BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015K03

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626733.1|  PREDICTED: probable chlorophyll(ide) b reduc...    170   6e-47   Nicotiana tomentosiformis
ref|XP_009770954.1|  PREDICTED: probable chlorophyll(ide) b reduc...    165   4e-45   Nicotiana sylvestris
gb|ACH54085.1|  putative chlorophyll b reductase                        165   4e-45   Nicotiana tabacum [American tobacco]
ref|XP_011093590.1|  PREDICTED: probable chlorophyll(ide) b reduc...    129   4e-32   
ref|XP_006360473.1|  PREDICTED: probable chlorophyll(ide) b reduc...    129   4e-32   Solanum tuberosum [potatoes]
ref|XP_004242955.1|  PREDICTED: probable chlorophyll(ide) b reduc...    123   7e-30   Solanum lycopersicum
ref|XP_010323446.1|  PREDICTED: probable chlorophyll(ide) b reduc...    123   7e-30   Solanum lycopersicum
emb|CDP03330.1|  unnamed protein product                                112   6e-26   Coffea canephora [robusta coffee]
gb|EPS61243.1|  hypothetical protein M569_13555                         105   1e-23   Genlisea aurea
gb|EYU18157.1|  hypothetical protein MIMGU_mgv1a0102811mg             91.7    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_008386425.1|  PREDICTED: probable chlorophyll(ide) b reduc...  89.0    5e-18   
ref|XP_008337383.1|  PREDICTED: probable chlorophyll(ide) b reduc...  89.0    2e-17   
ref|XP_010249726.1|  PREDICTED: probable chlorophyll(ide) b reduc...  87.8    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008242653.1|  PREDICTED: probable chlorophyll(ide) b reduc...  86.7    1e-16   Prunus mume [ume]
ref|XP_009374020.1|  PREDICTED: probable chlorophyll(ide) b reduc...  86.3    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_007013169.1|  NAD(P)-binding Rossmann-fold superfamily pro...  85.1    3e-16   
ref|XP_007013168.1|  NAD(P)-binding Rossmann-fold superfamily pro...  85.1    4e-16   
ref|XP_007013167.1|  NAD(P)-binding Rossmann-fold superfamily pro...  85.1    4e-16   
ref|XP_007013166.1|  NAD(P)-binding Rossmann-fold superfamily pro...  85.1    4e-16   
gb|AHM26648.1|  reductase NYC                                         84.7    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_009371459.1|  PREDICTED: probable chlorophyll(ide) b reduc...  84.7    6e-16   Pyrus x bretschneideri [bai li]
gb|KHG20319.1|  hypothetical protein F383_09127                       83.6    1e-15   Gossypium arboreum [tree cotton]
gb|AEO19898.1|  chlorophyll(ide) b reductase                          81.3    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_007204378.1|  hypothetical protein PRUPE_ppa004339mg           82.4    4e-15   Prunus persica
gb|KJB54194.1|  hypothetical protein B456_009G025000                  79.0    4e-14   Gossypium raimondii
gb|KJB54193.1|  hypothetical protein B456_009G025000                  79.0    5e-14   Gossypium raimondii
ref|XP_006583379.1|  PREDICTED: probable chlorophyll(ide) b reduc...  78.6    5e-14   Glycine max [soybeans]
ref|XP_011043468.1|  PREDICTED: probable chlorophyll(ide) b reduc...  79.0    5e-14   Populus euphratica
ref|XP_010099589.1|  putative chlorophyll(ide) b reductase NYC1       79.0    6e-14   Morus notabilis
ref|XP_002280953.1|  PREDICTED: probable chlorophyll(ide) b reduc...  79.0    6e-14   Vitis vinifera
ref|XP_010254115.1|  PREDICTED: probable chlorophyll(ide) b reduc...  79.0    6e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002324420.2|  hypothetical protein POPTR_0018s08790g           78.6    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_003528914.1|  PREDICTED: probable chlorophyll(ide) b reduc...  78.6    8e-14   
ref|XP_003534200.1|  PREDICTED: probable chlorophyll(ide) b reduc...  78.2    1e-13   
ref|XP_006451162.1|  hypothetical protein CICLE_v10008039mg           76.3    3e-13   
ref|XP_006451163.1|  hypothetical protein CICLE_v10008039mg           76.6    4e-13   Citrus clementina [clementine]
ref|XP_004287406.1|  PREDICTED: probable chlorophyll(ide) b reduc...  75.9    6e-13   Fragaria vesca subsp. vesca
ref|XP_007152835.1|  hypothetical protein PHAVU_004G163900g           75.9    7e-13   Phaseolus vulgaris [French bean]
ref|XP_006475625.1|  PREDICTED: probable chlorophyll(ide) b reduc...  75.1    1e-12   Citrus sinensis [apfelsine]
emb|CDY47326.1|  BnaCnng14630D                                        74.7    1e-12   Brassica napus [oilseed rape]
