BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015M22

Length=450
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615526.1|  PREDICTED: uncharacterized protein LOC104108246    127   7e-33   Nicotiana tomentosiformis
emb|CDP00784.1|  unnamed protein product                                131   9e-33   Coffea canephora [robusta coffee]
gb|EYU30069.1|  hypothetical protein MIMGU_mgv1a003875mg                124   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...    124   3e-30   Nicotiana sylvestris
ref|XP_009785420.1|  PREDICTED: uncharacterized protein At1g04910...    120   2e-29   Nicotiana sylvestris
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g             119   2e-28   Phaseolus vulgaris [French bean]
ref|XP_004498295.1|  PREDICTED: uncharacterized protein At1g04910...    118   2e-28   
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910       119   3e-28   Vitis vinifera
gb|KDP38063.1|  hypothetical protein JCGZ_04706                         119   3e-28   Jatropha curcas
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...    118   4e-28   Cicer arietinum [garbanzo]
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...    118   4e-28   Cicer arietinum [garbanzo]
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910       118   5e-28   Eucalyptus grandis [rose gum]
emb|CAN77011.1|  hypothetical protein VITISV_036881                     118   5e-28   Vitis vinifera
ref|XP_004150597.1|  PREDICTED: DUF246 domain-containing protein ...    117   8e-28   
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...    117   8e-28   Glycine max [soybeans]
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...    117   9e-28   Cicer arietinum [garbanzo]
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...    117   9e-28   Cucumis melo [Oriental melon]
gb|KJB50369.1|  hypothetical protein B456_008G166900                    117   9e-28   Gossypium raimondii
gb|KDO64643.1|  hypothetical protein CISIN_1g008637mg                   115   1e-27   Citrus sinensis [apfelsine]
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                   116   2e-27   Citrus sinensis [apfelsine]
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...    116   2e-27   Citrus sinensis [apfelsine]
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg             116   2e-27   Citrus clementina [clementine]
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910       116   2e-27   Solanum lycopersicum
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...    116   3e-27   Glycine max [soybeans]
gb|KDO64644.1|  hypothetical protein CISIN_1g008637mg                   114   4e-27   Citrus sinensis [apfelsine]
gb|EPS64269.1|  hypothetical protein M569_10511                         114   6e-27   Genlisea aurea
gb|KHG19963.1|  hypothetical protein F383_04918                         114   9e-27   Gossypium arboreum [tree cotton]
ref|XP_010262779.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-26   
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-26   Nelumbo nucifera [Indian lotus]
gb|KEH30846.1|  O-fucosyltransferase family protein                     114   2e-26   Medicago truncatula
ref|XP_006355101.1|  PREDICTED: uncharacterized protein At1g04910...    112   2e-26   Solanum tuberosum [potatoes]
ref|XP_010262908.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-26   
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-26   Populus euphratica
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...    113   4e-26   Solanum tuberosum [potatoes]
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g             113   4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...    112   1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910       111   1e-25   Populus euphratica
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g             111   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010262851.1|  PREDICTED: uncharacterized protein At1g04910...    110   2e-25   
ref|XP_010262705.1|  PREDICTED: uncharacterized protein At1g04910...    110   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...    110   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910       108   1e-24   Prunus mume [ume]
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg             108   1e-24   Prunus persica
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...    107   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_008389213.1|  PREDICTED: uncharacterized protein LOC103451575    103   3e-24   
gb|KFK33363.1|  hypothetical protein AALP_AA5G004000                    107   3e-24   Arabis alpina [alpine rockcress]
gb|KHG09805.1|  hypothetical protein F383_15167                         106   8e-24   Gossypium arboreum [tree cotton]
ref|XP_010093364.1|  hypothetical protein L484_022926                   106   9e-24   Morus notabilis
ref|NP_178257.1|  O-fucosyltransferase family protein                   106   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129233.1|  PREDICTED: uncharacterized protein At1g04910...    106   1e-23   Brassica rapa
ref|XP_010502128.1|  PREDICTED: uncharacterized protein At1g04910...    106   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010513871.1|  PREDICTED: uncharacterized protein At1g04910...    106   1e-23   Camelina sativa [gold-of-pleasure]
emb|CDY52384.1|  BnaCnng22220D                                          106   1e-23   Brassica napus [oilseed rape]
gb|KJB15425.1|  hypothetical protein B456_002G178200                    106   1e-23   Gossypium raimondii
ref|XP_006290827.1|  hypothetical protein CARUB_v10016938mg             106   1e-23   Capsella rubella
gb|KJB15424.1|  hypothetical protein B456_002G178200                    106   1e-23   Gossypium raimondii
ref|XP_002875074.1|  hypothetical protein ARALYDRAFT_484066             105   1e-23   
emb|CDY65925.1|  BnaC07g48790D                                          105   2e-23   Brassica napus [oilseed rape]
ref|XP_009101345.1|  PREDICTED: uncharacterized protein At1g04910...    105   2e-23   Brassica rapa
ref|XP_009101344.1|  PREDICTED: uncharacterized protein At1g04910...    105   2e-23   Brassica rapa
ref|XP_006398540.1|  hypothetical protein EUTSA_v10000838mg             105   3e-23   Eutrema salsugineum [saltwater cress]
gb|KHG09806.1|  hypothetical protein F383_15167                         104   4e-23   Gossypium arboreum [tree cotton]
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...    104   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...    104   4e-23   Malus domestica [apple tree]
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...    104   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...    103   4e-23   
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...    104   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...    104   6e-23   Elaeis guineensis
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                  103   1e-22   
gb|KJB30799.1|  hypothetical protein B456_005G161000                    103   2e-22   Gossypium raimondii
gb|AES59903.2|  O-fucosyltransferase family protein                     102   2e-22   Medicago truncatula
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...    101   5e-22   
ref|XP_007045152.1|  O-fucosyltransferase family protein                100   1e-21   Theobroma cacao [chocolate]
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...    100   2e-21   
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg           99.0    4e-21   Capsella rubella
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685           99.0    5e-21   
gb|AAF31019.1|AC012189_1  Contains similarity to atypical PKC spe...  93.6    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...  98.2    8e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...  95.1    1e-19   Elaeis guineensis
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...  94.7    1e-19   Sesamum indicum [beniseed]
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910     94.4    2e-19   Fragaria vesca subsp. vesca
ref|NP_172950.1|  O-fucosyltransferase family protein                 93.6    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002526030.1|  conserved hypothetical protein                   93.6    4e-19   Ricinus communis
ref|XP_006416955.1|  hypothetical protein EUTSA_v10007261mg           93.2    4e-19   Eutrema salsugineum [saltwater cress]
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...  92.4    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...  92.4    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...  92.0    1e-18   
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...  92.0    1e-18   
ref|XP_010476573.1|  PREDICTED: uncharacterized protein At1g04910...  91.3    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010476572.1|  PREDICTED: uncharacterized protein At1g04910...  91.3    3e-18   Camelina sativa [gold-of-pleasure]
emb|CDY33727.1|  BnaA09g45330D                                        89.4    1e-17   Brassica napus [oilseed rape]
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560        89.0    2e-17   Amborella trichopoda
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                  88.2    3e-17   Arabis alpina [alpine rockcress]
emb|CDX81687.1|  BnaC08g39140D                                        87.8    4e-17   
ref|XP_009117860.1|  PREDICTED: uncharacterized protein At1g04910...  84.7    4e-16   Brassica rapa
ref|XP_010318109.1|  PREDICTED: uncharacterized protein At1g04910...  83.6    7e-16   
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450        83.6    1e-15   Sorghum bicolor [broomcorn]
ref|XP_004235088.1|  PREDICTED: uncharacterized protein At1g04910...  83.6    1e-15   Solanum lycopersicum
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910     83.6    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_006342313.1|  PREDICTED: uncharacterized protein At1g04910...  82.4    2e-15   Solanum tuberosum [potatoes]
ref|XP_008674839.1|  PREDICTED: uncharacterized protein At1g04910...  82.8    2e-15   Zea mays [maize]
ref|XP_006342311.1|  PREDICTED: uncharacterized protein At1g04910...  82.4    3e-15   Solanum tuberosum [potatoes]
ref|XP_006342312.1|  PREDICTED: uncharacterized protein At1g04910...  82.0    3e-15   Solanum tuberosum [potatoes]
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...  82.4    3e-15   
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg           81.6    5e-15   
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...  81.3    8e-15   Tarenaya hassleriana [spider flower]
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...  80.5    1e-14   Glycine max [soybeans]
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...  80.1    2e-14   Cicer arietinum [garbanzo]
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...  79.7    2e-14   Glycine max [soybeans]
ref|XP_009379526.1|  PREDICTED: uncharacterized protein At1g04910...  79.7    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...  79.7    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g           79.7    2e-14   Phaseolus vulgaris [French bean]
ref|XP_008656363.1|  PREDICTED: uncharacterized protein At1g04910...  79.3    3e-14   
gb|AFW82218.1|  hypothetical protein ZEAMMB73_014086                  79.3    3e-14   
ref|XP_008656362.1|  PREDICTED: uncharacterized protein At1g04910...  79.3    4e-14   Zea mays [maize]
ref|XP_008656364.1|  PREDICTED: uncharacterized protein At1g04910...  78.6    4e-14   
gb|KJB28878.1|  hypothetical protein B456_005G074200                  77.8    7e-14   Gossypium raimondii
ref|XP_008347877.1|  PREDICTED: DDB1- and CUL4-associated factor ...  76.3    8e-14   
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910     78.2    8e-14   Fragaria vesca subsp. vesca
gb|KJB28877.1|  hypothetical protein B456_005G074200                  78.2    8e-14   Gossypium raimondii
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...  78.2    1e-13   Glycine max [soybeans]
ref|XP_002439920.1|  hypothetical protein SORBIDRAFT_09g022540        74.7    1e-13   
gb|KHN47089.1|  DUF246 domain-containing protein                      77.8    1e-13   Glycine soja [wild soybean]
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...  77.4    1e-13   
gb|KDP34835.1|  hypothetical protein JCGZ_11197                       77.4    2e-13   Jatropha curcas
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910     77.4    2e-13   Sesamum indicum [beniseed]
ref|XP_004499554.1|  PREDICTED: uncharacterized protein At1g04910...  77.0    2e-13   Cicer arietinum [garbanzo]
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1    77.4    2e-13   
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...  77.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_007020036.1|  O-fucosyltransferase family protein isoform 2    76.3    3e-13   Theobroma cacao [chocolate]
ref|XP_008649713.1|  PREDICTED: uncharacterized protein At1g04910...  75.5    5e-13   Zea mays [maize]
gb|AFW78262.1|  hypothetical protein ZEAMMB73_416738                  75.5    6e-13   
ref|XP_008649712.1|  PREDICTED: uncharacterized protein At1g04910...  75.9    6e-13   Zea mays [maize]
ref|XP_008649711.1|  PREDICTED: uncharacterized protein At1g04910...  75.9    6e-13   Zea mays [maize]
ref|XP_010104480.1|  hypothetical protein L484_025449                 73.6    7e-13   
ref|XP_008352830.1|  PREDICTED: uncharacterized protein YGR130C-like  75.1    1e-12   
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg              74.7    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_008368398.1|  PREDICTED: uncharacterized protein At1g04910...  73.9    2e-12   
ref|XP_006841301.1|  hypothetical protein AMTR_s00134p00089540        69.7    4e-12   
emb|CDY39592.1|  BnaC05g11210D                                        72.8    6e-12   Brassica napus [oilseed rape]
ref|XP_008339228.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    1e-11   
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910     72.0    1e-11   Brassica rapa
ref|XP_002533585.1|  conserved hypothetical protein                   71.6    1e-11   Ricinus communis
ref|XP_006387763.1|  hypothetical protein POPTR_0603s002101g          68.2    1e-11   
dbj|BAJ88036.1|  predicted protein                                    71.6    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910     70.9    3e-11   Nicotiana tomentosiformis
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g           70.9    3e-11   
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910     70.9    3e-11   Populus euphratica
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910     70.9    3e-11   Nicotiana sylvestris
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910     70.9    3e-11   Cucumis melo [Oriental melon]
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    3e-11   Tarenaya hassleriana [spider flower]
emb|CDY03127.1|  BnaC06g08460D                                        70.1    5e-11   
ref|XP_004963730.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    6e-11   
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...  69.7    6e-11   Cucumis sativus [cucumbers]
ref|NP_001055751.1|  Os05g0459600                                     69.7    7e-11   
emb|CDY36519.1|  BnaA06g09720D                                        69.7    7e-11   Brassica napus [oilseed rape]
gb|EEC79353.1|  hypothetical protein OsI_20224                        69.7    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    9e-11   
ref|XP_003598018.1|  DUF246 domain-containing protein                 69.3    9e-11   
gb|AAK93632.1|  putative growth regulator protein                     69.3    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564461.1|  O-fucosyltransferase-like protein                   69.3    9e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66921.1|  BnaAnng23210D                                        68.9    1e-10   Brassica napus [oilseed rape]
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910     68.2    2e-10   Brassica rapa
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680           67.8    3e-10   
ref|XP_003568305.1|  PREDICTED: uncharacterized protein At1g04910...  67.0    6e-10   Brachypodium distachyon [annual false brome]
ref|XP_002984324.1|  hypothetical protein SELMODRAFT_268854           66.6    7e-10   
gb|AAF79365.1|AC007887_24  F15O4.45                                   66.6    8e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61677.1|  hypothetical protein M569_13117                       65.9    1e-09   Genlisea aurea
ref|XP_010061980.1|  PREDICTED: uncharacterized protein At1g04910...  65.9    1e-09   
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...  66.2    1e-09   Eucalyptus grandis [rose gum]
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...  65.5    2e-09   Solanum tuberosum [potatoes]
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...  65.5    2e-09   
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910     65.5    2e-09   Vitis vinifera
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...  65.1    2e-09   Solanum lycopersicum
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...  65.1    3e-09   Solanum lycopersicum
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                  64.7    4e-09   Arabis alpina [alpine rockcress]
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg           64.3    4e-09   
gb|KDO83868.1|  hypothetical protein CISIN_1g008308mg                 63.9    5e-09   Citrus sinensis [apfelsine]
ref|XP_006473172.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    6e-09   
gb|KCW69027.1|  hypothetical protein EUGRSUZ_F02582                   63.9    6e-09   Eucalyptus grandis [rose gum]
emb|CAN77312.1|  hypothetical protein VITISV_026198                   62.8    6e-09   Vitis vinifera
emb|CDP10650.1|  unnamed protein product                              63.9    6e-09   Coffea canephora [robusta coffee]
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    7e-09   
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    8e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    8e-09   Nelumbo nucifera [Indian lotus]
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg           63.5    8e-09   
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...  63.2    9e-09   Nelumbo nucifera [Indian lotus]
gb|KDO83867.1|  hypothetical protein CISIN_1g008308mg                 63.2    1e-08   Citrus sinensis [apfelsine]
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg           63.2    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002972493.1|  hypothetical protein SELMODRAFT_441812           60.8    8e-08   
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg           57.4    8e-07   Capsella rubella
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008781542.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    2e-06   
ref|XP_008781543.1|  PREDICTED: uncharacterized protein At1g04910...  55.1    4e-06   
ref|XP_001760728.1|  predicted protein                                53.5    2e-05   
gb|AAF79229.1|AC006917_14  F10B6.36                                   48.9    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  48.5    5e-04   
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...  48.1    8e-04   Elaeis guineensis
gb|EEE55649.1|  hypothetical protein OsJ_04031                        48.1    8e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71770.1|  hypothetical protein OsI_04380                        48.1    9e-04   Oryza sativa Indica Group [Indian rice]



