICTED: 60S ribosomal protein L13a-2-like       186   9e-57   Tarenaya hassleriana [spider flower]
ref|XP_004154636.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    187   9e-57   
gb|ADR71263.1|  60S ribosomal protein L13aA                             186   9e-57   Hevea brasiliensis [jebe]
ref|XP_010277234.1|  PREDICTED: 60S ribosomal protein L13a-4            186   9e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006298567.1|  hypothetical protein CARUB_v10014649mg             186   9e-57   Capsella rubella
ref|NP_001275476.1|  60S ribosomal protein L13a-4-like                  186   1e-56   Solanum tuberosum [potatoes]
ref|XP_004239861.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   1e-56   Solanum lycopersicum
ref|XP_006855707.1|  hypothetical protein AMTR_s00044p00144180          185   1e-56   Amborella trichopoda
ref|XP_002323772.1|  ribosomal protein L13a                             186   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010552053.1|  PREDICTED: 60S ribosomal protein L13a-2-like       186   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_010547080.1|  PREDICTED: 60S ribosomal protein L13a-1            186   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_010245584.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010527234.1|  PREDICTED: 60S ribosomal protein L13a-2-like       186   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_004288082.1|  PREDICTED: 60S ribosomal protein L13a-4            186   1e-56   Fragaria vesca subsp. vesca
ref|XP_004297119.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   1e-56   Fragaria vesca subsp. vesca
ref|XP_006840139.1|  hypothetical protein AMTR_s00089p00040540          186   1e-56   Amborella trichopoda
gb|KDP39375.1|  hypothetical protein JCGZ_01132                         186   1e-56   Jatropha curcas
ref|XP_010439646.1|  PREDICTED: 60S ribosomal protein L13a-4            186   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009765513.1|  PREDICTED: 60S ribosomal protein L13a-4            186   2e-56   Nicotiana sylvestris
ref|XP_010482144.1|  PREDICTED: 60S ribosomal protein L13a-4-like       186   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010069656.1|  PREDICTED: 60S ribosomal protein L13a-2            186   2e-56   Eucalyptus grandis [rose gum]
ref|NP_001235102.1|  uncharacterized protein LOC100499978               185   2e-56   Glycine max [soybeans]
ref|XP_006281111.1|  hypothetical protein CARUB_v10027141mg             185   2e-56   Capsella rubella
gb|AAR89618.1|  60S ribosomal protein L13a                              186   2e-56   Capsicum annuum
ref|XP_002882511.1|  structural constituent of ribosome                 185   2e-56   
gb|AFK44939.1|  unknown                                                 185   2e-56   Lotus japonicus
ref|XP_004133995.1|  PREDICTED: 60S ribosomal protein L13a-2-like       185   2e-56   Cucumis sativus [cucumbers]
ref|XP_007223448.1|  hypothetical protein PRUPE_ppa011551mg             184   2e-56   
ref|XP_009596414.1|  PREDICTED: 60S ribosomal protein L13a-4            185   2e-56   Nicotiana tomentosiformis
ref|XP_004138959.1|  PREDICTED: 60S ribosomal protein L13a-4-like       185   2e-56   
ref|XP_009405822.1|  PREDICTED: 60S ribosomal protein L13a-4-like       185   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004154637.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    185   3e-56   
gb|ACG36118.1|  60S ribosomal protein L13a                              185   3e-56   Zea mays [maize]
gb|KJB30129.1|  hypothetical protein B456_005G130900                    185   3e-56   Gossypium raimondii
ref|XP_010464292.1|  PREDICTED: 60S ribosomal protein L13a-1-like       185   3e-56   Camelina sativa [gold-of-pleasure]
ref|NP_001281205.1|  60S ribosomal protein L13a                         185   3e-56   Zea mays [maize]
ref|XP_002466431.1|  hypothetical protein SORBIDRAFT_01g007690          185   3e-56   Sorghum bicolor [broomcorn]
ref|NP_001276138.1|  60S ribosomal protein L13a-4-like                  185   3e-56   
ref|XP_010448678.1|  PREDICTED: 60S ribosomal protein L13a-1            185   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004247847.1|  PREDICTED: 60S ribosomal protein L13a-4            185   3e-56   Solanum lycopersicum
ref|XP_009129745.1|  PREDICTED: 60S ribosomal protein L13a-4-like       184   3e-56   Brassica rapa
gb|KGN66498.1|  hypothetical protein Csa_1G615170                       184   3e-56   Cucumis sativus [cucumbers]
emb|CDY33947.1|  BnaA02g30400D                                          184   4e-56   Brassica napus [oilseed rape]
ref|XP_009111853.1|  PREDICTED: 60S ribosomal protein L13a-4            184   4e-56   Brassica rapa
ref|XP_009136093.1|  PREDICTED: 60S ribosomal protein L13a-2            184   4e-56   Brassica rapa
ref|XP_006395114.1|  hypothetical protein EUTSA_v10004924mg             184   4e-56   Eutrema salsugineum [saltwater cress]
ref|XP_007147486.1|  hypothetical protein PHAVU_006G128500g             184   5e-56   Phaseolus vulgaris [French bean]
ref|XP_002865669.1|  60S ribosomal protein L13A                         184   5e-56   
gb|KDO65930.1|  hypothetical protein CISIN_1g028649mg                   181   5e-56   Citrus sinensis [apfelsine]
ref|NP_199687.1|  60S ribosomal protein L13a-4                          184   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130808.1|  uncharacterized protein LOC100191912               184   7e-56   Zea mays [maize]
gb|ACF79169.1|  unknown                                                 184   7e-56   Zea mays [maize]
ref|XP_010069043.1|  PREDICTED: 60S ribosomal protein L13a-3            184   7e-56   Eucalyptus grandis [rose gum]
ref|XP_006479280.1|  PREDICTED: 60S ribosomal protein L13a-4-like       184   8e-56   Citrus sinensis [apfelsine]
gb|KFK39804.1|  hypothetical protein AALP_AA3G290300                    184   8e-56   Arabis alpina [alpine rockcress]
gb|EPS66587.1|  hypothetical protein M569_08187                         180   8e-56   Genlisea aurea
gb|ACG48503.1|  60S ribosomal protein L13a                              184   9e-56   Zea mays [maize]
ref|XP_008356990.1|  PREDICTED: 60S ribosomal protein L13a-4            183   9e-56   Malus domestica [apple tree]
ref|NP_001030654.1|  60S ribosomal protein L13a-1                       183   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041875.1|  PREDICTED: 60S ribosomal protein L13a-1-like       183   1e-55   Populus euphratica
gb|KJB10146.1|  hypothetical protein B456_001G186700                    183   1e-55   Gossypium raimondii
ref|XP_009374600.1|  PREDICTED: 60S ribosomal protein L13a-4            183   1e-55   Pyrus x bretschneideri [bai li]
gb|AHE13806.1|  ribosomal protein L13a                                  183   1e-55   Solanum torvum [berenjena cimarrona]
ref|XP_004981725.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    183   1e-55   Setaria italica
ref|NP_187367.1|  60S ribosomal protein L13a-1                          183   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440660.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    183   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004499225.1|  PREDICTED: 60S ribosomal protein L13a-4-like       183   1e-55   Cicer arietinum [garbanzo]
ref|XP_002521095.1|  60S ribosomal protein L13a, putative               183   1e-55   Ricinus communis
gb|ACJ83838.1|  unknown                                                 183   1e-55   Medicago truncatula
gb|KHF97469.1|  60S ribosomal L13a-4 -like protein                      183   1e-55   Gossypium arboreum [tree cotton]
gb|KHG16481.1|  60S ribosomal L13a-4 -like protein                      183   1e-55   Gossypium arboreum [tree cotton]
gb|KCW58066.1|  hypothetical protein EUGRSUZ_H00799                     184   1e-55   Eucalyptus grandis [rose gum]
ref|XP_007140600.1|  hypothetical protein PHAVU_008G125900g             183   1e-55   Phaseolus vulgaris [French bean]
ref|XP_010110069.1|  60S ribosomal protein L13a-3                       183   1e-55   Morus notabilis
sp|O65055.1|RL13A_PICMA  RecName: Full=60S ribosomal protein L13a       183   1e-55   Picea mariana [black spruce]
gb|KCW58067.1|  hypothetical protein EUGRSUZ_H00799                     182   1e-55   Eucalyptus grandis [rose gum]
ref|XP_008348430.1|  PREDICTED: 60S ribosomal protein L13a-4            183   2e-55   Malus domestica [apple tree]
ref|NP_001051314.1|  Os03g0756000                                       183   2e-55   
gb|ACN36734.1|  unknown                                                 182   2e-55   Zea mays [maize]
gb|KHG00254.1|  60S ribosomal L13a-4 -like protein                      183   2e-55   Gossypium arboreum [tree cotton]
gb|KJB42469.1|  hypothetical protein B456_007G154600                    183   2e-55   Gossypium raimondii
ref|XP_003546257.1|  PREDICTED: 60S ribosomal protein L13a-4-like       183   2e-55   Glycine max [soybeans]
ref|XP_003616742.1|  60S ribosomal protein L13A                         182   2e-55   Medicago truncatula
ref|XP_006586250.1|  PREDICTED: 60S ribosomal protein L13a-4-like       182   2e-55   Glycine max [soybeans]
gb|ABK22228.1|  unknown                                                 182   2e-55   Picea sitchensis
gb|KCW57253.1|  hypothetical protein EUGRSUZ_H00057                     181   3e-55   Eucalyptus grandis [rose gum]
ref|XP_009151676.1|  PREDICTED: 60S ribosomal protein L13a-4            182   3e-55   Brassica rapa
ref|XP_002863167.1|  predicted protein                                  182   3e-55   Arabidopsis lyrata subsp. lyrata
dbj|BAK07924.1|  predicted protein                                      184   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003589380.1|  60S ribosomal protein L13a                         182   3e-55   Medicago truncatula
gb|KFK38165.1|  hypothetical protein AALP_AA3G077500                    182   3e-55   Arabis alpina [alpine rockcress]
ref|XP_006298559.1|  hypothetical protein CARUB_v10014643mg             182   3e-55   Capsella rubella
ref|NP_001236202.1|  uncharacterized protein LOC100527190               182   3e-55   Glycine max [soybeans]
gb|KHN07182.1|  60S ribosomal protein L13a-1                            182   3e-55   Glycine soja [wild soybean]
gb|KFK39801.1|  hypothetical protein AALP_AA3G289800                    182   3e-55   Arabis alpina [alpine rockcress]
gb|AAL87341.1|  putative 60S ribosomal protein                          182   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189127.1|  60S ribosomal protein L13a-2                          182   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049776.1|  Ribosomal protein L13 family protein               182   5e-55   Theobroma cacao [chocolate]
gb|KDO65929.1|  hypothetical protein CISIN_1g028649mg                   181   5e-55   Citrus sinensis [apfelsine]
ref|XP_002439183.1|  hypothetical protein SORBIDRAFT_09g001930          181   5e-55   Sorghum bicolor [broomcorn]
ref|XP_010488596.1|  PREDICTED: 60S ribosomal protein L13a-2            181   6e-55   Camelina sativa [gold-of-pleasure]
gb|ACG33474.1|  60S ribosomal protein L13a                              181   6e-55   Zea mays [maize]
gb|AFK34830.1|  unknown                                                 181   6e-55   Medicago truncatula
ref|XP_010466918.1|  PREDICTED: 60S ribosomal protein L13a-2-like       181   6e-55   Camelina sativa [gold-of-pleasure]
gb|KJB22645.1|  hypothetical protein B456_004G058600                    180   6e-55   Gossypium raimondii
ref|XP_006284504.1|  hypothetical protein CARUB_v10005705mg             181   7e-55   
ref|XP_002883564.1|  60S ribosomal protein L13A                         181   1e-54   Arabidopsis lyrata subsp. lyrata
gb|ACG37566.1|  60S ribosomal protein L13a                              181   1e-54   Zea mays [maize]
ref|XP_010513787.1|  PREDICTED: 60S ribosomal protein L13a-2-like       181   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_011024678.1|  PREDICTED: 60S ribosomal protein L13a-4-like       181   1e-54   Populus euphratica
gb|KDP26388.1|  hypothetical protein JCGZ_17546                         180   1e-54   Jatropha curcas
ref|NP_193053.1|  60S ribosomal protein L13a-3                          180   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ38446.1|  hypothetical protein OsJ_22825                          180   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058724.1|  Os07g0109500                                       180   2e-54   
ref|XP_010228462.1|  PREDICTED: 60S ribosomal protein L13a-4-like       179   3e-54   Brachypodium distachyon [annual false brome]
gb|EMS52180.1|  60S ribosomal protein L13a-4                            179   4e-54   Triticum urartu
ref|XP_002301785.2|  ribosomal protein L13a                             179   4e-54   
gb|EMT05694.1|  60S ribosomal protein L13a-4                            180   5e-54   
gb|ABQ57364.1|  ribosomal protein L13A                                  179   7e-54   Lupinus luteus
gb|AFW67579.1|  hypothetical protein ZEAMMB73_211853                    176   8e-54   
ref|XP_001774253.1|  predicted protein                                  179   9e-54   
ref|XP_001765352.1|  predicted protein                                  178   9e-54   
ref|XP_001763759.1|  predicted protein                                  178   1e-53   
ref|XP_010107772.1|  60S ribosomal protein L13a-4                       179   2e-53   
ref|XP_006443602.1|  hypothetical protein CICLE_v10023466mg             182   3e-53   
ref|XP_006292546.1|  hypothetical protein CARUB_v10018781mg             174   4e-53   
ref|XP_001765905.1|  predicted protein                                  176   6e-53   
ref|XP_004981724.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    176   2e-52   
gb|KHN31417.1|  60S ribosomal protein L13a-4                            175   2e-52   Glycine soja [wild soybean]
ref|XP_001773626.1|  predicted protein                                  174   3e-52   
ref|XP_010435310.1|  PREDICTED: 60S ribosomal protein L13a-3-like       173   9e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006657401.1|  PREDICTED: 60S ribosomal protein L13a-3-like       172   2e-51   Oryza brachyantha
ref|XP_002964465.1|  hypothetical protein SELMODRAFT_166650             172   4e-51   Selaginella moellendorffii
ref|XP_007200528.1|  hypothetical protein PRUPE_ppa011553mg             171   7e-51   Prunus persica