>ref|XP_009615526.1| PREDICTED: uncharacterized protein LOC104108246 [Nicotiana tomentosiformis]
Length=246

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FTPGQP PRTLA R AW++LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP I+H  
Sbjct  48   FTPGQPGPRTLAHRLAWVILSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPNIRHHP  107

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  108  APGSLYRSPQLY  119



>emb|CDP00784.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FTPGQP P+T AQR AW++LS+LLRRQGIFLFAPLLYISGMLFYMGTVSFD VPII HR 
Sbjct  35   FTPGQPGPKTAAQRIAWLILSLLLRRQGIFLFAPLLYISGMLFYMGTVSFDVVPIINHRR  94

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  95   APGSVYRSPQLY  106



>gb|EYU30069.1| hypothetical protein MIMGU_mgv1a003875mg [Erythranthe guttata]
Length=558

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  419
            G+P P+TLAQR AWI+LSVLL+RQGIFLFAPLLYI+GMLFYMGTVSFD VP+IKHR  PG
Sbjct  37   GRPPPKTLAQRLAWIVLSVLLKRQGIFLFAPLLYIAGMLFYMGTVSFDVVPVIKHRPAPG  96

Query  420  SIYRSPQLY  446
            S+YRSPQLY
Sbjct  97   SVYRSPQLY  105



>ref|XP_009785418.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009785419.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/72 (79%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT GQP  RTLA R AW +LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP I+H  
Sbjct  48   FTSGQPGQRTLAHRLAWFILSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPNIRHHP  107

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  108  APGSLYRSPQLY  119



>ref|XP_009785420.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nicotiana 
sylvestris]
Length=468

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT GQP  RTLA R AW +LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP I+H  
Sbjct  48   FTSGQPGQRTLAHRLAWFILSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPNIRHHP  107

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  108  APGSLYRSPQLY  119



>ref|XP_007157752.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
 gb|ESW29746.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
Length=563

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P + + RT AQR +W+ LSVLLRRQG+FLFAPL+YISGML YMGT SFD VP+IKHR 
Sbjct  37   FSPNRGSGRTAAQRLSWMFLSVLLRRQGVFLFAPLIYISGMLLYMGTASFDVVPVIKHRP  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  97   APGSVYRSPQLY  108



>ref|XP_004498295.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Cicer arietinum]
Length=457

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P QP PRT AQR AW+ LSVLLRRQG+FLFAPL+YISGML Y GT SFD  PII+HR 
Sbjct  37   FSPPQPPPRTFAQRLAWVFLSVLLRRQGVFLFAPLIYISGMLLYFGTFSFDVNPIIRHRP  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  97   APGSVYRSPQLY  108



>ref|XP_002284457.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI26895.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F  GQ   RT AQR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  35   FAAGQQPGRTFAQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  94

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  95   APGSVYRSPQVY  106



>gb|KDP38063.1| hypothetical protein JCGZ_04706 [Jatropha curcas]
Length=561

 Score =   119 bits (297),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTPG-QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP   P  RT+A R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKH+
Sbjct  36   FTPASHPPGRTVAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHK  95

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQLY
Sbjct  96   PAPGSVYRSPQLY  108



>ref|XP_004498294.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=519

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P QP PRT AQR AW+ LSVLLRRQG+FLFAPL+YISGML Y GT SFD  PII+HR 
Sbjct  37   FSPPQPPPRTFAQRLAWVFLSVLLRRQGVFLFAPLIYISGMLLYFGTFSFDVNPIIRHRP  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  97   APGSVYRSPQLY  108



>ref|XP_004498293.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=563

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P QP PRT AQR AW+ LSVLLRRQG+FLFAPL+YISGML Y GT SFD  PII+HR 
Sbjct  37   FSPPQPPPRTFAQRLAWVFLSVLLRRQGVFLFAPLIYISGMLLYFGTFSFDVNPIIRHRP  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  97   APGSVYRSPQLY  108



>ref|XP_010066619.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW64583.1| hypothetical protein EUGRSUZ_G02181 [Eucalyptus grandis]
Length=564

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +3

Query  231  FTPG--QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKH  404
            FTP   Q   RTLAQR AW+LLS LLRRQG+FLFAPL+YISGML YMGTV FD VP+IKH
Sbjct  36   FTPAAAQQPGRTLAQRVAWLLLSCLLRRQGVFLFAPLIYISGMLLYMGTVKFDVVPVIKH  95

Query  405  RATPGSIYRSPQLY  446
            R  PGS+YRSPQLY
Sbjct  96   RPAPGSVYRSPQLY  109



>emb|CAN77011.1| hypothetical protein VITISV_036881 [Vitis vinifera]
Length=575

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F  GQ   RT AQR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  35   FAAGQQPGRTFAQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  94

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  95   APGSVYRSPQVY  106



>ref|XP_004150597.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004164435.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN51494.1| hypothetical protein Csa_5G570390 [Cucumis sativus]
Length=563

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT  Q   RT  QR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  37   FTQAQQPGRTFPQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  96

Query  411  TPGSIYRSPQL  443
             PGS+YRSPQL
Sbjct  97   APGSVYRSPQL  107



>ref|XP_003529417.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=564

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P + + RT AQR +W+ LSVLLRRQG+FLFAPL+YISGML YMGT SFD VP+IKHR 
Sbjct  38   FSPSRGSGRTAAQRLSWMFLSVLLRRQGVFLFAPLIYISGMLLYMGTASFDVVPVIKHRP  97

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQL+
Sbjct  98   APGSVYRSPQLF  109



>ref|XP_004505284.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=560

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            ++LAQR +W+LLSVLLRRQGIFLFAPL+YISGML YMGT SFD VPIIKHR  PGSIYRS
Sbjct  42   KSLAQRLSWMLLSVLLRRQGIFLFAPLIYISGMLLYMGTASFDVVPIIKHRPAPGSIYRS  101

Query  435  PQLY  446
            PQLY
Sbjct  102  PQLY  105



>ref|XP_008467134.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=563

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT  Q   RT  QR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  37   FTQAQQPGRTFPQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  96

Query  411  TPGSIYRSPQL  443
             PGS+YRSPQL
Sbjct  97   APGSVYRSPQL  107



>gb|KJB50369.1| hypothetical protein B456_008G166900 [Gossypium raimondii]
Length=561

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P QP  RT+A   AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP++KHR 
Sbjct  36   FSPFQPG-RTVAHHVAWLLLSVLLRRQGIFLFAPLIYISGMLIYMGTVSFDVVPLVKHRP  94

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  95   APGSVYRSPQVY  106



>gb|KDO64643.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=448

 Score =   115 bits (289),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  97   PAPGSVYRSPQVY  109



>gb|KDO64642.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=558

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  97   PAPGSVYRSPQVY  109



>ref|XP_006469184.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=558

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  97   PAPGSVYRSPQVY  109



>ref|XP_006448248.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
 gb|ESR61488.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
Length=558

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  97   PAPGSVYRSPQVY  109



>ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
 ref|XP_010320701.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=581

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT GQ  PRTLA R +  +LSVL+RRQGIFLFAPLLYI+G+LFYMGTV FD VPII+HR 
Sbjct  55   FTSGQQLPRTLANRISGAILSVLVRRQGIFLFAPLLYIAGILFYMGTVPFDVVPIIRHRP  114

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  115  APGSVYRSPQLY  126



>ref|XP_003556095.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 ref|XP_006605495.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=564

 Score =   116 bits (290),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P + + RT AQ+ +W+ LSVLLRRQG+FLFAPL+YISGML YMGT SFD VP+IKHR 
Sbjct  38   FSPSRGSGRTAAQQLSWMFLSVLLRRQGVFLFAPLIYISGMLLYMGTASFDVVPVIKHRP  97

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQL+
Sbjct  98   APGSVYRSPQLF  109



>gb|KDO64644.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=360

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  97   PAPGSVYRSPQVY  109



>gb|EPS64269.1| hypothetical protein M569_10511, partial [Genlisea aurea]
Length=390

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  419
             +  P+TL QR + I+LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP+IKHR  PG
Sbjct  36   SRSTPKTLRQRLSGIVLSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPVIKHRKPPG  95

Query  420  SIYRSPQLY  446
            SIYRSPQLY
Sbjct  96   SIYRSPQLY  104



>gb|KHG19963.1| hypothetical protein F383_04918 [Gossypium arboreum]
Length=561

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P QP  RT+A   AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP++KHR 
Sbjct  36   FSPFQPG-RTVAHHVAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPLVKHRP  94

Query  411  TPGSIYRSPQLY  446
             PGS+YRS Q+Y
Sbjct  95   APGSVYRSTQVY  106



>ref|XP_010262779.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Nelumbo nucifera]
Length=542

 Score =   114 bits (284),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  97   APGSVYRSPQVY  108



>ref|XP_010262622.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=563

 Score =   114 bits (285),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  97   APGSVYRSPQVY  108



>gb|KEH30846.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=561

 Score =   114 bits (284),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  440
            LAQR +W+LLSVLLRRQGIFLFAPL+YISGML YMGT SFD VPIIKHR  PGS+YRSPQ
Sbjct  45   LAQRLSWMLLSVLLRRQGIFLFAPLIYISGMLLYMGTASFDVVPIIKHRPAPGSLYRSPQ  104

Query  441  LY  446
            LY
Sbjct  105  LY  106



>ref|XP_006355101.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=472

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT GQ  PRTLA R    +LSVL+RRQGIFLFAPLLYI+G+LFYMGTV FD VPII+HR 
Sbjct  52   FTSGQQPPRTLANRITGAILSVLVRRQGIFLFAPLLYIAGILFYMGTVPFDVVPIIRHRP  111

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  112  APGSVYRSPQLY  123



>ref|XP_010262908.1| PREDICTED: uncharacterized protein At1g04910-like isoform X5 
[Nelumbo nucifera]
Length=510

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  97   APGSVYRSPQVY  108



>ref|XP_011023536.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=569

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP   P  R LA R AW LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD  PII H+
Sbjct  42   FTPSSYPPGRNLAHRLAWFLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPIIDHK  101

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  102  PAPGSVYRSPQIY  114



>ref|XP_006355100.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=578

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT GQ  PRTLA R    +LSVL+RRQGIFLFAPLLYI+G+LFYMGTV FD VPII+HR 
Sbjct  52   FTSGQQPPRTLANRITGAILSVLVRRQGIFLFAPLLYIAGILFYMGTVPFDVVPIIRHRP  111

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  112  APGSVYRSPQLY  123



>ref|XP_002311505.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa]
 gb|EEE88872.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa]
Length=569

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP   P  R LA R AW LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD  PII H+
Sbjct  42   FTPSSYPPGRNLAHRLAWFLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPIIDHK  101

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  102  PAPGSVYRSPQIY  114



>ref|XP_010695805.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +3

Query  237  PGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATP  416
            PG PA RT+A R A+++LS+LLRRQGIFLFAPL+YISGMLFYMGTVSFD  P+I H   P
Sbjct  48   PGLPASRTMAHRLAYLVLSILLRRQGIFLFAPLIYISGMLFYMGTVSFDVGPVISHYPAP  107

Query  417  GSIYRSPQLY  446
            GS+YRSPQLY
Sbjct  108  GSVYRSPQLY  117



>ref|XP_011038632.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=569

 Score =   111 bits (278),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP   P  R+LA R AW LLS LLRRQGIFLFAPL+YISGML YMGTVSFD  P+I H+
Sbjct  42   FTPSSYPPGRSLAHRLAWFLLSALLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPVIDHK  101

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  102  PAPGSVYRSPQIY  114



>ref|XP_002315879.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
 gb|EEF02050.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
Length=569

 Score =   111 bits (278),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  231  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  407
            FTP   P  R+LA R AW LLS LLRRQGIFLFAPL+YISGML YMGTVSFD  P+I H+
Sbjct  42   FTPSSYPPGRSLAHRLAWFLLSALLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPVIDHK  101

Query  408  ATPGSIYRSPQLY  446
              PGS+YRSPQ+Y
Sbjct  102  PAPGSVYRSPQIY  114



>ref|XP_010262851.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Nelumbo nucifera]
Length=539

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  97   APGSVYRSPQVY  108



>ref|XP_010262705.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=551

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  97   APGSVYRSPQVY  108



>ref|XP_010274715.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=558

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = +3

Query  240  GQPA--PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            G+P   PRTLAQR AW LLSV LRRQG+FLFAPL+YI+GML YMGTVSFD VP IK R  
Sbjct  33   GRPGLQPRTLAQRLAWTLLSVFLRRQGVFLFAPLIYIAGMLLYMGTVSFDVVPHIKPRPA  92

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQLY
Sbjct  93   PGSVYRSPQLY  103



>ref|XP_008243446.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=540

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I HR  PGS
Sbjct  40   QPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISHRPAPGS  98

Query  423  IYRSPQLY  446
            +YRSPQLY
Sbjct  99   VYRSPQLY  106



>ref|XP_007225729.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
 gb|EMJ26928.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
Length=561

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I HR  PGS
Sbjct  40   QPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISHRPAPGS  98

Query  423  IYRSPQLY  446
            +YRSPQLY
Sbjct  99   VYRSPQLY  106



>ref|XP_009339689.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=561

 Score =   107 bits (268),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP  RTL QR  W LLSVL+RRQG FLFAPLLYI+GML YMG+VSF+ VP+I HR  PGS
Sbjct  40   QPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYIAGMLLYMGSVSFEVVPVISHRLAPGS  98

Query  423  IYRSPQLY  446
            +YRSPQLY
Sbjct  99   VYRSPQLY  106



>ref|XP_008389213.1| PREDICTED: uncharacterized protein LOC103451575 [Malus domestica]
Length=217

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  419
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYI+GML YMG+VSF+ VP+I HR  PG
Sbjct  39   NQPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYIAGMLLYMGSVSFEVVPVISHRLAPG  97

Query  420  SIYRSPQLY  446
            S+YRSPQLY
Sbjct  98   SVYRSPQLY  106



>gb|KFK33363.1| hypothetical protein AALP_AA5G004000 [Arabis alpina]
Length=565

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ +A PGS
Sbjct  42   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRKAPPGS  100

Query  423  IYRSPQLY  446
            +Y+SPQ+Y
Sbjct  101  VYKSPQVY  108



>gb|KHG09805.1| hypothetical protein F383_15167 [Gossypium arboreum]
Length=561

 Score =   106 bits (265),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDVIPVVKHRPS  95

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQ+Y
Sbjct  96   PGSVYRSPQVY  106



>ref|XP_010093364.1| hypothetical protein L484_022926 [Morus notabilis]
 gb|EXB53958.1| hypothetical protein L484_022926 [Morus notabilis]
Length=562

 Score =   106 bits (265),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  246  PAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            P+ RT L QR  W +LSVL+RRQG+FLFAPLLYISGML YMG+VSFD VPII HR  PGS
Sbjct  40   PSGRTTLVQRLTWHILSVLIRRQGVFLFAPLLYISGMLLYMGSVSFDVVPIIHHRPAPGS  99

Query  423  IYRSPQLY  446
            +YRSP  Y
Sbjct  100  VYRSPHFY  107



>ref|NP_178257.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAC67324.1| similar to axi 1 protein from Nicotiana tabacum [Arabidopsis 
thaliana]
 gb|AAM13108.1| similar to axi 1 protein [Arabidopsis thaliana]
 gb|AAM91218.1| similar to axi 1 protein [Arabidopsis thaliana]
 dbj|BAE99174.1| similar to axi 1 protein from Nicotiana tabacum [Arabidopsis 
thaliana]
 gb|AEC05459.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=567

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  44   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  102

Query  423  IYRSPQLY  446
            +Y+SPQ+Y
Sbjct  103  VYKSPQVY  110



>ref|XP_009129233.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
 emb|CDY40371.1| BnaA02g26850D [Brassica napus]
Length=568

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WI+LS LLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS
Sbjct  44   QPS-RTLAHRVSWIILSALLRRQGVFLFAPLIYISCMLLYMGTVSFDVGPIIRHRSPPGS  102

Query  423  IYRSPQLY  446
            +Y+SPQLY
Sbjct  103  VYKSPQLY  110



>ref|XP_010502128.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
 ref|XP_010424919.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=568

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  45   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  103

Query  423  IYRSPQLY  446
            +Y+SPQ+Y
Sbjct  104  VYKSPQVY  111



>ref|XP_010513871.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=568

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  45   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  103

Query  423  IYRSPQLY  446
            +Y+SPQ+Y
Sbjct  104  VYKSPQVY  111



>emb|CDY52384.1| BnaCnng22220D [Brassica napus]
Length=568

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WI+LS LLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS
Sbjct  44   QPS-RTLAHRVSWIILSALLRRQGVFLFAPLIYISCMLLYMGTVSFDVGPIIRHRSPPGS  102

Query  423  IYRSPQLY  446
            +Y+SPQLY
Sbjct  103  VYKSPQLY  110



>gb|KJB15425.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=539

 Score =   106 bits (264),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDIIPVVKHRPS  95

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQ+Y
Sbjct  96   PGSVYRSPQVY  106



>ref|XP_006290827.1| hypothetical protein CARUB_v10016938mg [Capsella rubella]
 gb|EOA23725.1| hypothetical protein CARUB_v10016938mg [Capsella rubella]
Length=567

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  44   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  102

Query  423  IYRSPQLY  446
            +Y+SPQ+Y
Sbjct  103  VYKSPQVY  110



>gb|KJB15424.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
 gb|KJB15426.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=561

 Score =   106 bits (264),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDIIPVVKHRPS  95

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQ+Y
Sbjct  96   PGSVYRSPQVY  106



>ref|XP_002875074.1| hypothetical protein ARALYDRAFT_484066 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51333.1| hypothetical protein ARALYDRAFT_484066 [Arabidopsis lyrata subsp. 
lyrata]
Length=567

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  44   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  102