ref|XP_010685006.1|  PREDICTED: 60S ribosomal protein L13a-2            171   8e-51   Beta vulgaris subsp. vulgaris [field beet]
sp|O49885.1|RL13A_LUPLU  RecName: Full=60S ribosomal protein L13a       168   1e-49   Lupinus luteus
ref|XP_008365936.1|  PREDICTED: 60S ribosomal protein L13a-1            166   7e-49   
ref|XP_008235481.1|  PREDICTED: 60S ribosomal protein L13a-1-like       166   9e-49   Prunus mume [ume]
ref|XP_008382629.1|  PREDICTED: 60S ribosomal protein L13a-1            164   1e-48   
ref|XP_009334926.1|  PREDICTED: 60S ribosomal protein L13a-1-like       163   7e-48   Pyrus x bretschneideri [bai li]
ref|XP_006387455.1|  hypothetical protein POPTR_1021s00200g             154   7e-46   
gb|AAP80748.1|  60S ribosomal protein                                   147   6e-43   Kandelia candel
ref|XP_001692909.1|  ribosomal protein L13a, component of cytosol...    139   1e-38   Chlamydomonas reinhardtii
ref|XP_002953387.1|  component of cytosolic 80S ribosome and 60S ...    138   2e-38   Volvox carteri f. nagariensis
emb|CDS32619.1|  ribosomal protein rpl13a                               139   3e-38   Hymenolepis microstoma
ref|XP_005643971.1|  ribosomal protein L13a component of cytosoli...    137   5e-38   Coccomyxa subellipsoidea C-169
gb|EUB62915.1|  60S ribosomal protein L13a                              137   8e-38   Echinococcus granulosus
ref|XP_004955326.1|  PREDICTED: 60S ribosomal protein L13a-3-like       135   4e-37   Setaria italica
ref|NP_001187674.1|  60S ribosomal protein l13a                         134   2e-36   Ictalurus punctatus
ref|XP_001630812.1|  predicted protein                                  132   5e-36   Nematostella vectensis
gb|ABW90393.1|  putative ribosomal protein L13a                         130   3e-35   Barentsia elongata
gb|AFX72999.1|  60S ribosomal protein L13a                              130   5e-35   Spirometra erinaceieuropaei
gb|EWM30220.1|  60s ribosomal protein l13a                              130   9e-35   Nannochloropsis gaditana
sp|P93099.1|RL13A_CYAPA  RecName: Full=60S ribosomal protein L13a       129   1e-34   Cyanophora paradoxa
emb|CCD82603.1|  putative 60s ribosomal protein L13a                    129   2e-34   Schistosoma mansoni
ref|XP_005849945.1|  hypothetical protein CHLNCDRAFT_17540              127   3e-34   Chlorella variabilis
gb|KGB33955.1|  60S ribosomal protein L13a                              127   5e-34   Schistosoma haematobium
ref|XP_009035047.1|  hypothetical protein AURANDRAFT_58864              127   7e-34   Aureococcus anophagefferens
gb|AAW27674.1|  SJCHGC04249 protein                                     126   2e-33   Schistosoma japonicum
gb|ABX44816.1|  putative 60S ribosomal protein RPL13A                   125   2e-33   Flustra foliacea
ref|XP_002436282.1|  ribosomal protein L13A, putative                   125   3e-33   Ixodes scapularis [blacklegged tick]
gb|ABZ04228.1|  ribosomal protein rpl13a                                125   4e-33   Lineus viridis
gb|KJB28243.1|  hypothetical protein B456_005G036700                    122   4e-33   Gossypium raimondii
gb|KJB28245.1|  hypothetical protein B456_005G036700                    122   4e-33   Gossypium raimondii
ref|XP_002112893.1|  expressed hypothetical protein                     125   5e-33   Trichoplax adhaerens
gb|ABW23219.1|  ribosomal protein rpl13a                                125   6e-33   Eurythoe complanata
gb|AIU94816.1|  40S ribosomal protein                                   124   9e-33   Phragmatopoma lapidosa
ref|XP_003384047.1|  PREDICTED: 60S ribosomal protein L13a-like         124   1e-32   Amphimedon queenslandica
emb|CCF75745.1|  unnamed protein product                                124   1e-32   
emb|CBN08625.1|  small nucleolar RNA, C/D box 32A                       124   1e-32   Microcosmus squamiger
ref|XP_004226142.1|  PREDICTED: 60S ribosomal protein L13a-like         124   1e-32   Ciona intestinalis [sea vase]
ref|XP_009174552.1|  hypothetical protein T265_10037                    125   2e-32   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_011397206.1|  60S ribosomal protein L13a-1                       123   2e-32   Auxenochlorella protothecoides
gb|ABX75375.1|  60S ribosomal protein L13A                              124   2e-32   Lycosa singoriensis
gb|ETB58080.1|  ribosomal protein L13, variant                          123   2e-32   Plasmodium yoelii 17X
emb|CDR14435.1|  60S ribosomal protein L13, putative                    123   3e-32   
emb|CDS48985.1|  60S ribosomal protein L13, putative                    123   3e-32   
gb|AGJ03561.1|  large subunit ribosomal protein 16                      123   3e-32   Pristionchus boliviae
ref|XP_728218.1|  ribosomal protein L13                                 122   3e-32   
gb|KIY96173.1|  60S ribosomal protein L13a-1                            119   4e-32   Monoraphidium neglectum
ref|XP_744909.1|  ribosomal protein L13                                 122   5e-32   
ref|XP_677215.1|  ribosomal protein L13                                 122   5e-32   
ref|XP_001614348.1|  60S ribosomal protein L13a                         122   5e-32   Plasmodium vivax
gb|KGG52418.1|  60S ribosomal protein L16                               122   5e-32   Mitosporidium daphniae
gb|AGJ03609.1|  large subunit ribosomal protein 16                      122   6e-32   Pristionchus maxplancki
ref|XP_626048.1|  60S ribosomal protein L13A                            122   6e-32   Cryptosporidium parvum Iowa II
gb|KFM61542.1|  60S ribosomal protein L13a                              122   7e-32   Stegodyphus mimosarum
ref|XP_003746303.1|  PREDICTED: 60S ribosomal protein L13a-like         122   7e-32   Galendromus occidentalis
gb|ETB58079.1|  ribosomal protein L13                                   122   7e-32   Plasmodium yoelii 17X
ref|XP_668473.1|  60S ribosomal protein L13a                            122   8e-32   Cryptosporidium hominis TU502
emb|CDO64471.1|  60S ribosomal protein L13, putative                    122   8e-32   Plasmodium reichenowi
ref|XP_002741044.1|  PREDICTED: 60S ribosomal protein L13a-like i...    122   8e-32   Saccoglossus kowalevskii
ref|XP_001347328.1|  60S ribosomal protein L13, putative                122   8e-32   Plasmodium falciparum 3D7
gb|ABR87187.1|  large subunit ribosomal protein 16                      122   9e-32   Pristionchus uniformis
gb|ABR87184.1|  large subunit ribosomal protein 16                      122   9e-32   Pristionchus maupasi
ref|XP_008623266.1|  50S ribosomal protein L13Ae                        122   1e-31   Plasmodium vinckei vinckei
ref|XP_004990512.1|  ribosomal protein L13Ae                            121   1e-31   Salpingoeca rosetta
emb|CDP94445.1|  Protein BM-RPL-16, isoform a                           122   1e-31   
ref|XP_002139370.1|  60S ribosomal protein L13a                         121   1e-31   Cryptosporidium muris RN66
gb|ADP21473.1|  ribosomal protein L13A                                  121   1e-31   Antheraea yamamai [Japanese oak silk moth]
gb|EWC88518.1|  ribosomal protein L13                                   121   1e-31   Plasmodium falciparum NF54
gb|ABR87191.1|  large subunit ribosomal protein 16                      121   1e-31   Pristionchus sp. 6 RS5101
gb|EWC76523.1|  ribosomal protein L13                                   121   1e-31   Plasmodium falciparum UGT5.1
ref|XP_002258669.1|  ribosomal protein l13                              121   1e-31   Plasmodium knowlesi strain H
gb|AFL56721.1|  large subunit ribosomal protein 16                      121   1e-31   Pristionchus arcanus
gb|ETW42600.1|  ribosomal protein L13                                   121   1e-31   Plasmodium falciparum NF135/5.C10
ref|XP_006824379.1|  PREDICTED: 60S ribosomal protein L13a-like i...    121   1e-31   Saccoglossus kowalevskii
ref|NP_001016486.1|  ribosomal protein L13a                             122   1e-31   Xenopus tropicalis [western clawed frog]
gb|ABR87198.1|  large subunit ribosomal protein 16                      121   1e-31   Pristionchus sp. 13 RS5231
gb|AHW80333.1|  ribosomal protein                                       121   1e-31   Pristionchus clavus
gb|ABR87193.1|  large subunit ribosomal protein 16                      121   1e-31   Pristionchus pauli
gb|ABR87196.1|  large subunit ribosomal protein 16                      121   2e-31   Pristionchus sp. 11 RS5228
gb|ABR87199.1|  large subunit ribosomal protein 16                      121   2e-31   Pristionchus sp. 14 RS5230
gb|ABR87188.1|  large subunit ribosomal protein 16                      121   2e-31   Pristionchus sp. 3 CZ3975
gb|AGR33956.1|  subunit ribosomal protein 16                            121   2e-31   Pristionchus fukushimae
emb|CDR95102.1|  ribosomal protein L13, putative                        121   2e-31   Babesia bigemina
emb|CBJ25662.1|  60S ribosomal protein L13a                             121   2e-31   Ectocarpus siliculosus
ref|XP_004221920.1|  60S ribosomal protein L13a                         121   2e-31   Plasmodium cynomolgi strain B
gb|AFL56697.1|  large subunit ribosomal protein 16                      121   2e-31   Pristionchus exspectatus
ref|XP_004011713.1|  PREDICTED: 60S ribosomal protein L13a-like         121   2e-31   Ovis aries [domestic sheep]
ref|XP_001609803.1|  ribosomal protein L13                              121   2e-31   Babesia bovis T2Bo
gb|ADC97465.1|  putative 60S ribosomal protein L13a                     121   2e-31   Amblyomma hebraeum [African tick bite fever vector]
gb|ADC97464.1|  putative 60S ribosomal protein L13a                     121   2e-31   Amblyomma maculatum
ref|NP_001080130.1|  ribosomal protein L13a                             121   2e-31   Xenopus laevis [clawed frog]
ref|XP_008816056.1|  50S ribosomal protein L13Ae                        121   3e-31   Plasmodium inui San Antonio 1
gb|AGH70161.1|  60S ribosomal protein L13a                              120   3e-31   Placozoa sp. H4
ref|XP_002507247.1|  predicted protein                                  120   3e-31   Micromonas commoda
sp|Q95307.2|RL13A_PIG  RecName: Full=60S ribosomal protein L13a         119   3e-31   Sus scrofa [pigs]
sp|Q962U0.1|RL13A_SPOFR  RecName: Full=60S ribosomal protein L13a       120   3e-31   
ref|XP_003143319.1|  60S ribosomal protein L13a                         120   3e-31   
ref|XP_004349662.1|  ribosomal protein L13, putative                    120   3e-31   
ref|XP_003054822.1|  predicted protein                                  120   3e-31   
gb|ABR87192.1|  large subunit ribosomal protein 16                      120   3e-31   
gb|AGA17991.1|  ribosomal protein L13A                                  120   3e-31   
gb|ACY95304.1|  ribosomal protein L13A                                  120   3e-31   
gb|AHA44488.1|  60S ribosomal-like protein                              120   3e-31   
gb|AGR33932.1|  subunit ribosomal protein 16                            120   3e-31   
ref|XP_001898103.1|  60S ribosomal protein L13a                         120   3e-31   
ref|XP_001119428.2|  PREDICTED: 60S ribosomal protein L13a-like         119   4e-31   
ref|XP_002776400.1|  60S ribosomal protein L13A, putative               120   4e-31   
ref|XP_007431701.1|  PREDICTED: 60S ribosomal protein L13a-like         120   4e-31   
dbj|BAE41520.1|  unnamed protein product                                119   4e-31   
gb|ACO14619.1|  60S ribosomal protein L13A                              120   4e-31   
ref|XP_002590758.1|  hypothetical protein BRAFLDRAFT_280074             120   4e-31   
ref|XP_002788485.1|  60S ribosomal protein L13A, putative               120   4e-31   
ref|XP_006014996.1|  PREDICTED: 60S ribosomal protein L13a-like         120   4e-31   
ref|XP_003226237.1|  PREDICTED: 60S ribosomal protein L13a              120   4e-31   
gb|ETE70282.1|  60S ribosomal protein L13a                              120   5e-31   
gb|EPZ33870.1|  60S ribosomal protein L13a                              120   5e-31   
ref|XP_001507007.1|  PREDICTED: 60S ribosomal protein L13a              120   5e-31   
ref|XP_006898790.1|  PREDICTED: 60S ribosomal protein L13a              121   5e-31   
gb|ABR87183.1|  large subunit ribosomal protein 16                      119   5e-31   
ref|XP_011287982.1|  PREDICTED: 60S ribosomal protein L13a              120   5e-31   
gb|EFO20746.2|  60S ribosomal protein L13a                              120   6e-31   
gb|AEE61742.1|  unknown                                                 120   6e-31   
dbj|BAG60190.1|  unnamed protein product                                118   6e-31   
ref|XP_005833834.1|  large subunit ribosomal protein L13Ae_2, cyt...    119   6e-31   
sp|P35427.2|RL13A_RAT  RecName: Full=60S ribosomal protein L13a         119   6e-31   
gb|EDL22803.1|  mCG23455, isoform CRA_b                                 118   7e-31   
ref|XP_004830849.1|  60S ribosomal protein L13, putative                119   7e-31   
ref|XP_004540518.1|  PREDICTED: 60S ribosomal protein L13a-like         119   7e-31   
ref|XP_008843288.1|  PREDICTED: 60S ribosomal protein L13a              119   7e-31   
ref|XP_006986315.1|  PREDICTED: 60S ribosomal protein L13a              119   7e-31   
ref|XP_005088148.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   7e-31   
gb|ABY28364.1|  ribosomal protein L13A                                  119   7e-31   
ref|XP_001363221.1|  PREDICTED: 60S ribosomal protein L13a              119   7e-31   
ref|XP_003453268.1|  PREDICTED: 60S ribosomal protein L13a-like         119   8e-31   
sp|Q8MUR4.1|RL13A_CHOPR  RecName: Full=60S ribosomal protein L13a       119   8e-31   
ref|XP_003369279.1|  60S ribosomal protein L13a                         119   8e-31   
gb|EHH30267.1|  hypothetical protein EGK_10889                          119   8e-31   
ref|XP_005336733.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   8e-31   
ref|XP_001093017.1|  PREDICTED: 60S ribosomal protein L13a-like         119   8e-31   
ref|XP_004710493.1|  PREDICTED: 60S ribosomal protein L13a              119   8e-31   
ref|XP_005336734.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   8e-31   
gb|EHB05652.1|  60S ribosomal protein L13a                              119   8e-31   
ref|XP_005412929.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   8e-31   
ref|XP_002762391.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   8e-31   
ref|XP_001491926.1|  PREDICTED: 60S ribosomal protein L13a              119   8e-31   
ref|NP_001182348.1|  ribosomal protein L13a                             119   8e-31   
ref|XP_003940403.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   8e-31   
ref|NP_036555.1|  60S ribosomal protein L13a isoform 1                  119   9e-31   
gb|EHH59787.1|  hypothetical protein EGM_09978                          119   9e-31   
ref|XP_002723961.2|  PREDICTED: 60S ribosomal protein L13a              119   9e-31   
ref|XP_008067417.1|  PREDICTED: 60S ribosomal protein L13a              119   9e-31   
sp|Q4R8Z2.3|RL13A_MACFA  RecName: Full=60S ribosomal protein L13a       119   9e-31   
gb|ELR49590.1|  60S ribosomal protein L13a                              119   9e-31   
ref|XP_006905092.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|NP_001230997.1|  ribosomal protein L13a isoform 1                   119   9e-31   
ref|XP_007244661.1|  PREDICTED: 60S ribosomal protein L13a-like         119   9e-31   
ref|XP_004694340.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
gb|EFB23940.1|  hypothetical protein PANDA_006273                       119   9e-31   
ref|XP_005589974.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|XP_006905093.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|NP_001125810.1|  60S ribosomal protein L13a                         119   9e-31   
gb|AAH04900.2|  RPL13A protein                                          119   9e-31   
ref|NP_001070466.1|  60S ribosomal protein L13a                         119   9e-31   
ref|XP_006173859.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|XP_004646507.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|XP_006160205.1|  PREDICTED: 60S ribosomal protein L13a              119   9e-31   
ref|NP_001230998.1|  ribosomal protein L13a isoform 2                   119   9e-31   
gb|AFM88003.1|  60S ribosomal protein L13a                              119   9e-31   
ref|XP_007463424.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|XP_006868260.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|XP_005879589.1|  PREDICTED: 60S ribosomal protein L13a              119   9e-31   
ref|XP_004767370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|XP_004597042.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   9e-31   
ref|XP_004440337.1|  PREDICTED: 60S ribosomal protein L13a isoform 1    119   9e-31   
ref|XP_003801534.1|  PREDICTED: 60S ribosomal protein L13a              119   9e-31   
ref|XP_005366879.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
dbj|BAD96467.1|  ribosomal protein L13a variant                         119   1e-30   
ref|XP_008152577.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   1e-30   
ref|XP_005777699.1|  hypothetical protein EMIHUDRAFT_414178             119   1e-30   
ref|XP_007941028.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   1e-30   
ref|NP_001291802.1|  ribosomal protein L13a                             119   1e-30   
ref|XP_008152578.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   1e-30   
ref|XP_004381707.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
ref|NP_775462.2|  60S ribosomal protein L13a                            119   1e-30   
ref|XP_006173860.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   1e-30   
gb|AAX92709.1|  60S ribosomal protein L13a                              118   1e-30   
ref|XP_004672300.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   1e-30   
ref|XP_004409938.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
ref|XP_010584802.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
ref|XP_004271087.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
ref|XP_008213727.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
ref|NP_033464.2|  60S ribosomal protein L13a                            119   1e-30   
gb|EDM07407.1|  rCG53885, isoform CRA_c                                 118   1e-30   
ref|XP_004472671.1|  PREDICTED: 60S ribosomal protein L13a isoform 2    119   1e-30   
gb|AEL28871.1|  ribosomal protein L13A                                  119   1e-30   
emb|CAA35908.1|  tum- transplantation antigen P198                      119   1e-30   
ref|XP_005955448.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   1e-30   
gb|ACO11694.1|  60S ribosomal protein L13A                              119   1e-30   
gb|ADT80691.1|  ribosomal protein L13A                                  119   1e-30   
ref|XP_007053692.1|  PREDICTED: 60S ribosomal protein L13a-like         120   1e-30   
ref|XP_004092948.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    119   1e-30   
gb|EPQ15989.1|  60S ribosomal protein L13a                              119   1e-30   
ref|XP_011494133.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
ref|XP_010639023.1|  PREDICTED: 60S ribosomal protein L13a              119   1e-30   
ref|XP_004440338.1|  PREDICTED: 60S ribosomal protein L13a isoform 2    118   1e-30   
gb|EHJ63396.1|  60S ribosomal protein L13a                              119   1e-30   
gb|EJW82447.1|  60S ribosomal protein L13a                              119   1e-30   
ref|XP_003962761.1|  PREDICTED: 60S ribosomal protein L13a-like         119   1e-30   
ref|XP_003465562.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   2e-30   
gb|ABS57429.1|  ribosomal protein L13a                                  118   2e-30   
ref|XP_003730751.1|  PREDICTED: 60S ribosomal protein L13a-like i...    118   2e-30   
ref|XP_784515.1|  PREDICTED: 60S ribosomal protein L13a-like isof...    118   2e-30   
ref|NP_001037156.1|  ribosomal protein L13A                             119   2e-30   
gb|ACD65121.1|  putative 60S ribosomal protein RPL13A                   116   2e-30   
dbj|BAM17692.1|  ribosomal protein L13A                                 118   2e-30   
ref|XP_007172851.1|  PREDICTED: 60S ribosomal protein L13a-like         119   2e-30   
ref|NP_001051312.2|  Os03g0755700                                       117   2e-30   
ref|XP_009692506.1|  60S ribosomal protein L13                          118   2e-30   
gb|AAK95140.1|  ribosomal protein L13a                                  118   2e-30   
gb|ACH85355.1|  ribosomal protein L13a                                  118   2e-30   
gb|ABR87189.1|  large subunit ribosomal protein 16                      118   2e-30   
emb|CDQ71669.1|  unnamed protein product                                118   2e-30   
gb|ACN10380.1|  60S ribosomal protein L13a                              118   2e-30   
emb|CDW89718.1|  60s ribosomal protein l16                              118   2e-30   
gb|ACH85339.1|  ribosomal protein L13a                                  118   2e-30   
ref|XP_004767369.1|  PREDICTED: 60S ribosomal protein L13a isofor...    118   2e-30   
gb|ACI67868.1|  60S ribosomal protein L13a                              118   2e-30   
ref|XP_010877924.1|  PREDICTED: 60S ribosomal protein L13a              118   2e-30   
ref|XP_004619892.1|  PREDICTED: 60S ribosomal protein L13a isofor...    118   2e-30   
ref|XP_005801332.1|  PREDICTED: 60S ribosomal protein L13a-like         118   2e-30   
ref|XP_007892973.1|  PREDICTED: 60S ribosomal protein L13a              118   2e-30   
gb|AFM86379.1|  60S ribosomal protein L13a                              118   2e-30   
gb|AFM90670.1|  60S ribosomal protein L13a                              118   2e-30   
gb|KDD76284.1|  hypothetical protein H632_c285p2                        118   3e-30   
ref|XP_008398128.1|  PREDICTED: 60S ribosomal protein L13a              118   3e-30   
gb|AFM86006.1|  60S ribosomal protein L13a                              118   3e-30   
ref|XP_003508699.2|  PREDICTED: 60S ribosomal protein L13a isofor...    119   3e-30   
gb|ELU00201.1|  hypothetical protein CAPTEDRAFT_220822                  118   3e-30   
emb|CEF99938.1|  Ribosomal protein L13, eukaryotic/archaeal             118   3e-30   
ref|XP_007574193.1|  PREDICTED: 60S ribosomal protein L13a              118   3e-30   
ref|XP_008573628.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   3e-30   
emb|CCQ18645.1|  60S ribosomal protein L13a                             118   3e-30   
gb|ACH48187.1|  60S ribosomal protein L13a                              118   3e-30   
gb|AFM87541.1|  60S ribosomal protein L13a                              118   3e-30   
ref|XP_005986102.1|  PREDICTED: 60S ribosomal protein L13a-like         118   3e-30   
ref|XP_006631346.1|  PREDICTED: 60S ribosomal protein L13a-like         118   3e-30   
emb|CAK04157.1|  ribosomal protein L13a                                 118   3e-30   
ref|XP_004625632.1|  PREDICTED: 60S ribosomal protein L13a-like         117   3e-30   
gb|AHW80309.1|  ribosomal protein                                       117   3e-30   
gb|ESA01198.1|  hypothetical protein GLOINDRAFT_334214                  117   3e-30   
gb|ABA46793.1|  60S ribosomal protein L13A                              117   3e-30   
gb|ABR87186.1|  large subunit ribosomal protein 16                      117   3e-30   
ref|XP_004082291.2|  PREDICTED: 60S ribosomal protein L13a              118   4e-30   
ref|XP_007372042.1|  60S large subunit ribosomal protein                117   4e-30   
ref|XP_010367772.1|  PREDICTED: 60S ribosomal protein L13a isofor...    118   4e-30   
ref|XP_001749344.1|  hypothetical protein                               117   4e-30   
gb|AGJ74543.1|  large subunit ribosomal protein 16                      117   4e-30   
dbj|BAM19053.1|  ribosomal protein L13A                                 117   4e-30   
gb|ACN09946.1|  60S ribosomal protein L13a                              117   4e-30   
gb|AFD18173.1|  ribosomal protein L13a                                  114   5e-30   
ref|XP_005001821.1|  PREDICTED: 60S ribosomal protein L13a isofor...    117   5e-30   
ref|XP_011299985.1|  PREDICTED: 60S ribosomal protein L13a              117   5e-30   
gb|ERG86236.1|  60s ribosomal protein l13a                              117   5e-30   
gb|EGT53309.1|  hypothetical protein CAEBREN_29425                      117   5e-30   
gb|ACQ57984.1|  60S ribosomal protein L13a                              117   5e-30   
ref|XP_002641489.1|  C. briggsae CBR-RPL-16 protein                     117   5e-30   
ref|XP_004624823.1|  PREDICTED: 60S ribosomal protein L13a-like         117   5e-30   
ref|XP_004579204.1|  PREDICTED: 60S ribosomal protein L13a-like         117   5e-30   
emb|CAH57701.1|  60S ribosomal protein L13A                             117   6e-30   
ref|XP_004640903.1|  PREDICTED: 60S ribosomal protein L13a-like         117   6e-30   
ref|XP_010367771.1|  PREDICTED: 60S ribosomal protein L13a isofor...    118   6e-30   
ref|XP_005589973.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   6e-30   
emb|CCI10404.1|  unnamed protein product                                117   6e-30   
ref|XP_003112992.1|  CRE-RPL-16 protein                                 117   6e-30   
gb|AGL33439.1|  60S ribosomal protein L13a                              117   7e-30   
gb|AFJ91722.1|  60S ribosomal protein L13                               117   7e-30   
ref|XP_007099205.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    117   7e-30   
ref|XP_007623352.1|  PREDICTED: 60S ribosomal protein L13a isofor...    119   7e-30   
dbj|BAF98661.1|  ribosomal protein L13a                                 117   7e-30   
gb|ACN09948.1|  60S ribosomal protein L13a                              118   8e-30   
gb|EPY89115.1|  60S ribosomal protein L13a                              119   8e-30   
gb|AAX81225.1|  ribosomal protein L13                                   116   8e-30   
ref|XP_974304.1|  PREDICTED: 60S ribosomal protein L13a                 117   9e-30   
ref|XP_009030839.1|  hypothetical protein HELRODRAFT_158058             116   9e-30   
gb|KIH68890.1|  ribosomal protein L13                                   117   9e-30   
ref|XP_007531370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    116   9e-30   
gb|AAQ13495.1|AF109186_1  FWP004                                        116   9e-30   
ref|XP_003280356.1|  PREDICTED: 60S ribosomal protein L13a-like i...    116   9e-30   
gb|ERE70104.1|  fms-related tyrosine kinase 3 ligand-like isoform 1     120   9e-30   
ref|XP_003881298.1|  hypothetical protein NCLIV_043330                  116   9e-30   
emb|CAJ17275.1|  ribosomal protein L13Ae                                113   1e-29   
ref|XP_008887895.1|  ribosomal protein RPL13A                           116   1e-29   
gb|ABR87185.1|  large subunit ribosomal protein 16                      116   1e-29   
gb|EJY82133.1|  Ribosomal protein L13                                   116   1e-29   
ref|XP_010733236.1|  PREDICTED: 60S ribosomal protein L13a              117   1e-29   
gb|EIE90993.1|  60S ribosomal protein L16                               116   1e-29   
gb|EIE79164.1|  60S ribosomal protein L16                               116   1e-29   
ref|XP_005586136.1|  PREDICTED: 60S ribosomal protein L13a-like         116   1e-29   
gb|KDR22610.1|  60S ribosomal protein L13a                              116   1e-29   
dbj|BAN20926.1|  ribosomal protein L13A                                 116   1e-29   
ref|XP_006677789.1|  hypothetical protein BATDEDRAFT_16384              116   1e-29   
ref|XP_006096329.1|  PREDICTED: 60S ribosomal protein L13a-like         116   1e-29   
emb|CAB46827.1|  Ribosomal protein                                      114   1e-29   
ref|XP_009523807.1|  hypothetical protein PHYSODRAFT_285558             114   1e-29   
gb|ABR87201.1|  large subunit ribosomal protein 16                      116   2e-29   
ref|XP_008890825.1|  ribosomal protein L13                              116   2e-29   
gb|AAR01666.1|  putative ribosomal protein L13a                         115   2e-29   
ref|XP_002908436.1|  60S ribosomal protein L13, putative                115   2e-29   
gb|KFH71578.1|  60S ribosomal protein L16-B                             115   2e-29   
gb|EMP41574.1|  60S ribosomal protein L13a                              119   2e-29   
gb|EIE78513.1|  60S ribosomal protein L16                               115   2e-29   
ref|XP_011344385.1|  PREDICTED: 60S ribosomal protein L13a              115   2e-29   
gb|ELK18535.1|  60S ribosomal protein L13a                              119   2e-29   
emb|CEG67074.1|  Putative 60S ribosomal protein L16                     115   2e-29   
emb|CEG78600.1|  Putative 60S ribosomal protein L16                     115   2e-29   
ref|XP_003489877.1|  PREDICTED: 60S ribosomal protein L13a-like         115   2e-29   