Query  423  IYRSPQLY  446
            +Y+SPQ+Y
Sbjct  103  VYKSPQVY  110



>emb|CDY65925.1| BnaC07g48790D [Brassica napus]
Length=564

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            RTLA R +W+++SVLLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS+Y+S
Sbjct  44   RTLAHRLSWLIVSVLLRRQGVFLFAPLIYISCMLIYMGTVSFDVGPIIRHRSPPGSVYKS  103

Query  435  PQLY  446
            PQLY
Sbjct  104  PQLY  107



>ref|XP_009101345.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
 emb|CDY17669.1| BnaA06g34880D [Brassica napus]
Length=564

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            RTLA R +W+++SVLLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS+Y+S
Sbjct  44   RTLAHRLSWLIVSVLLRRQGVFLFAPLIYISCMLIYMGTVSFDVGPIIRHRSPPGSVYKS  103

Query  435  PQLY  446
            PQLY
Sbjct  104  PQLY  107



>ref|XP_009101344.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=568

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            RTLA R +W+++SVLLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS+Y+S
Sbjct  44   RTLAHRLSWLIVSVLLRRQGVFLFAPLIYISCMLIYMGTVSFDVGPIIRHRSPPGSVYKS  103

Query  435  PQLY  446
            PQLY
Sbjct  104  PQLY  107



>ref|XP_006398540.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
 gb|ESQ39993.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
Length=565

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ +  PGS
Sbjct  42   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRKPPPGS  100

Query  423  IYRSPQLY  446
            +Y+SPQ+Y
Sbjct  101  VYKSPQVY  108



>gb|KHG09806.1| hypothetical protein F383_15167 [Gossypium arboreum]
Length=552

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +3

Query  234  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDVIPVVKHRPS  95

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQ+Y
Sbjct  96   PGSVYRSPQVY  106



>ref|XP_009351481.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=561

 Score =   104 bits (260),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I  R  PGS
Sbjct  40   QPG-RTLIQRIVWNLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISRRLAPGS  98

Query  423  IYRSPQLY  446
            +YRSPQLY
Sbjct  99   VYRSPQLY  106



>ref|XP_008339538.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=561

 Score =   104 bits (260),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I  R  PGS
Sbjct  40   QPG-RTLIQRIVWNLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISRRLAPGS  98

Query  423  IYRSPQLY  446
            +YRSPQLY
Sbjct  99   VYRSPQLY  106



>ref|XP_009351480.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=574

 Score =   104 bits (260),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I  R  PGS
Sbjct  40   QPG-RTLIQRIVWNLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISRRLAPGS  98

Query  423  IYRSPQLY  446
            +YRSPQLY
Sbjct  99   VYRSPQLY  106



>ref|XP_010931259.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Elaeis guineensis]
Length=497

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  428
            +PR L QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R  PGSIY
Sbjct  44   SPRALVQRMAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPAPGSIY  103

Query  429  RSPQLYL  449
            RSPQLYL
Sbjct  104  RSPQLYL  110



>ref|XP_009420104.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=571

 Score =   104 bits (260),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  252  PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYR  431
            PRT+AQR AW+LLS LLRRQ IFLFAPLLY++ MLFYMGTV  D+VP I  R+ PGS+YR
Sbjct  53   PRTIAQRMAWMLLSFLLRRQAIFLFAPLLYVAAMLFYMGTVPIDSVPRIISRSAPGSVYR  112

Query  432  SPQLY  446
            SP+LY
Sbjct  113  SPKLY  117



>ref|XP_010931258.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Elaeis guineensis]
Length=563

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  428
            +PR L QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R  PGSIY
Sbjct  44   SPRALVQRMAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPAPGSIY  103

Query  429  RSPQLYL  449
            RSPQLYL
Sbjct  104  RSPQLYL  110



>ref|XP_003589652.1| hypothetical protein MTR_1g031590 [Medicago truncatula]
Length=614

 Score =   103 bits (258),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  234  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            T  +P+PRT+ QR +++ LS LLRRQGIFLFAPLLYIS +L Y  + SFD VP I HR+ 
Sbjct  35   TAPKPSPRTIPQRLSYLFLSGLLRRQGIFLFAPLLYISCVLLYFSSFSFDVVPFINHRSA  94

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQLY
Sbjct  95   PGSVYRSPQLY  105



>gb|KJB30799.1| hypothetical protein B456_005G161000 [Gossypium raimondii]
Length=561

 Score =   103 bits (256),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F+P QP  RT+A R AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  36   FSPFQPG-RTIAHRLAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  94

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQLY
Sbjct  95   APGSVYRSPQLY  106



>gb|AES59903.2| O-fucosyltransferase family protein [Medicago truncatula]
Length=549

 Score =   102 bits (255),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  234  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            T  +P+PRT+ QR +++ LS LLRRQGIFLFAPLLYIS +L Y  + SFD VP I HR+ 
Sbjct  35   TAPKPSPRTIPQRLSYLFLSGLLRRQGIFLFAPLLYISCVLLYFSSFSFDVVPFINHRSA  94

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQLY
Sbjct  95   PGSVYRSPQLY  105



>ref|XP_009416135.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   101 bits (252),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  252  PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYR  431
            PR +AQR AW+LLS+ LRRQ IFLF PLLY++ MLFYMGTVS ++VP I  R+ PGS+YR
Sbjct  51   PRAIAQRMAWMLLSLFLRRQAIFLFTPLLYVAAMLFYMGTVSLESVPHIISRSAPGSVYR  110

Query  432  SPQLY  446
            SP+LY
Sbjct  111  SPKLY  115



>ref|XP_007045152.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY00984.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=561

 Score =   100 bits (249),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F P QP  RT+A R AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VPI+KHR 
Sbjct  36   FGPFQPG-RTIAHRLAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPIVKHRP  94

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  95   APGSVYRSPQVY  106



>ref|XP_008776785.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=563

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  428
            APR+L QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R   GS+Y
Sbjct  44   APRSLVQRMAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPASGSMY  103

Query  429  RSPQLY  446
            RSPQLY
Sbjct  104  RSPQLY  109



>ref|XP_006307153.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
 gb|EOA40051.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
Length=555

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  234  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  413
            + GQ   RT   R +WILLSVLLRRQGI LFAPL+Y+S MLF+M   SFDA PII  R  
Sbjct  34   SSGQQQSRTFPHRLSWILLSVLLRRQGILLFAPLIYVSCMLFHMRVASFDAAPIIHRRPA  93

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQ+Y
Sbjct  94   PGSVYRSPQIY  104



>ref|XP_002892842.1| hypothetical protein ARALYDRAFT_471685 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69101.1| hypothetical protein ARALYDRAFT_471685 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            Q   RT+A R +WILLSVLLRRQGI LFAPL+Y+S MLF++   SFDA PII  R  PGS
Sbjct  43   QQQSRTVAHRLSWILLSVLLRRQGILLFAPLIYVSCMLFHLHAASFDASPIIHRRPAPGS  102

Query  423  IYRSPQLY  446
            +YRSPQ+Y
Sbjct  103  VYRSPQVY  110



>gb|AAF31019.1|AC012189_1 Contains similarity to atypical PKC specific binding protein 
from Rattus norvegicus gb|AB005549. This gene is cut off, partial 
[Arabidopsis thaliana]
Length=133

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            R +A R +WI+LSVLLRRQGI LFAP++YIS MLF++   SFDA PII  R  PGS+YRS
Sbjct  48   RNVAHRLSWIILSVLLRRQGILLFAPIIYISCMLFHLHAASFDASPIIHRRPAPGSVYRS  107

Query  435  PQLY  446
            PQ+Y
Sbjct  108  PQVY  111



>ref|XP_009407491.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  252  PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYR  431
            PRTLAQR AW+LLS+LLRRQ IFLFAPLLY++ M+FYMGT+  D+VP I  R  PGS+YR
Sbjct  51   PRTLAQRMAWMLLSLLLRRQAIFLFAPLLYVAAMIFYMGTLPLDSVPRIISRPAPGSVYR  110

Query  432  SPQLY  446
            SP LY
Sbjct  111  SPMLY  115



>ref|XP_010922337.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=563

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  428
            APRTL QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R  PGS+Y
Sbjct  44   APRTLLQRLAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPAPGSVY  103

Query  429  RSPQLY  446
            RSPQLY
Sbjct  104  RSPQLY  109



>ref|XP_011070621.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=558

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            F   +  PRTLAQRF  +L S  L+RQGIFLFAPLLYI+GMLFYMGTVS D VP  ++R 
Sbjct  34   FKSARGPPRTLAQRFDRVL-SFFLKRQGIFLFAPLLYIAGMLFYMGTVSLDVVPFARNRL  92

Query  411  TPGSIYRSPQLY  446
             PGS+YRSP  Y
Sbjct  93   GPGSVYRSPDFY  104



>ref|XP_004297377.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=569

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF--DAVPIIKHRATP  416
            QP  RTL QR AW LLSVL+RRQG FLFAPLLYISGML YMG+ SF  D +PII     P
Sbjct  43   QPG-RTLIQRIAWHLLSVLIRRQGFFLFAPLLYISGMLLYMGSGSFPDDRLPIIPRHFAP  101

Query  417  GSIYRSPQLY  446
            GS YRSPQLY
Sbjct  102  GSRYRSPQLY  111



>ref|NP_172950.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AEE29248.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=562

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            R +A R +WI+LSVLLRRQGI LFAP++YIS MLF++   SFDA PII  R  PGS+YRS
Sbjct  48   RNVAHRLSWIILSVLLRRQGILLFAPIIYISCMLFHLHAASFDASPIIHRRPAPGSVYRS  107

Query  435  PQLY  446
            PQ+Y
Sbjct  108  PQVY  111



>ref|XP_002526030.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36370.1| conserved hypothetical protein [Ricinus communis]
Length=570

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 62/81 (77%), Gaps = 9/81 (11%)
 Frame = +3

Query  231  FTPGQPAP---------RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD  383
            FTP   +P         RT+A R AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD
Sbjct  37   FTPASSSPWSHTPGGGGRTIAHRLAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFD  96

Query  384  AVPIIKHRATPGSIYRSPQLY  446
              P+I+H+  PGS+YRSPQLY
Sbjct  97   VGPVIQHKPPPGSVYRSPQLY  117



>ref|XP_006416955.1| hypothetical protein EUTSA_v10007261mg [Eutrema salsugineum]
 gb|ESQ35308.1| hypothetical protein EUTSA_v10007261mg [Eutrema salsugineum]
Length=557

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            RT A R +WILLSVLLRRQGI LFAPL+YIS MLF+M T SF A PII  R  PGS+YRS
Sbjct  44   RTFAHRISWILLSVLLRRQGILLFAPLIYISCMLFHMRTASFYAGPIIPRRPAPGSVYRS  103

Query  435  PQLY  446
            PQ+Y
Sbjct  104  PQVY  107



>ref|XP_010459015.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=556

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  234  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQNRTAFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  94   APGSVYRSPQVY  105



>ref|XP_010496695.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=556

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  234  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQTRTTFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  94   APGSVYRSPQVY  105



>ref|XP_010459016.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=549

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  234  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQNRTAFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  94   APGSVYRSPQVY  105



>ref|XP_010496702.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=549

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  234  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  410
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQTRTTFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  411  TPGSIYRSPQLY  446
             PGS+YRSPQ+Y
Sbjct  94   APGSVYRSPQVY  105