>ref|XP_008793237.1| PREDICTED: 60S ribosomal protein L13a-4 [Phoenix dactylifera]
Length=206

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_010923627.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=246

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  49   AAKMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  228
            AA+MVSGSGIC RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM
Sbjct  38   AAEMVSGSGICTRRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  97

Query  229  KYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            K+ RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  98   KFLRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  134



>ref|XP_002268901.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
 emb|CAN63603.1| hypothetical protein VITISV_006449 [Vitis vinifera]
Length=206

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_011073788.1| PREDICTED: 60S ribosomal protein L13a-4 [Sesamum indicum]
Length=206

 Score =   190 bits (482),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_011091425.1| PREDICTED: 60S ribosomal protein L13a-4-like [Sesamum indicum]
Length=206

 Score =   189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010920859.1| PREDICTED: 60S ribosomal protein L13a-4-like [Elaeis guineensis]
Length=206

 Score =   189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_010937848.1| PREDICTED: 60S ribosomal protein L13a-4 [Elaeis guineensis]
Length=206

 Score =   189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_008786013.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIP  94



>gb|EYU31410.1| hypothetical protein MIMGU_mgv1a013934mg [Erythranthe guttata]
Length=206

 Score =   189 bits (480),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>gb|EYU32659.1| hypothetical protein MIMGU_mgv1a013922mg [Erythranthe guttata]
Length=206

 Score =   189 bits (479),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_009789164.1| PREDICTED: 60S ribosomal protein L13a-1 [Nicotiana sylvestris]
Length=206

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>emb|CDP03876.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_009625303.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   188 bits (477),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>gb|AIC33046.1| 60S ribosomal protein L13a, partial [Panax ginseng]
Length=157

 Score =   186 bits (473),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009392721.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   188 bits (477),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>gb|KHG08426.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB37827.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
 gb|KJB37828.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
Length=206

 Score =   188 bits (477),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>gb|EPS58218.1| hypothetical protein M569_16597 [Genlisea aurea]
Length=206

 Score =   188 bits (477),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+R VVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRFVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>gb|KHG07795.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_003559332.1| PREDICTED: 60S ribosomal protein L13a-4 [Brachypodium distachyon]
Length=206

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009404653.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009421391.1| PREDICTED: 60S ribosomal protein L13a-4 [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_011045655.1| PREDICTED: 60S ribosomal protein L13a-2 [Populus euphratica]
Length=206

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_008805147.1| PREDICTED: 60S ribosomal protein L13a-2-like [Phoenix dactylifera]
Length=206

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR P+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKILWRTIRGMIP  94



>gb|KJB72096.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=206

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>gb|KHG26825.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>emb|CDY52083.1| BnaCnng21840D [Brassica napus]
 emb|CDX77383.1| BnaA07g05210D [Brassica napus]
Length=206

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_002267491.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
Length=206

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAGRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_009102457.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
Length=206

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|ACJ02350.1| 60S ribosomal protein L13A [Vernicia fordii]
Length=206

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKIVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010279449.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   187 bits (475),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009622553.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   187 bits (475),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARRVV+DARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVIDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_007223449.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 ref|XP_008224495.1| PREDICTED: 60S ribosomal protein L13a-4 [Prunus mume]
 gb|EMJ24648.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=206

 Score =   187 bits (475),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>gb|KDO61166.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=205

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_006369799.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
 gb|ABK93590.1| unknown [Populus trichocarpa]
 gb|ERP66368.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
Length=206

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+R+VVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRIVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_006420899.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 ref|XP_006493807.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|ESR34139.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 gb|KDO61167.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=206

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_002518107.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF44240.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010937601.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=206

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMK+ 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKFL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIP  94



>ref|XP_010023711.1| PREDICTED: 60S ribosomal protein L13a-4-like [Eucalyptus grandis]
 gb|KCW60057.1| hypothetical protein EUGRSUZ_H02787 [Eucalyptus grandis]
Length=206

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS+LAKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQRVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009403869.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   187 bits (474),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CARRVVVDARHHMLGRLASI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_007034382.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 ref|XP_007034383.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05308.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05309.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
Length=206

 Score =   187 bits (474),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA++VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009112682.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
 emb|CDY39786.1| BnaA09g10380D [Brassica napus]
 emb|CDY03292.1| BnaC09g10560D [Brassica napus]
Length=206

 Score =   187 bits (474),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|KJB72097.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=169

 Score =   185 bits (470),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009795999.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana sylvestris]
Length=206

 Score =   186 bits (473),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARRVVVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_006418685.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
 gb|ESQ37121.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
Length=206

 Score =   186 bits (473),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>pdb|3J61|O Chain O, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50984.1| ribosomal protein L13a [Triticum aestivum]
 dbj|BAJ92402.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50837.1| 60S ribosomal protein L13a-4 [Triticum urartu]
 gb|EMT20078.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=206

 Score =   186 bits (473),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_010524687.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   186 bits (473),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_008789105.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVLVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_006650608.1| PREDICTED: 60S ribosomal protein L13a-4-like [Oryza brachyantha]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CARRVVVDARHHMLGRL+S++AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLSSVIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTVRGMIP  94



>ref|XP_004252998.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_006349931.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_006407868.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
 gb|ESQ49321.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_010532891.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_004154636.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 1 [Cucumis 
sativus]
Length=241

 Score =   187 bits (475),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  55   KMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY  234
            KMVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY
Sbjct  33   KMVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKY  92

Query  235  HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
             RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  93   MRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  127



>gb|ADR71263.1| 60S ribosomal protein L13aA [Hevea brasiliensis]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_010277234.1| PREDICTED: 60S ribosomal protein L13a-4 [Nelumbo nucifera]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIP  94



>ref|XP_006298567.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
 gb|EOA31465.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
Length=206

 Score =   186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|NP_001275476.1| 60S ribosomal protein L13a-4-like [Solanum tuberosum]
 gb|ABA46790.1| 60S ribosomal protein L13a-like protein [Solanum tuberosum]
Length=206

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_004239861.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum lycopersicum]
Length=206

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_006855707.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
 gb|ERN17174.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
Length=171

 Score =   185 bits (469),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICAR VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_002323772.1| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK95932.1| unknown [Populus trichocarpa]
 gb|EEF03905.1| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010552053.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_010547080.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_010245584.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIP  94



>ref|XP_010527234.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_004288082.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
 ref|XP_004288083.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_004297119.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca 
subsp. vesca]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_006840139.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
 gb|ERN01814.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+ VVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>gb|KDP39375.1| hypothetical protein JCGZ_01132 [Jatropha curcas]
Length=206

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS +AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASTIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010439646.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
 ref|XP_010442327.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
Length=206

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_009765513.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana sylvestris]
Length=206

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010482144.1| PREDICTED: 60S ribosomal protein L13a-4-like [Camelina sativa]
Length=206

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_010069656.1| PREDICTED: 60S ribosomal protein L13a-2 [Eucalyptus grandis]
 gb|KCW58065.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=206

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|NP_001235102.1| uncharacterized protein LOC100499978 [Glycine max]
 gb|ACU14471.1| unknown [Glycine max]
Length=206

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_006281111.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
 gb|EOA14009.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
Length=206

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|AAR89618.1| 60S ribosomal protein L13a [Capsicum annuum]
Length=220

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_002882511.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58770.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|AFK44939.1| unknown [Lotus japonicus]
Length=206

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIP  94



>ref|XP_004133995.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_004169511.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_008438365.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis melo]
 gb|KGN56740.1| hypothetical protein Csa_3G131930 [Cucumis sativus]
Length=206

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_007223448.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 gb|EMJ24647.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=187

 Score =   184 bits (468),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009596414.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana tomentosiformis]
Length=206

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_004138959.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_004139040.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_008450411.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008457247.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008458460.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 gb|KGN61467.1| hypothetical protein Csa_2G138710 [Cucumis sativus]
Length=206

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009405822.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CAR VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARCVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_004154637.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 2 [Cucumis 
sativus]
 ref|XP_004154638.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 3 [Cucumis 
sativus]
Length=208

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>gb|ACG36118.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>gb|KJB30129.1| hypothetical protein B456_005G130900 [Gossypium raimondii]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEISMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_010464292.1| PREDICTED: 60S ribosomal protein L13a-1-like [Camelina sativa]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RV VDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVAVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|NP_001281205.1| 60S ribosomal protein L13a [Zea mays]
 gb|ACN25827.1| unknown [Zea mays]
 gb|AFW67581.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_002466431.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
 gb|AAM47582.1| putative 60S ribosomal protein [Sorghum bicolor]
 gb|EER93429.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|NP_001276138.1| 60S ribosomal protein L13a-4-like [Glycine max]
 gb|ACU20583.1| unknown [Glycine max]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_010448678.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
 ref|XP_010486252.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLGSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_004247847.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
 ref|XP_006360354.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI A+R+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_009129745.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brassica rapa]
Length=206

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|KGN66498.1| hypothetical protein Csa_1G615170 [Cucumis sativus]
Length=202

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>emb|CDY33947.1| BnaA02g30400D [Brassica napus]
 emb|CDY05663.1| BnaC02g38740D [Brassica napus]
 emb|CDX85362.1| BnaC07g26730D [Brassica napus]
Length=206

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_009111853.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
 emb|CDY00046.1| BnaC09g02550D [Brassica napus]
 emb|CDX86281.1| BnaA06g29980D [Brassica napus]
Length=206

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_009136093.1| PREDICTED: 60S ribosomal protein L13a-2 [Brassica rapa]
 emb|CDY15113.1| BnaC03g44740D [Brassica napus]
 emb|CDX93039.1| BnaA03g37610D [Brassica napus]
Length=206

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+C++RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RF+RKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFMRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_006395114.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
 gb|ESQ32400.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
Length=206

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_007147486.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
 gb|ESW19480.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
Length=206

 Score =   184 bits (467),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41928.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   184 bits (467),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|KDO65930.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=130

 Score =   181 bits (460),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 ref|NP_001078737.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 sp|Q9FKC0.1|R13A4_ARATH RecName: Full=60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 dbj|BAB09429.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAL91263.1| AT5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AAM65734.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAM67435.1| At5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AED95720.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 gb|AED95721.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
Length=206

 Score =   184 bits (467),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|NP_001130808.1| uncharacterized protein LOC100191912 [Zea mays]
 gb|ACG24933.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   184 bits (466),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>gb|ACF79169.1| unknown [Zea mays]
 tpg|DAA51453.1| TPA: ribosomal protein L13A-like protein [Zea mays]
Length=206

 Score =   184 bits (466),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_010069043.1| PREDICTED: 60S ribosomal protein L13a-3 [Eucalyptus grandis]
 gb|KCW57252.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=206

 Score =   184 bits (466),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_006479280.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|KDO65928.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=206

 Score =   184 bits (466),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>gb|KFK39804.1| hypothetical protein AALP_AA3G290300 [Arabis alpina]
Length=206

 Score =   184 bits (466),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|EPS66587.1| hypothetical protein M569_08187, partial [Genlisea aurea]
Length=91

 Score =   180 bits (456),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/91 (97%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG  330
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG  91



>gb|ACG48503.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   184 bits (466),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_008356990.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
 ref|XP_009348407.1| PREDICTED: 60S ribosomal protein L13a-4-like [Pyrus x bretschneideri]
Length=206

 Score =   183 bits (465),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|NP_001030654.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AEE74500.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=207

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_011041875.1| PREDICTED: 60S ribosomal protein L13a-1-like [Populus euphratica]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKR NTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRTNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>gb|KJB10146.1| hypothetical protein B456_001G186700 [Gossypium raimondii]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_009374600.1| PREDICTED: 60S ribosomal protein L13a-4 [Pyrus x bretschneideri]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>gb|AHE13806.1| ribosomal protein L13a [Solanum torvum]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI A+R+VVDARHHMLGRL+SI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSIIAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_004981725.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X2 [Setaria 
italica]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIP  94



>ref|NP_187367.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 sp|Q9SFU1.1|R13A1_ARATH RecName: Full=60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AAF20235.1|AC012395_22 putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAG40393.1|AF325041_1 AT3g07110 [Arabidopsis thaliana]
 gb|AAL09790.1| AT3g07110/T1B9_24 [Arabidopsis thaliana]
 gb|AAL32871.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAM47908.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AEE74499.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_010440660.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L13a-3-like 
[Camelina sativa]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHM GRLAS LAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGRLASSLAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_004499225.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
 ref|XP_004499231.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_002521095.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF41246.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>gb|ACJ83838.1| unknown [Medicago truncatula]
 gb|AFK37771.1| unknown [Medicago truncatula]
 gb|KEH22805.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|KHF97469.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>gb|KHG16481.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB22644.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=206

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>gb|KCW58066.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=240

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_007140600.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
 gb|AGV54439.1| 60S ribosomal protein L13a [Phaseolus vulgaris]
 gb|ESW12594.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
Length=206

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIP  94



>ref|XP_010110069.1| 60S ribosomal protein L13a-3 [Morus notabilis]
 gb|EXC25125.1| 60S ribosomal protein L13a-3 [Morus notabilis]
Length=206

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEELCISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>sp|O65055.1|RL13A_PICMA RecName: Full=60S ribosomal protein L13a [Picea mariana]
 gb|AAC32117.1| probable 60s ribosomal protein L13a [Picea mariana]
Length=206

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIP  94



>gb|KCW58067.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=174

 Score =   182 bits (461),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_008348430.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
Length=206

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|NP_001051314.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|AAR01683.1| putative ribosomal protein L13a [Oryza sativa Japonica Group]
 gb|ABF98951.1| 60S ribosomal protein L13a-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13228.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|EAY91906.1| hypothetical protein OsI_13588 [Oryza sativa Indica Group]
 gb|EAZ28629.1| hypothetical protein OsJ_12636 [Oryza sativa Japonica Group]
 dbj|BAG96308.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01442.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR+P+KILWRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTVRGMIP  94



>gb|ACN36734.1| unknown [Zea mays]
 gb|AFW67580.1| hypothetical protein ZEAMMB73_211853 [Zea mays]
Length=179

 Score =   182 bits (462),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>gb|KHG00254.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>gb|KJB42469.1| hypothetical protein B456_007G154600 [Gossypium raimondii]
Length=206

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_003546257.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
Length=206

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVAVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_003616742.1| 60S ribosomal protein L13A [Medicago truncatula]
 gb|AES99700.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIP  94



>ref|XP_006586250.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
 gb|KHN07181.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=206

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIP  94



>gb|ABK22228.1| unknown [Picea sitchensis]
 gb|ABK22389.1| unknown [Picea sitchensis]
 gb|ABK22608.1| unknown [Picea sitchensis]
 gb|ABK23686.1| unknown [Picea sitchensis]
 gb|ABK23694.1| unknown [Picea sitchensis]
 gb|ABK26243.1| unknown [Picea sitchensis]
 gb|ABK26404.1| unknown [Picea sitchensis]
 gb|ABR17228.1| unknown [Picea sitchensis]
 gb|ACN40291.1| unknown [Picea sitchensis]
 gb|ACN40454.1| unknown [Picea sitchensis]
 gb|ACN40588.1| unknown [Picea sitchensis]
 gb|ACN40688.1| unknown [Picea sitchensis]
 gb|ADE77397.1| unknown [Picea sitchensis]
Length=206

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIP  94



>gb|KCW57253.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=181

 Score =   181 bits (460),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIP  94



>ref|XP_009151676.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
Length=206

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPPKIFWRTVRGMIP  94



>ref|XP_002863167.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39426.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVD RHHMLGRLAS  AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASTTAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>dbj|BAK07924.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   184 bits (466),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  34   E*REDAAKMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGL  213
            E R     MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGL
Sbjct  37   EGRSQQVTMVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGL  96

Query  214  VRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            VRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  97   VRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  138



>ref|XP_003589380.1| 60S ribosomal protein L13a [Medicago truncatula]
 gb|ACJ85949.1| unknown [Medicago truncatula]
 gb|AES59631.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
 gb|AFK44083.1| unknown [Medicago truncatula]
Length=206

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|KFK38165.1| hypothetical protein AALP_AA3G077500 [Arabis alpina]
Length=206

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+C++RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_006298559.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
 gb|EOA31457.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
Length=206

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|NP_001236202.1| uncharacterized protein LOC100527190 [Glycine max]
 gb|ACU16241.1| unknown [Glycine max]
Length=206

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIP  94



>gb|KHN07182.1| 60S ribosomal protein L13a-1 [Glycine soja]
Length=206

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIP  94



>gb|KFK39801.1| hypothetical protein AALP_AA3G289800 [Arabis alpina]
Length=206

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+RVVVD RHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|AAL87341.1| putative 60S ribosomal protein [Arabidopsis thaliana]
Length=206

 Score =   182 bits (462),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|NP_189127.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 sp|Q9LRX8.1|R13A2_ARATH RecName: Full=60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 dbj|BAB02893.1| 60S ribosomal protein L13A-like [Arabidopsis thaliana]
 gb|AAN12937.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AEE76951.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
Length=206

 Score =   182 bits (461),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_007049776.1| Ribosomal protein L13 family protein [Theobroma cacao]
 gb|EOX93933.1| Ribosomal protein L13 family protein [Theobroma cacao]
Length=206

 Score =   182 bits (461),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MV GSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVCGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KILWRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTVRGMIP  94



>gb|KDO65929.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=179

 Score =   181 bits (458),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_002439183.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
 gb|EES17613.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
Length=206

 Score =   181 bits (460),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+ A+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGLSAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010488596.1| PREDICTED: 60S ribosomal protein L13a-2 [Camelina sativa]
Length=206

 Score =   181 bits (460),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|ACG33474.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   181 bits (460),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSH PIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHRPIHFRAPSKILWRTIRGMIP  94



>gb|AFK34830.1| unknown [Medicago truncatula]
Length=206

 Score =   181 bits (460),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKP+HGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPNHGPIHFRAPSKIFWRTLRGMIP  94



>ref|XP_010466918.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   181 bits (460),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|KJB22645.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=173

 Score =   180 bits (457),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>ref|XP_006284504.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
 gb|EOA17402.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
Length=217

 Score =   181 bits (460),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHM GRLAS +AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  12   MVSGSGICAKRVVVDARHHMGGRLASSIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  71

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  72   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  105



>ref|XP_002883564.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59823.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|ACG37566.1| 60S ribosomal protein L13a [Zea mays]
Length=222

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R  VDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRXXVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  94



>ref|XP_010513787.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>ref|XP_011024678.1| PREDICTED: 60S ribosomal protein L13a-4-like [Populus euphratica]
Length=206

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+ VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>gb|KDP26388.1| hypothetical protein JCGZ_17546 [Jatropha curcas]
Length=206

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA++VVVDARHHMLGRLAS++AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASVVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFR P+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKIFWRTVRGMIP  94



>ref|NP_193053.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 sp|Q9SVR0.1|R13A3_ARATH RecName: Full=60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 emb|CAB41927.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 emb|CAB78359.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 gb|AAK97733.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AAL31131.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AEE83240.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
Length=206

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVD RHHMLGRLAS  AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|EAZ38446.1| hypothetical protein OsJ_22825 [Oryza sativa Japonica Group]
Length=206

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIP  94



>ref|NP_001058724.1| Os07g0109500 [Oryza sativa Japonica Group]
 dbj|BAC79560.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAD30642.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAF20638.1| Os07g0109500 [Oryza sativa Japonica Group]
 gb|EAZ02520.1| hypothetical protein OsI_24624 [Oryza sativa Indica Group]
 dbj|BAG88872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95855.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIP  94



>ref|XP_010228462.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brachypodium distachyon]
Length=206

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEISVSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIP  94



>gb|EMS52180.1| 60S ribosomal protein L13a-4 [Triticum urartu]
Length=206

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIP  94



>ref|XP_002301785.2| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK92693.1| unknown [Populus trichocarpa]
 gb|ABK94779.1| unknown [Populus trichocarpa]
 gb|EEE81058.2| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+ V+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVLVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  94



>gb|EMT05694.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=238

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+ ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIP  94



>gb|ABQ57364.1| ribosomal protein L13A [Lupinus luteus]
Length=206

 Score =   179 bits (453),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>gb|AFW67579.1| hypothetical protein ZEAMMB73_211853 [Zea mays]
Length=127

 Score =   176 bits (446),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG  330
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG  91



>ref|XP_001774253.1| predicted protein [Physcomitrella patens]
 gb|EDQ60889.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   179 bits (453),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIP  94



>ref|XP_001765352.1| predicted protein [Physcomitrella patens]
 gb|EDQ69815.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   178 bits (452),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIP  94



>ref|XP_001763759.1| predicted protein [Physcomitrella patens]
 gb|EDQ71401.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+ VVVDARHHMLGRLASILAKELLNGQ++VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKIVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIP  94



>ref|XP_010107772.1| 60S ribosomal protein L13a-4 [Morus notabilis]
 gb|EXC16937.1| 60S ribosomal protein L13a-4 [Morus notabilis]
Length=271

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMI  336
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRG +
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGAV  93



>ref|XP_006443602.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
 gb|ESR56842.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
Length=382

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  177  MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  236

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIP
Sbjct  237  RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIP  270



>ref|XP_006292546.1| hypothetical protein CARUB_v10018781mg, partial [Capsella rubella]
 gb|EOA25444.1| hypothetical protein CARUB_v10018781mg, partial [Capsella rubella]
Length=120

 Score =   174 bits (441),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHM+GRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMIGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMI  336
            RFLRKRMNTKPSHGPI+FRAPSKI WRT+RG++
Sbjct  61   RFLRKRMNTKPSHGPIYFRAPSKIFWRTVRGVL  93



>ref|XP_001765905.1| predicted protein [Physcomitrella patens]
 gb|EDQ69226.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   176 bits (447),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIP  94



>ref|XP_004981724.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X1 [Setaria 
italica]
Length=241