>ref|XP_010476573.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=558

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSP  437
            T   R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R  PGS+YRSP
Sbjct  45   TFLHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRPAPGSVYRSP  104

Query  438  QLY  446
            Q+Y
Sbjct  105  QVY  107



>ref|XP_010476572.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=564

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSP  437
            T   R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R  PGS+YRSP
Sbjct  45   TFLHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRPAPGSVYRSP  104

Query  438  QLY  446
            Q+Y
Sbjct  105  QVY  107



>emb|CDY33727.1| BnaA09g45330D [Brassica napus]
Length=557

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            RTL  R +WILLS+LLRRQGI LFAPL+YI  MLF+M T SFD  P I  R  PGS+YRS
Sbjct  44   RTLPHRVSWILLSLLLRRQGILLFAPLIYIFCMLFHMRTASFDPGPFINRRPAPGSVYRS  103

Query  435  PQLY  446
            PQ+Y
Sbjct  104  PQVY  107



>ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
 gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
Length=554

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            R+L QR    LLSV LRRQG+FLFAPL+YISGML YMG+VSFD VP I  R  PGSIY+S
Sbjct  36   RSLVQRVTLALLSVFLRRQGVFLFAPLIYISGMLLYMGSVSFD-VPQISVRPPPGSIYKS  94

Query  435  PQLY  446
            P+++
Sbjct  95   PEVF  98



>gb|KFK43757.1| hypothetical protein AALP_AA1G168900 [Arabis alpina]
Length=557

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGM-LFYMGTVSFDAVPIIKHRATPG  419
            QP+ RTLA R +W LLS  LRRQGI LFAP++YIS M LF+M T SFDA PII  R  PG
Sbjct  39   QPS-RTLAHRLSWFLLSHFLRRQGILLFAPVIYISCMLLFHMRTASFDAGPIIHRRPAPG  97

Query  420  SIYRSPQLY  446
            S+Y+SPQ+Y
Sbjct  98   SVYKSPQVY  106



>emb|CDX81687.1| BnaC08g39140D [Brassica napus]
Length=558

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            R L  R +WILLS+LLRRQGI LFAPL+YI  MLF+M T SFD  P I  R  PGS+YRS
Sbjct  44   RNLPHRVSWILLSLLLRRQGILLFAPLIYIFCMLFHMRTASFDPGPFINRRPAPGSVYRS  103

Query  435  PQLY  446
            PQ+Y
Sbjct  104  PQVY  107



>ref|XP_009117860.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
Length=558

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            RTL  R +W LLS+LLRRQGI L APL+YI  MLF+M T SFD  P I  R  PGS+YRS
Sbjct  44   RTLPHRVSWFLLSLLLRRQGILLVAPLIYIFCMLFHMRTASFDPGPFINRRPAPGSVYRS  103

Query  435  PQLY  446
            PQ+Y
Sbjct  104  PQVY  107



>ref|XP_010318109.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum lycopersicum]
Length=446

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  246  PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSI  425
            PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F ++P   H A PGS+
Sbjct  32   PAPKTLPQHLASRFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHSLP-PPHYAPPGSV  90

Query  426  YRSPQLY  446
            YRSPQLY
Sbjct  91   YRSPQLY  97



>ref|XP_002458744.1| hypothetical protein SORBIDRAFT_03g039450 [Sorghum bicolor]
 gb|EES03864.1| hypothetical protein SORBIDRAFT_03g039450 [Sorghum bicolor]
Length=568

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            +R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  55   RRVARAVLAALLRRQAVFLFAPLLYVAAMLLYMGSISLDSVPRIISRPAPGSVYRSPQLY  114



>ref|XP_004235088.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=552

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  246  PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSI  425
            PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F ++P   H A PGS+
Sbjct  32   PAPKTLPQHLASRFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHSLP-PPHYAPPGSV  90

Query  426  YRSPQLY  446
            YRSPQLY
Sbjct  91   YRSPQLY  97



>ref|XP_010527785.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=567

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +3

Query  120  MHAKNRLpssghsspstpssprsrsprvrrggkpggrFTPGQPAPRTLAQRFAWILLSVL  299
            MHAKNRLPSSGH++PS P+SP           K   R T  QP  RTLA R +W+LLSVL
Sbjct  1    MHAKNRLPSSGHNTPSPPASPLRSPRYRHGRSKTTSRLTAVQPG-RTLAHRLSWLLLSVL  59

Query  300  LRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            LRRQGIFLFAPL+YIS ML +MGTVSFD VP+I HR  PGS+Y+SPQLY
Sbjct  60   LRRQGIFLFAPLIYISCMLLFMGTVSFDVVPVITHRPAPGSVYKSPQLY  108



>ref|XP_006342313.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Solanum tuberosum]
Length=446

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  246  PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSI  425
            PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F  +P   H A PGS+
Sbjct  32   PAPQTLPQHLASQFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHNLP-PPHYAPPGSV  90

Query  426  YRSPQLY  446
            YRSPQLY
Sbjct  91   YRSPQLY  97



>ref|XP_008674839.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=502

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            +R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  55   RRVARAVLAALLRRQAVFLFAPLLYVAAMLLYMGSISLDSVPRIIPRPAPGSMYRSPQLY  114



>ref|XP_006342311.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=552

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  246  PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSI  425
            PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F  +P   H A PGS+
Sbjct  32   PAPQTLPQHLASQFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHNLP-PPHYAPPGSV  90

Query  426  YRSPQLY  446
            YRSPQLY
Sbjct  91   YRSPQLY  97



>ref|XP_006342312.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=486

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  246  PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSI  425
            PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F  +P   H A PGS+
Sbjct  32   PAPQTLPQHLASQFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHNLP-PPHYAPPGSV  90

Query  426  YRSPQLY  446
            YRSPQLY
Sbjct  91   YRSPQLY  97



>ref|XP_008674838.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
 gb|ACR35648.1| unknown [Zea mays]
 tpg|DAA56900.1| TPA: hypothetical protein ZEAMMB73_118496 [Zea mays]
Length=558

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            +R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  55   RRVARAVLAALLRRQAVFLFAPLLYVAAMLLYMGSISLDSVPRIIPRPAPGSMYRSPQLY  114



>ref|XP_007222464.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
 gb|EMJ23663.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
Length=569

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 56/75 (75%), Gaps = 6/75 (8%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIK  401
            G+   +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+VSFD      AV +++
Sbjct  32   GRGPKQSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVSFDVVSLKNAVVVVR  91

Query  402  HRATPGSIYRSPQLY  446
             R+ PGS+YRSPQ++
Sbjct  92   KRSPPGSLYRSPQVF  106



>ref|XP_010553860.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=566

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            RTLA R +W+LLS+LLRRQGIFLFAPL+YIS ML YMGTVSFDAVP I HR  PGS+Y+S
Sbjct  47   RTLAHRLSWLLLSILLRRQGIFLFAPLIYISCMLLYMGTVSFDAVPKITHRPPPGSVYKS  106

Query  435  PQLY  446
            PQ+Y
Sbjct  107  PQVY  110



>ref|XP_003526401.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN20543.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 6/66 (9%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  428
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++SFD V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSFDVVSIKNGVVLVHKRAPPGSVY  99

Query  429  RSPQLY  446
            RSPQL+
Sbjct  100  RSPQLF  105



>ref|XP_004499553.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=553

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = +3

Query  270  RFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR---ATPGSIYRSPQ  440
            +F ++++S +LRR+G+ LFAPLLYISGML YMG++SFD V + KHR     PGS+Y SPQ
Sbjct  31   KFVFVVMSAILRRRGLLLFAPLLYISGMLLYMGSLSFDVVLVHKHRHRPPPPGSLYTSPQ  90

Query  441  LY  446
            L+
Sbjct  91   LF  92



>ref|XP_006582446.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 6/66 (9%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  428
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++SFD V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSFDVVSIKNGVVLVHKRAPPGSVY  99

Query  429  RSPQLY  446
            RSPQL+
Sbjct  100  RSPQLF  105



>ref|XP_009379526.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009379534.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=458

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIK  401
            G+   +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+V+FD      AV ++ 
Sbjct  33   GRGPKQSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVNFDVVSLKNAVVVVS  92

Query  402  HRATPGSIYRSPQLY  446
             R+ PGS+YRSPQ++
Sbjct  93   KRSPPGSVYRSPQVF  107



>ref|XP_009379518.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=571

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIK  401
            G+   +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+V+FD      AV ++ 
Sbjct  33   GRGPKQSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVNFDVVSLKNAVVVVS  92

Query  402  HRATPGSIYRSPQLY  446
             R+ PGS+YRSPQ++
Sbjct  93   KRSPPGSVYRSPQVF  107



>ref|XP_007148603.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
 gb|ESW20597.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
Length=565

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 6/66 (9%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  428
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG+ SFD V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSFSFDVVSIKNGVVLVHKRAPPGSVY  99

Query  429  RSPQLY  446
            RSPQ++
Sbjct  100  RSPQVF  105



>ref|XP_008656363.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=473

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  264  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  443
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  444  Y  446
            Y
Sbjct  132  Y  132



>gb|AFW82218.1| hypothetical protein ZEAMMB73_014086, partial [Zea mays]
Length=582

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  264  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  443
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  444  Y  446
            Y
Sbjct  132  Y  132



>ref|XP_008656362.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=586

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  264  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  443
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  444  Y  446
            Y
Sbjct  132  Y  132



>ref|XP_008656364.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Zea mays]
Length=433

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  264  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  443
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  444  Y  446
            Y
Sbjct  132  Y  132



>gb|KJB28878.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=461

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 6/70 (9%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  416
            ++ A +  ++L+S + RR+G+ LFAPLLYISGML YMG + FD      AV ++  R+ P
Sbjct  46   QSAANKIVFVLISTVFRRKGVLLFAPLLYISGMLLYMGLLGFDVVSLKNAVVVVHRRSPP  105

Query  417  GSIYRSPQLY  446
            GS+YRSPQL+
Sbjct  106  GSVYRSPQLF  115



>ref|XP_008347877.1| PREDICTED: DDB1- and CUL4-associated factor 13-like [Malus domestica]
Length=296

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  416
            +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+V+FD      AV ++  R+ P
Sbjct  38   QSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVNFDVVSLKNAVVVVSKRSPP  97

Query  417  GSIYRSPQLY  446
            GS+YRSPQ++
Sbjct  98   GSVYRSPQVF  107



>ref|XP_004299893.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=564

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP-----IIKH  404
            G    +++ +R  + ++SV+ RR+G+ LFAPLLYISGML YMG+VSFD V      II  
Sbjct  33   GTKQQQSIVERAVFFIISVVFRRRGMLLFAPLLYISGMLLYMGSVSFDVVSLKNVVIIGK  92

Query  405  RATPGSIYRSPQLY  446
             + PGS+YRSPQ++
Sbjct  93   PSPPGSVYRSPQVF  106



>gb|KJB28877.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=575

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 6/70 (9%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  416
            ++ A +  ++L+S + RR+G+ LFAPLLYISGML YMG + FD      AV ++  R+ P
Sbjct  46   QSAANKIVFVLISTVFRRKGVLLFAPLLYISGMLLYMGLLGFDVVSLKNAVVVVHRRSPP  105