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMI  336
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRG +
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGYV  93



>gb|KHN31417.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=204

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 2/94 (2%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHMLGRLAS   KELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLAS--EKELLNGQKVAVVRCEEICISGGLVRQKMKYL  58

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  59   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  92



>ref|XP_001773626.1| predicted protein [Physcomitrella patens]
 gb|EDQ61514.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+CA+ VVVDARHHMLGRLASIL+KELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILSKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIP  94



>ref|XP_010435310.1| PREDICTED: 60S ribosomal protein L13a-3-like [Camelina sativa]
Length=206

 Score =   173 bits (439),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVDARHHM G LAS LAKELLNGQ+VVVVRCEEICLSGGLVR +MKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGLLASSLAKELLNGQKVVVVRCEEICLSGGLVRLRMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+R MIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRSMIP  94



>ref|XP_006657401.1| PREDICTED: 60S ribosomal protein L13a-3-like [Oryza brachyantha]
Length=206

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+C RRVVVDAR+HM+GRLAS +AKELLNGQRVVVVRCEE+C+SGG VRQKMKY 
Sbjct  1    MVSGSGVCRRRVVVDARNHMMGRLASAVAKELLNGQRVVVVRCEEMCVSGGPVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIP  94



>ref|XP_002964465.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
 ref|XP_002975331.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ23532.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ34798.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
Length=206

 Score =   172 bits (435),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG CAR VV+DARHHMLGRLASI AKELLNGQR+V+ RCEEI LSGGLVRQKMKY 
Sbjct  1    MVSGSGACARVVVIDARHHMLGRLASIAAKELLNGQRLVITRCEEIALSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPS GPIHFRAP++ILWRTIRGMIP
Sbjct  61   RFLRKRMNTKPSKGPIHFRAPARILWRTIRGMIP  94



>ref|XP_007200528.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
 gb|EMJ01727.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
Length=206

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVD RHHMLGRLAS++AK+LLNGQR+ VVRC+EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRCDEIAISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIP
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIP  94



>ref|XP_010685006.1| PREDICTED: 60S ribosomal protein L13a-2 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   171 bits (433),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSG+ A+RVVVDARHHM GRLASI+AKELL GQRVVV RCE I LSGGLVRQKMKY 
Sbjct  1    MVSGSGVMAKRVVVDARHHMCGRLASIVAKELLTGQRVVVTRCEAIALSGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIP  94



>sp|O49885.1|RL13A_LUPLU RecName: Full=60S ribosomal protein L13a [Lupinus luteus]
 emb|CAA11283.1| ribosomal protein L13a [Lupinus luteus]
Length=205

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 88/94 (94%), Gaps = 1/94 (1%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGI A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGPIH  APSKI WRT+RGMIP
Sbjct  61   RFLRKRMNTKPSHGPIHC-APSKIFWRTVRGMIP  93



>ref|XP_008365936.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=206

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIP  94



>ref|XP_008235481.1| PREDICTED: 60S ribosomal protein L13a-1-like [Prunus mume]
Length=206

 Score =   166 bits (419),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC +RVVVD RHHMLGRLAS++AK+LLNGQR+ VVR +EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICLKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRSDEIAISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIP
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIP  94



>ref|XP_008382629.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=161

 Score =   164 bits (414),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIP  94



>ref|XP_009334926.1| PREDICTED: 60S ribosomal protein L13a-1-like [Pyrus x bretschneideri]
Length=206

 Score =   163 bits (413),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGICA+RVVVD  HHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGHHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIP
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIP  94



>ref|XP_006387455.1| hypothetical protein POPTR_1021s00200g, partial [Populus trichocarpa]
 gb|ERP46369.1| hypothetical protein POPTR_1021s00200g, partial [Populus trichocarpa]
Length=80

 Score =   154 bits (389),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSGSGIC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  238  RFLRKRMNTKPSHGPIHFRA  297
            RFLRKRMNTKPSHGPIHFRA
Sbjct  61   RFLRKRMNTKPSHGPIHFRA  80



>gb|AAP80748.1| 60S ribosomal protein [Kandelia candel]
Length=79

 Score =   147 bits (370),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  82   ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN  261
            A+ VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMN
Sbjct  2    AKVVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMN  61

Query  262  TKPSHGPIHFRAPSKIL  312
            TKPSHGPIHFRAPSKIL
Sbjct  62   TKPSHGPIHFRAPSKIL  78



>ref|XP_001692909.1| ribosomal protein L13a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP03478.1| ribosomal protein L13a [Chlamydomonas reinhardtii]
Length=185

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            + VV+D R HMLGRLAS++AK++L GQ++VVVR EEI +SGGLVRQKMKY RFLRKRMNT
Sbjct  3    KTVVIDGRAHMLGRLASVVAKQILAGQQIVVVRAEEITISGGLVRQKMKYDRFLRKRMNT  62

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P+ GP HFRAPS+I WRT+RGMIP
Sbjct  63   NPTRGPFHFRAPSRIFWRTVRGMIP  87



>ref|XP_002953387.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45697.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=185

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            + VV+D R HMLGRLAS++AK++L+GQ++VVVR E+I +SGGLVRQKMKY RFLRKRMNT
Sbjct  3    KTVVIDGRAHMLGRLASVVAKQILSGQQIVVVRAEDITISGGLVRQKMKYDRFLRKRMNT  62

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P+ GP HFRAPS+I WRT+RGMIP
Sbjct  63   NPTRGPFHFRAPSRIFWRTVRGMIP  87



>emb|CDS32619.1| ribosomal protein rpl13a [Hymenolepis microstoma]
Length=202

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +V+DAR H+LGRLASI+AK LLNGQ++VVVRCEEI +SG L R K+KYH FLRKRMNT P
Sbjct  8    IVIDARDHLLGRLASIVAKTLLNGQKIVVVRCEEINISGSLYRNKLKYHEFLRKRMNTNP  67

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            S GP HFRAP+KI WRT+RGM+P
Sbjct  68   SRGPYHFRAPAKIFWRTVRGMLP  90



>ref|XP_005643971.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19427.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=185

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            + VV+DAR HMLGRLASI+AK+ LNGQ +VV R EEI +SGGLVRQKMKY RFLRKRMN+
Sbjct  3    KTVVIDARGHMLGRLASIVAKQALNGQHIVVTRAEEINVSGGLVRQKMKYERFLRKRMNS  62

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P  GPIHFRAPS+I WRT+RGM+P
Sbjct  63   NPKKGPIHFRAPSRIFWRTVRGMVP  87



>gb|EUB62915.1| 60S ribosomal protein L13a [Echinococcus granulosus]
 emb|CDI99730.1| ribosomal protein rpl13a [Echinococcus multilocularis]
 emb|CDS18961.1| ribosomal protein rpl13a [Echinococcus granulosus]
 emb|CDS37012.1| ribosomal protein rpl13a [Echinococcus multilocularis]
Length=202

 Score =   137 bits (346),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +++DAR H+LGRLASI+AK LL GQR+VVVRCEEI +SG L R K+KYH FLRKRMNT P
Sbjct  8    IIIDARGHLLGRLASIVAKTLLQGQRIVVVRCEEINISGSLYRNKLKYHEFLRKRMNTNP  67

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            SHGP H+RAP+KI WRT+RGM+P
Sbjct  68   SHGPYHYRAPAKIFWRTVRGMLP  90



>ref|XP_004955326.1| PREDICTED: 60S ribosomal protein L13a-3-like [Setaria italica]
Length=200

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 6/94 (6%)
 Frame = +1

Query  58   MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  237
            MVSG       VVVDAR HM+GRLAS +AKELL GQRV V+RCEE+ LSGGLVRQK ++ 
Sbjct  1    MVSGC------VVVDARGHMMGRLASAVAKELLKGQRVAVLRCEEMTLSGGLVRQKSRFL  54

Query  238  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RFLRKRMNTKPSHGP+H R+P++I WR +RGM+P
Sbjct  55   RFLRKRMNTKPSHGPVHHRSPARIFWRAVRGMVP  88



>ref|NP_001187674.1| 60S ribosomal protein l13a [Ictalurus punctatus]
 gb|ADO28968.1| 60S ribosomal protein l13a [Ictalurus punctatus]
Length=202

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            + +++DAR H+LGRLASI AK LL GQ+VVVVRCEEI +SG L R K+KY  FLRKRMNT
Sbjct  6    KSIIIDARGHLLGRLASITAKTLLQGQKVVVVRCEEINISGSLYRNKLKYLDFLRKRMNT  65

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             PSHGP H+RAPSKI WRT+RGM+P
Sbjct  66   NPSHGPYHYRAPSKIFWRTVRGMLP  90



>ref|XP_001630812.1| predicted protein [Nematostella vectensis]
 gb|EDO38749.1| predicted protein [Nematostella vectensis]
Length=201

 Score =   132 bits (333),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +++V+D   H+LGRLAS +AK +L+GQRVVVVRCE+IC+SG   R K+KY  FLRKR NT
Sbjct  5    KQIVIDGAGHLLGRLASTVAKSILSGQRVVVVRCEKICISGNFYRNKLKYLDFLRKRTNT  64

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
            KPSHGP HFRAPS+I WRT+RGMIP
Sbjct  65   KPSHGPFHFRAPSRIFWRTVRGMIP  89



>gb|ABW90393.1| putative ribosomal protein L13a [Barentsia elongata]
Length=200

 Score =   130 bits (328),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +V+D R H+LGRLASI+AK LL GQR+VVVRCE+I +SG L R K+KYH FLRKRMNT P
Sbjct  5    IVIDGRGHLLGRLASIVAKTLLQGQRIVVVRCEQINISGSLYRNKLKYHDFLRKRMNTNP  64

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GP HFRAPSKILWR IRGM+P
Sbjct  65   KKGPYHFRAPSKILWRVIRGMLP  87



>gb|AFX72999.1| 60S ribosomal protein L13a [Spirometra erinaceieuropaei]
Length=202

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +++DAR H+LGRLASI+AK LL GQ+VVVVRCE+I +SG   R K+KY  FLRKRMNT P
Sbjct  8    IIIDARGHLLGRLASIVAKTLLQGQKVVVVRCEQINISGSFYRNKLKYREFLRKRMNTNP  67

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            SHGP H+R+P+KI WRT+RGM+P
Sbjct  68   SHGPYHYRSPAKIFWRTVRGMLP  90



>gb|EWM30220.1| 60s ribosomal protein l13a [Nannochloropsis gaditana]
Length=213

 Score =   130 bits (326),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  82   ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN  261
            ++ VV+D R H+LGRL+SI+AKELL+GQ+VVVVRCEE+ +SGGLVR   +Y +FLRKR N
Sbjct  5    SKEVVIDGRGHLLGRLSSIVAKELLSGQKVVVVRCEELMISGGLVRNHTRYMQFLRKRTN  64

Query  262  TKPSHGPIHFRAPSKILWRTIRGMIP  339
            T P  GP H+RAPS+ILWRTIRGM+P
Sbjct  65   TNPKRGPFHYRAPSRILWRTIRGMLP  90



>sp|P93099.1|RL13A_CYAPA RecName: Full=60S ribosomal protein L13a [Cyanophora paradoxa]
 emb|CAA71090.1| ribosomal protein L13a [Cyanophora paradoxa]
Length=200

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            VVVD R H+LGRLA+ LAKELLNGQRVV VR EEI +SG L R K+K+H FL+KRMNT P
Sbjct  6    VVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNP  65

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GP HFR+P++ILWRTIRGMIP
Sbjct  66   RRGPFHFRSPARILWRTIRGMIP  88



>emb|CCD82603.1| putative 60s ribosomal protein L13a [Schistosoma mansoni]
Length=203

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +++DA+ H+LGRLAS++AK LLNGQ+VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  8    IIIDAQGHLLGRLASVVAKTLLNGQKVVVVRCESINISGSFYRNKLKYLDFLRKRMNTNP  67

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            S GP HFRAP+KI WRT+RGM+P
Sbjct  68   SRGPYHFRAPAKIFWRTVRGMLP  90



>ref|XP_005849945.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
 gb|EFN57843.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
Length=180

 Score =   127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  79   CARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRM  258
            C + VVVD R HMLGRLAS+LAK+LL+GQ VV VRCEEI +SGG+VRQK KY RFLRKR 
Sbjct  1    CVQTVVVDCRGHMLGRLASVLAKQLLSGQHVVCVRCEEINISGGMVRQKAKYERFLRKRS  60

Query  259  NTKPSHGPIHFRAPSKILWRTIRGMIP  339
             T P  G + FRAPS+ILWRT+RGM P
Sbjct  61   VTNPRRGAVKFRAPSRILWRTVRGMTP  87



>gb|KGB33955.1| 60S ribosomal protein L13a, partial [Schistosoma haematobium]
Length=197

 Score =   127 bits (320),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +++DA+ H+LGRLAS++AK LLNGQ+VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  2    IIIDAQGHLLGRLASVVAKTLLNGQKVVVVRCEGINISGSFYRNKLKYLDFLRKRMNTNP  61

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            S GP HFRAP+KI WRT+RGM+P
Sbjct  62   SRGPYHFRAPAKIFWRTVRGMLP  84