Query  417  GSIYRSPQLY  446
            GS+YRSPQL+
Sbjct  106  GSVYRSPQLF  115



>ref|XP_006578999.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=566

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 6/66 (9%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  428
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++S D V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSIDVVSIKNGVVLVHKRAPPGSVY  99

Query  429  RSPQLY  446
            RSPQL+
Sbjct  100  RSPQLF  105



>ref|XP_002439920.1| hypothetical protein SORBIDRAFT_09g022540 [Sorghum bicolor]
 gb|EES18350.1| hypothetical protein SORBIDRAFT_09g022540 [Sorghum bicolor]
Length=175

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  288  LSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQLY
Sbjct  90   LATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQLY  142



>gb|KHN47089.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 6/66 (9%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  428
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++S D V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSIDVVSIKNGVVLVHKRAPPGSVY  99

Query  429  RSPQLY  446
            RSPQL+
Sbjct  100  RSPQLF  105



>ref|XP_006579000.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 6/66 (9%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  428
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++S D V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSIDVVSIKNGVVLVHKRAPPGSVY  99

Query  429  RSPQLY  446
            RSPQL+
Sbjct  100  RSPQLF  105



>gb|KDP34835.1| hypothetical protein JCGZ_11197 [Jatropha curcas]
Length=594

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 7/71 (10%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-------AVPIIKHRAT  413
            + L +R  +IL+SV+ RR+G+ LFAPL+YISGML YMG+++FD          +++ R  
Sbjct  57   QNLVERLIFILVSVVFRRRGVLLFAPLMYISGMLLYMGSLNFDVDLNLKSGGVVVRKRPP  116

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQ++
Sbjct  117  PGSVYRSPQVF  127



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 4/68 (6%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT----PGS  422
            + + +RF + L+S + RR+G+ LFAPLLYISGML YMG   FDAV  I + A     PGS
Sbjct  58   KNVVERFGYFLISAMYRRRGVLLFAPLLYISGMLMYMGIFGFDAVNNISNGARDVVGPGS  117

Query  423  IYRSPQLY  446
            +YRSPQ++
Sbjct  118  VYRSPQVF  125



>ref|XP_004499554.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=508

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = +3

Query  270  RFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT---PGSIYRSPQ  440
            +F ++++S +LRR+G+ LFAPLLYISGML YMG++SFD V + KHR     PGS+Y SPQ
Sbjct  31   KFVFVVMSAILRRRGLLLFAPLLYISGMLLYMGSLSFDVVLVHKHRHRPPPPGSLYTSPQ  90

Query  441  LY  446
            L+
Sbjct  91   LF  92



>ref|XP_007020035.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY17260.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=588

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 6/70 (9%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  416
            ++ A +  ++L+S + RR+G+ LFAPL+YISGML +MGT+ FD      AV ++  R+ P
Sbjct  48   QSAADKIVFVLISAVFRRKGVLLFAPLVYISGMLLFMGTLGFDVVSLKNAVVVVHRRSPP  107

Query  417  GSIYRSPQLY  446
            GS+YRSPQ++
Sbjct  108  GSVYRSPQVF  117



>ref|XP_009362462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=582

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +3

Query  240  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  398
            G+  P+ ++ ++   +L+SV+ +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  53   GRRGPKQSILEKVVVLLISVVFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKHAVVVV  112

Query  399  KHRATPGSIYRSPQLY  446
              R+ PGS+YRSPQ++
Sbjct  113  SKRSPPGSVYRSPQVF  128



>ref|XP_007020036.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY17261.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
Length=525

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 6/70 (9%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  416
            ++ A +  ++L+S + RR+G+ LFAPL+YISGML +MGT+ FD      AV ++  R+ P
Sbjct  48   QSAADKIVFVLISAVFRRKGVLLFAPLVYISGMLLFMGTLGFDVVSLKNAVVVVHRRSPP  107

Query  417  GSIYRSPQLY  446
            GS+YRSPQ++
Sbjct  108  GSVYRSPQVF  117



>ref|XP_008649713.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Zea mays]
Length=472

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  440
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  70   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  129

Query  441  LY  446
            LY
Sbjct  130  LY  131



>gb|AFW78262.1| hypothetical protein ZEAMMB73_416738, partial [Zea mays]
Length=556

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  440
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  51   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  110

Query  441  LY  446
            LY
Sbjct  111  LY  112



>ref|XP_008649712.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=585

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  440
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  70   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  129

Query  441  LY  446
            LY
Sbjct  130  LY  131



>ref|XP_008649711.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=588

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  440
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  70   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  129

Query  441  LY  446
            LY
Sbjct  130  LY  131



>ref|XP_010104480.1| hypothetical protein L484_025449 [Morus notabilis]
 gb|EXC01081.1| hypothetical protein L484_025449 [Morus notabilis]
Length=290

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 6/70 (9%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATP  416
            +++ +R   +L+S + RR+G+ L APLLYISGML YMG+VSFD V I      +  R  P
Sbjct  40   QSVMERIVLLLISAMFRRRGVLLLAPLLYISGMLLYMGSVSFDVVGIKNGVVVVHKRHPP  99

Query  417  GSIYRSPQLY  446
            GS+YRSPQ++
Sbjct  100  GSVYRSPQVF  109



>ref|XP_008352830.1| PREDICTED: uncharacterized protein YGR130C-like [Malus domestica]
Length=611

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 7/76 (9%)
 Frame = +3

Query  240  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  398
            G+  P+ ++ ++   +  SV  +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  53   GRRGPKQSILEKVVVLXXSVXFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKNAVVVV  112

Query  399  KHRATPGSIYRSPQLY  446
              R+ PGS+YRSPQ++
Sbjct  113  SKRSPPGSVYRSPQVF  128



>gb|EYU22809.1| hypothetical protein MIMGU_mgv1a003510mg [Erythranthe guttata]
Length=580

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPII--KHRAT  413
            G+   + +A+RF + L+S L R++G+ LFAPLLYI+GML YMGT+ F+A+  +       
Sbjct  50   GRVEMKNVAERFRYFLISALYRKRGVLLFAPLLYIAGMLMYMGTMGFNAMSSVGGGDAVG  109

Query  414  PGSIYRSPQLY  446
            PGS+YRSP+++
Sbjct  110  PGSVYRSPEVF  120



>ref|XP_008368398.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=511

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = +3

Query  240  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  398
            G+  P+ ++ ++   +L+SV+ +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  32   GRRGPKQSILEKVVVLLISVVFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKNAVVVV  91

Query  399  KHRATPGSIYRSPQLY  446
              R+ PGS+Y SPQ++
Sbjct  92   SKRSPPGSVYXSPQVF  107



>ref|XP_006841301.1| hypothetical protein AMTR_s00134p00089540 [Amborella trichopoda]
 gb|ERN02976.1| hypothetical protein AMTR_s00134p00089540 [Amborella trichopoda]
Length=127

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  434
            + +  R  ++L SV+ RR G+ LF PL+YI GMLFYMG++ F+  P++ +R  PGS YRS
Sbjct  48   QNVIHRLVYLLFSVVYRRHGVLLFVPLVYICGMLFYMGSLPFEG-PVVANRPPPGSTYRS  106

Query  435  PQLY  446
            P+++
Sbjct  107  PEVF  110



>emb|CDY39592.1| BnaC05g11210D, partial [Brassica napus]
Length=561

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +3

Query  243  QPAPRTLAQRFAWILLSVLLRRQGIFL-FAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  419
            +P  RT A R +WI+LSV+LRR+   L FAP++YIS MLF+M   SFDA P I  R  PG
Sbjct  52   EPPSRTFAHRISWIVLSVILRRRRRILLFAPVIYISCMLFHMHKASFDAGPTIHRRPAPG  111

Query  420  SIYRSPQLY  446
            S+YRSPQ Y
Sbjct  112  SVYRSPQAY  120



>ref|XP_008339228.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=392

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = +3

Query  240  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  398
            G+  P+ ++ ++   +L+SV+ +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  32   GRRGPKQSILEKVVVLLISVVFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKNAVVVV  91

Query  399  KHRATPGSIYRSPQLY  446
              R+ PGS+Y SPQ++
Sbjct  92   SKRSPPGSVYXSPQVF  107



>ref|XP_009148881.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 ref|XP_009148882.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 ref|XP_009148883.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=556

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFL-FAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSI  425
            A +T  QR +WI+LSV+LRR+   L FAP++YIS MLF+M T SFDA P I  R  PGS+
Sbjct  40   ANQTFVQRISWIVLSVILRRRRRILLFAPVIYISCMLFHMRTASFDAGPTIHRRPAPGSV  99

Query  426  YRSPQLY  446
            YRSPQ+Y
Sbjct  100  YRSPQVY  106



>ref|XP_002533585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28803.1| conserved hypothetical protein [Ricinus communis]
Length=587

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 7/73 (10%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-------AVPIIKHR  407
            + + + ++  ++L+SV+L+R+G+ LFAPLLYISGML YMG+++FD          +++ R
Sbjct  53   SKQNVVEKLMFVLVSVVLKRRGVLLFAPLLYISGMLLYMGSLNFDVDLNLKNGGVVVRKR  112

Query  408  ATPGSIYRSPQLY  446
               GS+YRSPQ++
Sbjct  113  PPVGSVYRSPQVF  125



>ref|XP_006387763.1| hypothetical protein POPTR_0603s002101g, partial [Populus trichocarpa]
 gb|ERP46677.1| hypothetical protein POPTR_0603s002101g, partial [Populus trichocarpa]
Length=145

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 52/67 (78%), Gaps = 5/67 (7%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPGSI  425
            + +R  +++++V+LRR+G+ LFAPLLY++GM+ YMG+++FD        +++ RA PG++
Sbjct  63   VVERLMFMVVTVVLRRRGLLLFAPLLYVAGMVLYMGSLNFDVNLKNGGVVVRKRAPPGTV  122

Query  426  YRSPQLY  446
            YRSP+++
Sbjct  123  YRSPKVF  129



>dbj|BAJ88036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  309  QGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            Q +FLFAPLLY++ ML YMG+VS D VP I  R  PGS+YRSPQLY
Sbjct  54   QAVFLFAPLLYVAAMLLYMGSVSLDGVPRIISRPAPGSLYRSPQLY  99



>ref|XP_003564587.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=573

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  309  QGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            Q +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  74   QAVFLFAPLLYVAAMLLYMGSISLDSVPRIISRPAPGSLYRSPQLY  119



>ref|XP_009594772.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=564

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVS-FDAVPIIKHRATPGSIYRSP  437
            L ++  ++++S + RR+G+ LFAPLLYISGML YMGT+  FDA       + PGS+YRSP
Sbjct  42   LQEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGTLGFFDASAATTEVSPPGSLYRSP  101

Query  438  QLY  446
            Q++
Sbjct  102  QVF  104



>ref|XP_002325978.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
 gb|EEF00360.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
Length=584

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 52/67 (78%), Gaps = 5/67 (7%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPGSI  425
            + +R  +++++V+LRR+G+ LFAPLLY++GM+ YMG+++FD        +++ RA PG++
Sbjct  63   VVERLMFMVVTVVLRRRGLLLFAPLLYVAGMVLYMGSLNFDVNLKNGGVVVRKRAPPGTV  122

Query  426  YRSPQLY  446
            YRSP+++
Sbjct  123  YRSPKVF  129



>ref|XP_011003993.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=590

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 52/67 (78%), Gaps = 5/67 (7%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPGSI  425
            + +R  +++++V+LRR+G+ LFAPLLY++GM+ YMG+++FD        +++ RA PG++
Sbjct  69   VVERLMFMVVTVVLRRRGLLLFAPLLYVAGMVLYMGSLNFDVNLKNGGVVVRKRAPPGTV  128

Query  426  YRSPQLY  446
            YRSP+++
Sbjct  129  YRSPKVF  135



>ref|XP_009781764.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=565

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVS-FDAVPIIKHRATPGSIYRSP  437
            L ++  ++++S + RR+G+ LFAPLLYISGML YMGT+  FDA       + PGS+YRSP
Sbjct  43   LQEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGTLGFFDASAATTEVSPPGSLYRSP  102

Query  438  QLY  446
            Q++
Sbjct  103  QVF  105



>ref|XP_008459666.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
 ref|XP_008459667.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=556

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 8/71 (11%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA--------VPIIKHRAT  413
            ++ ++  +++LS + RR+G+ LFAPLLYIS ML YMG+++FD         V  +  RA 
Sbjct  34   SIMEKLVFLILSAVFRRKGLLLFAPLLYISMMLLYMGSLNFDVSISNLKTRVVSVSKRAP  93

Query  414  PGSIYRSPQLY  446
            PGS+YRSPQ++
Sbjct  94   PGSLYRSPQVF  104



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATPGS  422
            LA+R  ++L+S + RR+G+ L APLLYI+GML +MG+  F        V I+  RA PGS
Sbjct  52   LAERLVFMLVSSIFRRKGVLLLAPLLYITGMLLFMGSFGFSVLDLGHGVEIVYKRAPPGS  111

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  112  VYRSPKVF  119



>emb|CDY03127.1| BnaC06g08460D [Brassica napus]
Length=560

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 6/75 (8%)
 Frame = +3

Query  240  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIK  401
            G+ + + + +R  ++L SV+ RR+G+ L APLLYI+GML +MG+  F        V I+ 
Sbjct  31   GKTSNQGIGERLVFLLFSVVFRRKGVLLLAPLLYIAGMLLFMGSFGFTILDLGHGVDIVY  90

Query  402  HRATPGSIYRSPQLY  446
             RA PGS+YRSP+++
Sbjct  91   RRAPPGSVYRSPKVF  105



>ref|XP_004963730.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=576

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  309  QGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            Q +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQLY
Sbjct  77   QAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQLY  122



>ref|XP_004141562.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004162859.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN52707.1| hypothetical protein Csa_5G651650 [Cucumis sativus]
Length=573

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 8/71 (11%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA--------VPIIKHRAT  413
            ++ ++  +++LS + RR+G+ LFAPLLYIS ML YMG+++FD         V  +  RA 
Sbjct  51   SIMEKLVFLILSAVFRRKGLLLFAPLLYISMMLLYMGSLNFDVSISNLKTRVVSVSKRAP  110

Query  414  PGSIYRSPQLY  446
            PG++YRSPQ++
Sbjct  111  PGTVYRSPQVF  121



>ref|NP_001055751.1| Os05g0459600 [Oryza sativa Japonica Group]
 gb|AAT39163.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF17665.1| Os05g0459600 [Oryza sativa Japonica Group]
Length=519

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  303  RRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            RRQ +FLFAPLLY++ ML YMG++  D VP I  R  PGS+YRSPQLY
Sbjct  79   RRQAVFLFAPLLYVAAMLLYMGSIPLDVVPRIVARPAPGSVYRSPQLY  126



>emb|CDY36519.1| BnaA06g09720D [Brassica napus]
Length=556

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  246  PAPRTLAQRFAWILLSVLLRRQGIFL-FAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  422
            PA +T  QR + I+LSV+LRR+   L FAP++YIS MLF+M T SFDA P I  R  PGS
Sbjct  39   PANQTFVQRISCIVLSVILRRRRRILLFAPVIYISCMLFHMRTASFDAGPTIHRRPAPGS  98

Query  423  IYRSPQLY  446
            +YRSPQ+Y
Sbjct  99   VYRSPQVY  106



>gb|EEC79353.1| hypothetical protein OsI_20224 [Oryza sativa Indica Group]
Length=549

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  303  RRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            RRQ +FLFAPLLY++ ML YMG++  D VP I  R  PGS+YRSPQLY
Sbjct  79   RRQAVFLFAPLLYVAAMLLYMGSIPLDVVPRIVARPAPGSVYRSPQLY  126



>ref|XP_004970534.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=564

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  315  IFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  67   VFLFAPLLYVAAMLLYMGSISLDSVPRIISRPAPGSMYRSPQLY  110



>ref|XP_003598018.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES68269.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=577

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = +3

Query  273  FAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT----PGSIYRSPQ  440
            F ++ +S + RR+G+ LFAPLLYI+GML YMG++SFD V + KH       PGS+Y SPQ
Sbjct  38   FVYLFMSAIFRRRGLLLFAPLLYIAGMLLYMGSLSFDIVLVSKHHRLPPPPPGSLYTSPQ  97

Query  441  LY  446
            L+
Sbjct  98   LF  99



>gb|AAK93632.1| putative growth regulator protein [Arabidopsis thaliana]
Length=568

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATPGS  422
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R +PGS
Sbjct  46   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGSPGS  105

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  106  VYRSPKVF  113



>ref|NP_564461.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN12984.1| putative growth regulator [Arabidopsis thaliana]
 gb|AEE31802.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=568

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATPGS  422
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R +PGS
Sbjct  46   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGSPGS  105

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  106  VYRSPKVF  113



>emb|CDY66921.1| BnaAnng23210D [Brassica napus]
Length=564

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATPGS  422
            + +R  ++L SV+ RR+G+ L APLLYI+GML +MG+  F        V I+  RA PGS
Sbjct  40   IGERLVFLLFSVVFRRKGVLLLAPLLYIAGMLLFMGSFGFTILDLGHGVDIVYRRAPPGS  99

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  100  VYRSPKVF  107



>ref|XP_010543593.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
Length=577

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATPGS  422
            L +R  ++L+S + RR+G+ L APLLYI+GML +MG+  F        V II  R  PGS
Sbjct  56   LVERLVFVLVSAVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIIYKRGPPGS  115

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  116  VYRSPKVF  123



>ref|XP_009114709.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=562

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA------VPIIKHRATPGS  422
            + +R  ++L SV+ RR+G+ L APLLYI+GML +MG+  F        V I+  RA PGS
Sbjct  40   IGERLVFLLFSVVFRRKGVLLLAPLLYIAGMLLFMGSFGFTILDLGHRVDIVYRRAPPGS  99

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  100  VYRSPKVF  107



>ref|XP_002891187.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67446.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATPGS  422
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R  PGS
Sbjct  47   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYSRGPPGS  106

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  107  VYRSPKVF  114



>ref|XP_003568305.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=570

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  315  IFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            +FLFAPLLY++ ML YMG++  D VP I  R+ PGS+YRSPQLY
Sbjct  73   VFLFAPLLYVAAMLLYMGSLPLDVVPRIIARSAPGSVYRSPQLY  116



>ref|XP_002984324.1| hypothetical protein SELMODRAFT_268854 [Selaginella moellendorffii]
 gb|EFJ14834.1| hypothetical protein SELMODRAFT_268854 [Selaginella moellendorffii]
Length=570

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +3

Query  237  PGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATP  416
            PG P   TL QR + ++LS+LLR+  + L AP++YISGML YM T++ D +P ++    P
Sbjct  33   PGSPG-STLMQRLSCLVLSILLRQHKLLLIAPIIYISGMLLYMSTMTLD-LPRVRKPDPP  90

Query  417  GSIYRSPQLY  446
            GS YRSP+++
Sbjct  91   GSRYRSPEVF  100



>gb|AAF79365.1|AC007887_24 F15O4.45 [Arabidopsis thaliana]
Length=668

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  422
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R +PGS
Sbjct  66   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGSPGS  125

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  126  VYRSPKVF  133



>gb|EPS61677.1| hypothetical protein M569_13117, partial [Genlisea aurea]
Length=421

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 6/72 (8%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHRA  410
            A + +A  FA++L+S L RR+G+ LFAPL+YISG++ YMG + F++V       +     
Sbjct  10   ASKNMAAGFAYLLISALYRRKGMLLFAPLIYISGLVVYMGWIGFESVNSQRINTVGSDAV  69

Query  411  TPGSIYRSPQLY  446
             PG++YRSP+L+
Sbjct  70   GPGTLYRSPELF  81



>ref|XP_010061980.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
Length=454

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR-  407
            F  G+   ++L +R    ++S + RR+G+ LFAP+LYI+GM+ YMG+  FD V + ++  
Sbjct  34   FGGGRWPKKSLVERLVLAIVSAVFRRRGVLLFAPVLYITGMVLYMGSFGFD-VGLRRNAD  92

Query  408  --ATPGSIYRSPQLY  446
              A PGS+YRSPQ++
Sbjct  93   GPAPPGSVYRSPQVF  107



>ref|XP_010061979.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69026.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=562

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR-  407
            F  G+   ++L +R    ++S + RR+G+ LFAP+LYI+GM+ YMG+  FD V + ++  
Sbjct  34   FGGGRWPKKSLVERLVLAIVSAVFRRRGVLLFAPVLYITGMVLYMGSFGFD-VGLRRNAD  92

Query  408  --ATPGSIYRSPQLY  446
              A PGS+YRSPQ++
Sbjct  93   GPAPPGSVYRSPQVF  107



>ref|XP_006349651.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=571

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 19/84 (23%)
 Frame = +3

Query  231  FTPG--QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV-----  389
            FT G  Q   +  A++  ++++S + RR+G+ LFAPLLYISGML YMG + FDA      
Sbjct  33   FTSGNCQVNLQNFAEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGALGFDASRTSGG  92

Query  390  -----PIIKHRATPGSIYRSPQLY  446
                 PI       GS+YRSPQ++
Sbjct  93   GTGLDPI-------GSVYRSPQVF  109



>ref|XP_010543575.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543584.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=587

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  422
            L +R  ++L+S + RR+G+ L APLLYI+GML +MG+  F        V II  R  PGS
Sbjct  56   LVERLVFVLVSAVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIIYKRGPPGS  115

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  116  VYRSPKVF  123



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 5/68 (7%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT-----PGS  422
            +  +R  ++ +S + RR+G+ LFAP+LYISGML YMG++SFD               PGS
Sbjct  56   SFVERVMFVFVSAVFRRRGLLLFAPVLYISGMLLYMGSLSFDGGGGGGGGGGAEAQPPGS  115

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  116  VYRSPEVF  123



>ref|XP_010319880.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=568

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 17/74 (23%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV----------PIIKH  404
            +  A++  ++++S + RR+G+ LFAPLLYISGML YMG + FDA           PI   
Sbjct  43   QNFAEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGALGFDASRTSGGGTGLDPI---  99