>ref|XP_009035047.1| hypothetical protein AURANDRAFT_58864 [Aureococcus anophagefferens]
 gb|EGB10230.1| hypothetical protein AURANDRAFT_58864 [Aureococcus anophagefferens]
Length=199

 Score =   127 bits (319),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            V+VD R HMLGRLASI+AKELL GQ+VVVVRCE++C+SG LVR K+K+  FL+KR NT P
Sbjct  7    VLVDGRTHMLGRLASIIAKELLCGQKVVVVRCEQLCVSGSLVRNKVKFTAFLKKRTNTNP  66

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GPIH+R+P+++LWRT+RGM+P
Sbjct  67   KRGPIHYRSPARMLWRTVRGMLP  89



>gb|AAW27674.1| SJCHGC04249 protein [Schistosoma japonicum]
Length=203

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +++DA+ H+LGRLA+++AK LLNGQ+VVVVRCE + +SG   R K+KY  FLRKRMNT P
Sbjct  8    IIIDAQGHLLGRLAAVVAKTLLNGQKVVVVRCENLNISGSFYRNKLKYLDFLRKRMNTNP  67

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            S GP HFRAP+KI WRT+RGM+P
Sbjct  68   SRGPYHFRAPAKIFWRTVRGMLP  90



>gb|ABX44816.1| putative 60S ribosomal protein RPL13A [Flustra foliacea]
Length=173

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +1

Query  73   GICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRK  252
            G   + V++DAR H+LGRLASI+AK LL GQRVVVVRCEEI +SG   R K+KY  F+RK
Sbjct  2    GFQVQPVLIDARGHLLGRLASIIAKTLLRGQRVVVVRCEEINISGSFYRNKLKYLDFMRK  61

Query  253  RMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            R NT PS GP H RAPSKILWR IRGM+P
Sbjct  62   RCNTNPSRGPYHLRAPSKILWRVIRGMVP  90



>ref|XP_002436282.1| ribosomal protein L13A, putative [Ixodes scapularis]
 gb|EEC09112.1| ribosomal protein L13A, putative [Ixodes scapularis]
Length=205

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  70   SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  249
            +GI ++ +++D + H+LGRL++++AK LL+GQRVVVVRCE IC+SG   R K+KY  FLR
Sbjct  2    TGISSKPIIIDGQGHLLGRLSALIAKTLLHGQRVVVVRCEGICISGSFFRSKLKYLSFLR  61

Query  250  KRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            KR N  P  GP HFRAPSKILWRT+RGM+P
Sbjct  62   KRCNVNPKRGPYHFRAPSKILWRTVRGMVP  91



>gb|ABZ04228.1| ribosomal protein rpl13a [Lineus viridis]
Length=203

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +1

Query  73   GICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRK  252
            G   + +++DAR H+LGRLASI+AK +LNGQRVV++RCEEI +SG   R K+KY  F++K
Sbjct  2    GFSTKPIIIDARGHLLGRLASIVAKTILNGQRVVILRCEEINISGSFYRNKLKYLDFIKK  61

Query  253  RMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            R N  P  GP HFRAPSKI WRT+RGM+P
Sbjct  62   RCNVNPKRGPFHFRAPSKIFWRTVRGMVP  90



>gb|KJB28243.1| hypothetical protein B456_005G036700 [Gossypium raimondii]
 gb|KJB28244.1| hypothetical protein B456_005G036700 [Gossypium raimondii]
Length=96

 Score =   122 bits (306),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  76   ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKR  255
            +C++RV VDARH MLGRLASILAKELLNGQ+VVVVRCEEIC+ GGLV QKM   RFLRKR
Sbjct  1    MCSKRVAVDARHRMLGRLASILAKELLNGQKVVVVRCEEICMWGGLVSQKMNLMRFLRKR  60

Query  256  MNTKPSHGPIHFRAP  300
            MNT+PSHG I F AP
Sbjct  61   MNTEPSHGFIQFPAP  75



>gb|KJB28245.1| hypothetical protein B456_005G036700 [Gossypium raimondii]
 gb|KJB28246.1| hypothetical protein B456_005G036700 [Gossypium raimondii]
Length=85

 Score =   122 bits (305),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  76   ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKR  255
            +C++RV VDARH MLGRLASILAKELLNGQ+VVVVRCEEIC+ GGLV QKM   RFLRKR
Sbjct  1    MCSKRVAVDARHRMLGRLASILAKELLNGQKVVVVRCEEICMWGGLVSQKMNLMRFLRKR  60

Query  256  MNTKPSHGPIHFRAP  300
            MNT+PSHG I F AP
Sbjct  61   MNTEPSHGFIQFPAP  75



>ref|XP_002112893.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV25003.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=202

 Score =   125 bits (313),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +++D R+H+LGRLAS +AK +L+GQRVVVVRCEE+ +SGG  R K+KY  FLRKR N  P
Sbjct  7    IIIDGRNHLLGRLASTIAKTILSGQRVVVVRCEELNISGGFYRNKLKYLDFLRKRCNVNP  66

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GP HFRAPS+ILWRT+RGM+P
Sbjct  67   RRGPFHFRAPSRILWRTVRGMVP  89



>gb|ABW23219.1| ribosomal protein rpl13a [Eurythoe complanata]
Length=202

 Score =   125 bits (313),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +V+DAR HMLGRLASI+AK +L GQ VV+VRCE I +SG   R K+KY  FLRKR NTKP
Sbjct  7    IVIDARGHMLGRLASIVAKTILQGQNVVIVRCEGINISGNFYRNKLKYLDFLRKRCNTKP  66

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            S GP H+RAPSKI WRT+RGM+P
Sbjct  67   SRGPYHYRAPSKIFWRTVRGMLP  89



>gb|AIU94816.1| 40S ribosomal protein [Phragmatopoma lapidosa]
 gb|AIU94819.1| 60S ribosomal protein [Phragmatopoma lapidosa]
 gb|AIU94841.1| 60S ribosomal protein [Phragmatopoma lapidosa]
Length=203

 Score =   124 bits (312),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +1

Query  73   GICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRK  252
            G   + +V+DAR H+LGRLA++++K +L GQRVV+VRCE I +SG   R K+KY  FLRK
Sbjct  2    GFQTKPIVIDARGHLLGRLAALVSKTILQGQRVVIVRCEGINISGSFYRNKLKYLSFLRK  61

Query  253  RMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RMNT P  GP HFRAPSKI WRT+RGM+P
Sbjct  62   RMNTNPRRGPYHFRAPSKIFWRTVRGMLP  90



>ref|XP_003384047.1| PREDICTED: 60S ribosomal protein L13a-like [Amphimedon queenslandica]
Length=202

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            ++VDA+ H+LGRLASI+AK+LLNGQ++V++RCE I +SG + R K+KY +FLR R N KP
Sbjct  7    IIVDAKDHLLGRLASIVAKQLLNGQKIVILRCEYINISGSIYRNKVKYLKFLRLRCNVKP  66

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            S GP HFRAPSKI WRT+RGM+P
Sbjct  67   SRGPFHFRAPSKIFWRTVRGMLP  89



>emb|CCF75745.1| unnamed protein product [Babesia microti strain RI]
Length=208

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = +1

Query  79   CARR--VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRK  252
            C RR  +V+D + H+LGRLAS++AKELL+GQ++V VRCEEI +SG L R K+KY RFLR 
Sbjct  7    CLRRWQIVIDCKGHLLGRLASVVAKELLSGQKIVAVRCEEINISGSLFRNKLKYQRFLRL  66

Query  253  RMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            R NT P+HGP H RAPSK  WR +RGM+P
Sbjct  67   RTNTNPNHGPFHLRAPSKFFWRVVRGMLP  95



>emb|CBN08625.1| small nucleolar RNA, C/D box 32A [Microcosmus squamiger]
Length=206

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  273
            V+DA +H+LGRL++++AK +LNGQRVVVVRCE + +SG   R K+KY  FLRKR+NT P 
Sbjct  10   VIDANNHLLGRLSAVVAKTILNGQRVVVVRCEGLLISGNFYRNKLKYLAFLRKRINTNPK  69

Query  274  HGPIHFRAPSKILWRTIRGMIP  339
             GP HFRAPSKILWRT+RGM+P
Sbjct  70   RGPFHFRAPSKILWRTVRGMLP  91



>ref|XP_004226142.1| PREDICTED: 60S ribosomal protein L13a-like [Ciona intestinalis]
Length=206

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  273
            ++DA+ H+LGRLA+++AK LLNGQ++VVVRCE I +SG   R K+KY  FLRKR+ T P 
Sbjct  10   IIDAKDHLLGRLAALIAKNLLNGQKIVVVRCESILISGNFYRNKLKYLDFLRKRIRTNPK  69

Query  274  HGPIHFRAPSKILWRTIRGMIP  339
             GP HFRAPSKILWRT+RGM+P
Sbjct  70   RGPFHFRAPSKILWRTVRGMLP  91



>ref|XP_009174552.1| hypothetical protein T265_10037 [Opisthorchis viverrini]
 gb|KER21689.1| hypothetical protein T265_10037 [Opisthorchis viverrini]
Length=288

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +1

Query  73   GICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRK  252
            G   + +++D + H+LGRLA+I+AK LLNGQ VVVVRCE+I +SG   R K+KY  FLRK
Sbjct  88   GFQKKAIIIDGKDHLLGRLAAIVAKTLLNGQNVVVVRCEQINISGSFYRNKLKYLDFLRK  147

Query  253  RMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            RM+T PS GP HFRAP+KI WRT+RGM+P
Sbjct  148  RMSTNPSRGPYHFRAPAKIFWRTVRGMLP  176



>ref|XP_011397206.1| 60S ribosomal protein L13a-1 [Auxenochlorella protothecoides]
 gb|KFM24318.1| 60S ribosomal protein L13a-1 [Auxenochlorella protothecoides]
Length=184

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            + VV+D R HMLGRLAS++AK+LL+GQ +V V CE I LSGG+VRQK KY RFL KR  +
Sbjct  3    KTVVIDCRTHMLGRLASVIAKQLLSGQHIVAVSCENITLSGGMVRQKAKYERFLNKRSVS  62

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P HG + FRAPS+ILWRT+RGM+P
Sbjct  63   NPRHGAVKFRAPSRILWRTVRGMVP  87



>gb|ABX75375.1| 60S ribosomal protein L13A [Lycosa singoriensis]
Length=205

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +1

Query  70   SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  249
            +G   + +V+D R H+LGRLA++ AK LLNGQ+VVVVRCE I +SG   R K+KY  FLR
Sbjct  2    TGFSEKAIVIDGRGHLLGRLAALTAKTLLNGQKVVVVRCEGINISGSFFRSKLKYLSFLR  61

Query  250  KRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            KR N  P+ GP HFRAPSKI WRT+RGM+P
Sbjct  62   KRCNVNPARGPFHFRAPSKIFWRTVRGMLP  91



>gb|ETB58080.1| ribosomal protein L13, variant [Plasmodium yoelii 17X]
 emb|CDU19221.1| 60S ribosomal protein L13, putative [Plasmodium yoelii]
 emb|CDZ13524.1| 60S ribosomal protein L13, putative [Plasmodium yoelii]
Length=202

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +  V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT
Sbjct  4    KEYVIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNKLKYQEFLRLRTNT  63

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P  GP+H R PSKILWR +RGM+P
Sbjct  64   NPKKGPLHLREPSKILWRCVRGMLP  88



>emb|CDR14435.1| 60S ribosomal protein L13, putative [Plasmodium chabaudi chabaudi]
Length=202

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +  V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT
Sbjct  4    KEYVIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNKLKYQEFLRLRTNT  63

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P  GP+H R PSKILWR +RGM+P
Sbjct  64   NPKKGPLHLREPSKILWRCVRGMLP  88



>emb|CDS48985.1| 60S ribosomal protein L13, putative [Plasmodium berghei ANKA]
Length=202

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +  V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT
Sbjct  4    KEYVIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNKLKYQEFLRLRTNT  63

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P  GP+H R PSKILWR +RGM+P
Sbjct  64   NPKKGPLHLREPSKILWRCVRGMLP  88



>gb|AGJ03561.1| large subunit ribosomal protein 16, partial [Pristionchus sp. 
1 EJR-2013]
Length=198

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +V+D ++H+LGRLASI+AK++L GQ+VVVVRCEEIC+SG   R K+KY  FLRKR N  P
Sbjct  3    LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP  62

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GP H R+PSKILWRTIRGM+P
Sbjct  63   RRGPFHLRSPSKILWRTIRGMVP  85



>ref|XP_728218.1| ribosomal protein L13 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA19783.1| ribosomal protein L13, putative [Plasmodium yoelii yoelii]
Length=198

 Score =   122 bits (307),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  273
            V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT P 
Sbjct  3    VIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNKLKYQEFLRLRTNTNPK  62

Query  274  HGPIHFRAPSKILWRTIRGMIP  339
             GP+H R PSKILWR +RGM+P
Sbjct  63   KGPLHLREPSKILWRCVRGMLP  84



>gb|KIY96173.1| 60S ribosomal protein L13a-1 [Monoraphidium neglectum]
Length=86

 Score =   119 bits (298),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +1

Query  88   RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTK  267
            R V+DAR HMLGRLASI+AK++L G ++VVVR EEI +SGGLVRQ+MKY RFL+KR NT 
Sbjct  5    RQVIDARAHMLGRLASIVAKQILAGHQIVVVRAEEITISGGLVRQRMKYSRFLQKRHNTN  64

Query  268  PSH-GPIHFRAPSKILWRTIRG  330
            P+  GP HFRAPS+I WRT+RG
Sbjct  65   PNRAGPWHFRAPSRIFWRTVRG  86



>ref|XP_744909.1| ribosomal protein L13 [Plasmodium chabaudi chabaudi]
 emb|CAH78466.1| ribosomal protein L13, putative [Plasmodium chabaudi chabaudi]
Length=198

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  273
            V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT P 
Sbjct  3    VIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNKLKYQEFLRLRTNTNPK  62

Query  274  HGPIHFRAPSKILWRTIRGMIP  339
             GP+H R PSKILWR +RGM+P
Sbjct  63   KGPLHLREPSKILWRCVRGMLP  84



>ref|XP_677215.1| ribosomal protein L13 [Plasmodium berghei strain ANKA]
 emb|CAH99579.1| ribosomal protein L13, putative [Plasmodium berghei]
Length=198

 Score =   122 bits (306),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  273
            V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT P 
Sbjct  3    VIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNKLKYQEFLRLRTNTNPK  62

Query  274  HGPIHFRAPSKILWRTIRGMIP  339
             GP+H R PSKILWR +RGM+P
Sbjct  63   KGPLHLREPSKILWRCVRGMLP  84



>ref|XP_001614348.1| 60S ribosomal protein L13a [Plasmodium vivax Sal-1]
 gb|EDL44621.1| 60S ribosomal protein L13a, putative [Plasmodium vivax]
Length=202

 Score =   122 bits (306),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  273
            V+D + H+LGRLASI+AKELLNGQRVV VRCE+I +SG L R K+KY  FLR R NT P 
Sbjct  7    VIDCKGHLLGRLASIIAKELLNGQRVVAVRCEDINISGSLYRNKLKYQEFLRLRTNTNPK  66

Query  274  HGPIHFRAPSKILWRTIRGMIP  339
             GP+H R PSKILWR +RGM+P
Sbjct  67   KGPLHLREPSKILWRCVRGMLP  88



>gb|KGG52418.1| 60S ribosomal protein L16 [Microsporidia sp. UGP3]
Length=203

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            VV+D + H+LGRLASI+AK++L+GQ+VVVVRCEE+ +SG   R K+KY  FLRKR    P
Sbjct  7    VVIDGKGHLLGRLASIVAKQILSGQKVVVVRCEELNMSGSFYRAKLKYKDFLRKRCIVNP  66

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            +HG IHFRAPSKI WRT+RGM+P
Sbjct  67   THGAIHFRAPSKIFWRTVRGMVP  89



>gb|AGJ03609.1| large subunit ribosomal protein 16, partial [Pristionchus sp. 
2 EJR-2013]
Length=198

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +V+D ++H+LGRLASI+AK++L GQ+VVVVRCEEIC+SG   R K+KY  FLRKR N  P
Sbjct  3    LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP  62

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GP H R+PSKILWRT+RGM+P
Sbjct  63   RRGPFHLRSPSKILWRTVRGMVP  85



>ref|XP_626048.1| 60S ribosomal protein L13A [Cryptosporidium parvum Iowa II]
 gb|EAK88252.1| 60S ribosomal protein L13A [Cryptosporidium parvum Iowa II]
Length=204

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  88   RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTK  267
            ++V+D R  +LGRLAS++AKELLNGQ++V VRCE I +SG L R +MKY  FLRKRMNT 
Sbjct  7    KIVIDCRGSLLGRLASVIAKELLNGQKIVAVRCEGINISGSLYRNRMKYQDFLRKRMNTN  66

Query  268  PSHGPIHFRAPSKILWRTIRGMIP  339
            P  GP H RAPSKIL+R +RGMIP
Sbjct  67   PRKGPFHHRAPSKILFRAVRGMIP  90



>gb|KFM61542.1| 60S ribosomal protein L13a, partial [Stegodyphus mimosarum]
Length=205

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +1

Query  70   SGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  249
            +G   + +++D R H+LGRLA++ AK LLNGQ+VVVVRC+ I +SG   R K+KY  FLR
Sbjct  2    TGFSEKAIIIDGRGHLLGRLAALTAKTLLNGQKVVVVRCDGINISGSFFRSKLKYLSFLR  61

Query  250  KRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            KR N  P+ GP HFRAPSKI WRT+RGM+P
Sbjct  62   KRCNVNPARGPFHFRAPSKIFWRTVRGMLP  91



>ref|XP_003746303.1| PREDICTED: 60S ribosomal protein L13a-like [Metaseiulus occidentalis]
Length=205

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  73   GICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRK  252
            G     VV+D + H+LGRLAS++AK LL GQ+VVVVRCE + +SGGL R K+KY  FL+K
Sbjct  3    GFTEAPVVIDGKGHLLGRLASLVAKTLLTGQKVVVVRCESLVISGGLFRNKLKYLSFLKK  62

Query  253  RMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            R N  P+ GP HFRAPS+I WRT+RGM+P
Sbjct  63   RCNVNPTRGPFHFRAPSRIFWRTVRGMLP  91



>gb|ETB58079.1| ribosomal protein L13 [Plasmodium yoelii 17X]
Length=212

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  94   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  273
            V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT P 
Sbjct  17   VIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNKLKYQEFLRLRTNTNPK  76

Query  274  HGPIHFRAPSKILWRTIRGMIP  339
             GP+H R PSKILWR +RGM+P
Sbjct  77   KGPLHLREPSKILWRCVRGMLP  98



>ref|XP_668473.1| 60S ribosomal protein L13a [Cryptosporidium hominis TU502]
Length=202

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  88   RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTK  267
            ++V+D R  +LGRLAS++AKELLNGQ++V VRCE I +SG L R +MKY  FLRKRMNT 
Sbjct  5    KIVIDCRGSLLGRLASVIAKELLNGQKIVAVRCEGINISGSLYRNRMKYQDFLRKRMNTN  64

Query  268  PSHGPIHFRAPSKILWRTIRGMIP  339
            P  GP H RAPSKIL+R +RGMIP
Sbjct  65   PRKGPFHHRAPSKILFRAVRGMIP  88



>emb|CDO64471.1| 60S ribosomal protein L13, putative [Plasmodium reichenowi]
Length=202

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +  V+D + H+LGRLAS++AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT
Sbjct  4    KEYVIDCKGHLLGRLASLIAKELLNGQRIVAVRCEDINISGSLYRNKLKYQEFLRLRTNT  63

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P  GP+H R PSKILWR +RGM+P
Sbjct  64   NPKKGPLHLREPSKILWRCVRGMLP  88



>ref|XP_002741044.1| PREDICTED: 60S ribosomal protein L13a-like isoform X1 [Saccoglossus 
kowalevskii]
Length=202

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +++DAR H+LGRLASI AK +L GQRVV+VRCE I +SG L R K+K+ +FLRKR NTKP
Sbjct  7    LLIDARGHLLGRLASITAKTILQGQRVVLVRCEGIVISGSLYRNKLKFLQFLRKRTNTKP  66

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
            S GP HFRAPS++ WR +RGM+P
Sbjct  67   SRGPFHFRAPSRVFWRVVRGMLP  89



>ref|XP_001347328.1| 60S ribosomal protein L13, putative [Plasmodium falciparum 3D7]
 pdb|1VX7|K Chain K, Cryo-em Structure Of The Plasmodium Falciparum 80s Ribosome 
Bound To The Anti-protozoan Drug Emetine, Large Subunit 
(protein Only)
 gb|AAN35241.1| 60S ribosomal protein L13, putative [Plasmodium falciparum 3D7]
 gb|ETW18202.1| ribosomal protein L13 [Plasmodium falciparum Vietnam Oak-Knoll 
(FVO)]
 gb|ETW49216.1| ribosomal protein L13 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW56778.1| ribosomal protein L13 [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW61271.1| ribosomal protein L13 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR72011.1| ribosomal protein L13 [Plasmodium falciparum 7G8]
Length=202

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +  V+D + H+LGRLAS++AKELLNGQR+V VRCE+I +SG L R K+KY  FLR R NT
Sbjct  4    KEYVIDCKGHLLGRLASLIAKELLNGQRIVAVRCEDINISGSLYRNKLKYQEFLRLRTNT  63

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P  GP+H R PSKILWR +RGM+P
Sbjct  64   NPKKGPLHLREPSKILWRCVRGMLP  88



>gb|ABR87187.1| large subunit ribosomal protein 16 [Pristionchus uniformis]
Length=198

 Score =   122 bits (305),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +V+D ++H+LGRLASI+AK++L GQ+VVVVRCEEIC+SG   R K+KY  FLRKR N  P
Sbjct  3    LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP  62

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GP H R+PS+ILWRTIRGM+P
Sbjct  63   RRGPFHLRSPSRILWRTIRGMVP  85



>gb|ABR87184.1| large subunit ribosomal protein 16 [Pristionchus maupasi]
 gb|ABR87190.1| large subunit ribosomal protein 16 [Pristionchus aerivorus]
 gb|ABR87194.1| large subunit ribosomal protein 16 [Pristionchus pseudaerivorus]
 gb|ABR87197.1| large subunit ribosomal protein 16 [Pristionchus americanus]
 gb|AGJ03585.1| large subunit ribosomal protein 16, partial [Pristionchus sp. 
3 EJR-2013]
Length=198

 Score =   122 bits (305),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  91   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  270
            +V+D ++H+LGRLASI+AK++L GQ+VVVVRCEEIC+SG   R K+KY  FLRKR N  P
Sbjct  3    LVIDGKNHLLGRLASIIAKQILLGQKVVVVRCEEICISGNFHRSKLKYMSFLRKRCNVNP  62

Query  271  SHGPIHFRAPSKILWRTIRGMIP  339
              GP H R+PS+ILWRTIRGM+P
Sbjct  63   RRGPFHLRSPSRILWRTIRGMVP  85



>ref|XP_008623266.1| 50S ribosomal protein L13Ae [Plasmodium vinckei vinckei]
 gb|EUD69732.1| 50S ribosomal protein L13Ae [Plasmodium vinckei petteri]
 gb|KEG03342.1| 50S ribosomal protein L13Ae [Plasmodium vinckei vinckei]
Length=202

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +  V+D + HMLGRLASI+AKELLNGQR+V VRCE+I +SG L R ++KY  FLR R NT
Sbjct  4    KEYVIDCKGHMLGRLASIIAKELLNGQRIVAVRCEDIDISGSLYRNRLKYQEFLRLRTNT  63

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P  GP+H R PSKILWR +RGM+P
Sbjct  64   NPKKGPLHLREPSKILWRCVRGMLP  88



>ref|XP_004990512.1| ribosomal protein L13Ae [Salpingoeca rosetta]
 gb|EGD77624.1| ribosomal protein L13Ae [Salpingoeca rosetta]
Length=198

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  85   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  264
            +R+V+DAR H+LGRLASI+AKE+L+GQ VVVVRCE+I +SG   R K+KY  FLRKR N 
Sbjct  4    KRIVIDARGHLLGRLASIVAKEILSGQHVVVVRCEQINISGSFYRNKLKYKEFLRKRCNV  63

Query  265  KPSHGPIHFRAPSKILWRTIRGMIP  339
             P+ GP H RAPS+I WR +RGM+P
Sbjct  64   NPARGPFHLRAPSRIFWRVVRGMLP  88



>emb|CDP94445.1| Protein BM-RPL-16, isoform a [Brugia malayi]
Length=226

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +1

Query  43   EDAAKMVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQ  222
            +  A+ +   G+  + ++VD + H+LGRLAS++AK+LL GQ++V+VRCE+I +SG   R 
Sbjct  15   QGVAQQLHTMGLVDKPIIVDGKDHLLGRLASVVAKQLLLGQKIVIVRCEDIAISGNFHRS  74

Query  223  KMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  339
            K+K+  FLRKR N KP+ GP HFRAPS+I WRT+RGM+P
Sbjct  75   KLKFMSFLRKRCNVKPARGPYHFRAPSRIFWRTVRGMLP  113



>ref|XP_002139370.1| 60S ribosomal protein L13a [Cryptosporidium muris RN66]
 gb|EEA05021.1| 60S ribosomal protein L13a, putative [Cryptosporidium muris RN66]
Length=202

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  88   RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTK  267
            ++V+D R  +LGRLASI+AKELLNGQ+++ VRCE+I +SG L R +MKY  FLRKRMNT 
Sbjct  5    QIVIDCRGALLGRLASIIAKELLNGQKIIAVRCEDINVSGSLYRNRMKYQDFLRKRMNTN  64

Query  268  PSHGPIHFRAPSKILWRTIRGMIP  339
            P  GP H R+PS+IL+RT+RGMIP
Sbjct  65   PRRGPFHHRSPSRILFRTVRGMIP  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558646673120