Query  405  RATPGSIYRSPQLY  446
                GS+YRSPQ++
Sbjct  100  ----GSVYRSPQVF  109



>ref|XP_004237568.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=571

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 17/74 (23%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV----------PIIKH  404
            +  A++  ++++S + RR+G+ LFAPLLYISGML YMG + FDA           PI   
Sbjct  43   QNFAEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGALGFDASRTSGGGTGLDPI---  99

Query  405  RATPGSIYRSPQLY  446
                GS+YRSPQ++
Sbjct  100  ----GSVYRSPQVF  109



>gb|KFK27807.1| hypothetical protein AALP_AA8G431600 [Arabis alpina]
Length=569

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA------VPIIKHRATPGS  422
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R  PGS
Sbjct  47   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHRVEIVYRRGPPGS  106

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  107  VYRSPKVF  114



>ref|XP_006434581.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47821.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=656

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  419
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  129  QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRKRAPPG  188

Query  420  SIYRSPQLY  446
            S+YRSPQ++
Sbjct  189  SVYRSPQVF  197



>gb|KDO83868.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=455

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  419
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  420  SIYRSPQLY  446
            S+YRSPQ++
Sbjct  103  SVYRSPQVF  111



>ref|XP_006473172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=450

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  419
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  420  SIYRSPQLY  446
            S+YRSPQ++
Sbjct  103  SVYRSPQVF  111



>gb|KCW69027.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=524

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR-  407
            F  G+   ++L +R    ++S + RR+G+ LFAP+LYI+GM+ YMG+  FD V + ++  
Sbjct  34   FGGGRWPKKSLVERLVLAIVSAVFRRRGVLLFAPVLYITGMVLYMGSFGFD-VGLRRNAD  92

Query  408  --ATPGSIYRSPQLY  446
              A PGS+YRSPQ++
Sbjct  93   GPAPPGSVYRSPQVF  107



>emb|CAN77312.1| hypothetical protein VITISV_026198 [Vitis vinifera]
Length=312

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  419
             +  +R  ++ +S + RR+G+ LFAP+LYISGML YMG++SFD               PG
Sbjct  55   HSFVERVMFVFVSAVFRRRGLLLFAPVLYISGMLLYMGSLSFDGGGGGGGGGGAEAQPPG  114

Query  420  SIYRSPQLY  446
            S+YRSP+++
Sbjct  115  SVYRSPEVF  123



>emb|CDP10650.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 7/66 (11%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT------PGSIY  428
            +R  + ++S + RR+G+ L APLLYIS ML YMGTV FD+V + ++         PGS+Y
Sbjct  49   ERLGFAVISTVYRRRGVLLLAPLLYISVMLLYMGTVGFDSV-VSRNGGNGDDLTRPGSLY  107

Query  429  RSPQLY  446
            RSPQ++
Sbjct  108  RSPQVF  113



>ref|XP_006473171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 gb|KDO83865.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
 gb|KDO83866.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=570

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  419
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  420  SIYRSPQLY  446
            S+YRSPQ++
Sbjct  103  SVYRSPQVF  111



>ref|XP_010246042.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nelumbo 
nucifera]
Length=510

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD--AVPIIKH  404
            F    P   T A+R  +I+LS + R++G+ LFAPL+YISGML YMG++S +  A  ++  
Sbjct  41   FGSRSPKLHTFAERLVYIVLSAVYRKRGVLLFAPLVYISGMLLYMGSLSLEVVAPVVVVK  100

Query  405  RATPGSIYRSPQLY  446
             A PGS YRSPQ++
Sbjct  101  PAPPGSTYRSPQVF  114



>ref|XP_010246040.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=576

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD--AVPIIKH  404
            F    P   T A+R  +I+LS + R++G+ LFAPL+YISGML YMG++S +  A  ++  
Sbjct  41   FGSRSPKLHTFAERLVYIVLSAVYRKRGVLLFAPLVYISGMLLYMGSLSLEVVAPVVVVK  100

Query  405  RATPGSIYRSPQLY  446
             A PGS YRSPQ++
Sbjct  101  PAPPGSTYRSPQVF  114



>ref|XP_006434583.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 ref|XP_006434584.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47823.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47824.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=570

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  419
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRKRAPPG  102

Query  420  SIYRSPQLY  446
            S+YRSPQ++
Sbjct  103  SVYRSPQVF  111



>ref|XP_010246041.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=532

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +3

Query  231  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD--AVPIIKH  404
            F    P   T A+R  +I+LS + R++G+ LFAPL+YISGML YMG++S +  A  ++  
Sbjct  41   FGSRSPKLHTFAERLVYIVLSAVYRKRGVLLFAPLVYISGMLLYMGSLSLEVVAPVVVVK  100

Query  405  RATPGSIYRSPQLY  446
             A PGS YRSPQ++
Sbjct  101  PAPPGSTYRSPQVF  114



>gb|KDO83867.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=523

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = +3

Query  255  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  419
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  420  SIYRSPQLY  446
            S+YRSPQ++
Sbjct  103  SVYRSPQVF  111



>ref|XP_006397450.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
 gb|ESQ38903.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
Length=571

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  422
            + ++  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R  PGS
Sbjct  49   IGEKLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGPPGS  108

Query  423  IYRSPQLY  446
            +YRSP+++
Sbjct  109  VYRSPKVF  116



>ref|XP_010500036.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 7/69 (10%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHR-ATPG  419
            L ++  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R   PG
Sbjct  54   LGEKLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGPPG  113

Query  420  SIYRSPQLY  446
            S+YRSP+++
Sbjct  114  SVYRSPKVF  122



>ref|XP_010461317.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 7/69 (10%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHR-ATPG  419
            L ++  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R   PG
Sbjct  54   LGEKLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGPPG  113

Query  420  SIYRSPQLY  446
            S+YRSP+++
Sbjct  114  SVYRSPKVF  122



>ref|XP_002972493.1| hypothetical protein SELMODRAFT_441812 [Selaginella moellendorffii]
 gb|EFJ26579.1| hypothetical protein SELMODRAFT_441812 [Selaginella moellendorffii]
Length=870

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +3

Query  267  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            QR + ++LS+LLR+  + L AP++YISGML YM T++ D +P ++    PGS YRSP+++
Sbjct  2    QRLSCLVLSILLRQHKLLLIAPIIYISGMLLYMSTMTLD-LPRVRKPDPPGSRYRSPEVF  60



>ref|XP_010478945.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=571

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 7/69 (10%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHR-ATPG  419
            L ++  ++L S++ RR+   L APLLYI+GML +MG+  F        V I+  R   PG
Sbjct  52   LGEKLVFLLFSIVFRRKSFLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGPPG  111

Query  420  SIYRSPQLY  446
            S+YRSP+++
Sbjct  112  SVYRSPKVF  120



>ref|XP_006304663.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
 gb|EOA37561.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
Length=580

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 14/76 (18%)
 Frame = +3

Query  261  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHR-----  407
            L ++  + L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R     
Sbjct  48   LGEKLVFSLFSLVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGGGG  107

Query  408  ---ATPGSIYRSPQLY  446
                 PGS+YRSP+++
Sbjct  108  GGGGAPGSVYRSPKVF  123



>ref|XP_010680244.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 22/85 (26%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA-------VPIIKHRAT-  413
               +R  +I+++ + RR+G+ LFAPLLYI+GML YMG++S D+       + + K +   
Sbjct  54   NFVERVVYIVIATVFRRKGVLLFAPLLYITGMLAYMGSLSLDSKVNGGERIGLEKLKGNI  113

Query  414  --------------PGSIYRSPQLY  446
                          PGS+YRSP+++
Sbjct  114  VEFSGGFVLNEPRLPGSLYRSPEVF  138



>ref|XP_010680324.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=596

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 22/85 (26%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA-------VPIIKHRAT-  413
               +R  +I+++ + RR+G+ LFAPLLYI+GML YMG++S D+       + + K +   
Sbjct  54   NFVERVVYIVIATVFRRKGVLLFAPLLYITGMLAYMGSLSLDSKVNGGERIGLEKLKGNI  113

Query  414  --------------PGSIYRSPQLY  446
                          PGS+YRSP+++
Sbjct  114  VEFSGGFVLNEPRLPGSLYRSPEVF  138



>ref|XP_008781542.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Phoenix dactylifera]
Length=461

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = +3

Query  249  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHRA  410
            AP    +R  +  L+ L RR+GI L APLLY+S ML +MG+ + DAVP      ++  R 
Sbjct  31   APPPGMERLLYAALAALFRRRGILLVAPLLYVSAMLVFMGSWNLDAVPVRVGVAVLHRRP  90

Query  411  TPGSIYRSPQLY  446
             PG++YRS Q++
Sbjct  91   PPGAVYRSHQVF  102



>ref|XP_008781543.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Phoenix dactylifera]
Length=423

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 6/54 (11%)
 Frame = +3

Query  303  RRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHRATPGSIYRSPQLY  446
            RR+GI L APLLY+S ML +MG+ + DAVP      ++  R  PG++YRS Q++
Sbjct  49   RRRGILLVAPLLYVSAMLVFMGSWNLDAVPVRVGVAVLHRRPPPGAVYRSHQVF  102



>ref|XP_001760728.1| predicted protein [Physcomitrella patens]
 gb|EDQ74467.1| predicted protein [Physcomitrella patens]
Length=558

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +3

Query  258  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSP  437
            T +Q+    LLS   RR  + LF P +Y++GML YMG       P    R  PGS+YRS 
Sbjct  22   TWSQKLTHFLLSFFRRRNRVLLFIPFIYVTGMLLYMGGDISMEFPPFPGRYRPGSVYRSD  81

Query  438  QLY  446
            Q++
Sbjct  82   QVF  84



>gb|AAF79229.1|AC006917_14 F10B6.36 [Arabidopsis thaliana]
Length=483

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  351  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            MLF++   SFDA PII  R  PGS+YRSPQ+Y
Sbjct  1    MLFHLHAASFDASPIIHRRPAPGSVYRSPQVY  32



>ref|XP_010930789.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910-like 
[Elaeis guineensis]
Length=553

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 6/49 (12%)
 Frame = +3

Query  318  FLFAPLLYISGMLFYMGTVSFDAVP------IIKHRATPGSIYRSPQLY  446
             L AP+LY+S ML +MG+ + DAVP      +++ R  PG++YRSPQ++
Sbjct  58   LLLAPVLYVSAMLVFMGSWNLDAVPVRVGVAVLRRRPLPGAVYRSPQVF  106



>ref|XP_010912508.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=550

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 6/73 (8%)
 Frame = +3

Query  246  PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHR  407
            P P++  +R  + +L+ LLRR+G  L APLLY+S M  ++G  + D+VP      ++  R
Sbjct  31   PRPKSGVERLLYAVLATLLRRRGFLLLAPLLYVSAMPVFLGRWNLDSVPVRVRVAVLHRR  90

Query  408  ATPGSIYRSPQLY  446
              PG++YRSP+++
Sbjct  91   PPPGAVYRSPRVF  103



>gb|EEE55649.1| hypothetical protein OsJ_04031 [Oryza sativa Japonica Group]
Length=422

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  351  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  1    MLLYMGSISLDSVPRIISRPAPGSLYRSPQLY  32



>gb|EEC71770.1| hypothetical protein OsI_04380 [Oryza sativa Indica Group]
Length=440

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  351  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  446
            ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  1    MLLYMGSISLDSVPRIISRPAPGSLYRSPQLY  32



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553272586920