ref|XP_006414943.1|  hypothetical protein EUTSA_v10024970mg           74.3    2e-12   Eutrema salsugineum [saltwater cress]
ref|XP_010450312.1|  PREDICTED: probable chlorophyll(ide) b reduc...  73.9    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009139641.1|  PREDICTED: probable chlorophyll(ide) b reduc...  73.6    3e-12   Brassica rapa
emb|CDY01120.1|  BnaA04g06990D                                        73.6    3e-12   
ref|XP_004512981.1|  PREDICTED: probable chlorophyll(ide) b reduc...  73.6    4e-12   Cicer arietinum [garbanzo]
ref|XP_010656325.1|  PREDICTED: probable chlorophyll(ide) b reduc...  73.2    5e-12   
gb|KDO50905.1|  hypothetical protein CISIN_1g010380mg                 71.6    5e-12   Citrus sinensis [apfelsine]
gb|KDO50904.1|  hypothetical protein CISIN_1g010380mg                 72.0    8e-12   Citrus sinensis [apfelsine]
ref|XP_010435297.1|  PREDICTED: probable chlorophyll(ide) b reduc...  72.0    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010440670.1|  PREDICTED: probable chlorophyll(ide) b reduc...  72.0    1e-11   Camelina sativa [gold-of-pleasure]
ref|NP_001147506.1|  LOC100281115                                     71.6    1e-11   
ref|XP_002514298.1|  short-chain dehydrogenase, putative              71.6    1e-11   Ricinus communis
gb|KDO50903.1|  hypothetical protein CISIN_1g010380mg                 71.6    2e-11   Citrus sinensis [apfelsine]
gb|KDP33676.1|  hypothetical protein JCGZ_07247                       71.2    2e-11   Jatropha curcas
tpg|DAA52781.1|  TPA: hypothetical protein ZEAMMB73_885268            70.5    3e-11   
ref|XP_006283586.1|  hypothetical protein CARUB_v10004643mg           70.5    4e-11   Capsella rubella
gb|KFK39772.1|  hypothetical protein AALP_AA3G285600                  70.5    5e-11   Arabis alpina [alpine rockcress]
ref|XP_010532859.1|  PREDICTED: probable chlorophyll(ide) b reduc...  70.1    5e-11   Tarenaya hassleriana [spider flower]
gb|ACN31897.1|  unknown                                               70.1    5e-11   Zea mays [maize]
ref|XP_003620674.1|  Oxidoreductase                                   68.9    9e-11   
ref|XP_002863155.1|  short-chain dehydrogenase/reductase family p...  69.3    1e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_010915806.1|  PREDICTED: probable chlorophyll(ide) b reduc...  69.3    1e-10   Elaeis guineensis
ref|NP_001190716.1|  probable chlorophyll(ide) b reductase NYC1       68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567400.1|  probable chlorophyll(ide) b reductase NYC1          68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457093.1|  hypothetical protein SORBIDRAFT_03g001100        68.9    1e-10   Sorghum bicolor [broomcorn]
ref|NP_001042468.1|  Os01g0227100                                     68.9    1e-10   
gb|EEC70221.1|  hypothetical protein OsI_00981                        68.9    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_003620673.1|  Oxidoreductase                                   68.9    2e-10   Medicago truncatula
ref|XP_004967428.1|  PREDICTED: probable chlorophyll(ide) b reduc...  68.6    2e-10   Setaria italica
ref|XP_009381052.1|  PREDICTED: probable chlorophyll(ide) b reduc...  68.2    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006645666.1|  PREDICTED: probable chlorophyll(ide) b reduc...  67.8    3e-10   Oryza brachyantha
ref|XP_009409056.1|  PREDICTED: probable chlorophyll(ide) b reduc...  67.4    4e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003565871.1|  PREDICTED: probable chlorophyll(ide) b reduc...  67.0    5e-10   Brachypodium distachyon [annual false brome]
ref|XP_008795044.1|  PREDICTED: probable chlorophyll(ide) b reduc...  67.0    6e-10   Phoenix dactylifera
gb|KCW79681.1|  hypothetical protein EUGRSUZ_C01035                   65.5    2e-09   Eucalyptus grandis [rose gum]
dbj|BAJ87391.1|  predicted protein                                    65.5    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010047726.1|  PREDICTED: probable chlorophyll(ide) b reduc...  65.1    3e-09   Eucalyptus grandis [rose gum]
ref|XP_009107686.1|  PREDICTED: probable chlorophyll(ide) b reduc...  65.1    3e-09   Brassica rapa
gb|KCW79680.1|  hypothetical protein EUGRSUZ_C01035                   65.1    3e-09   Eucalyptus grandis [rose gum]
ref|XP_008463393.1|  PREDICTED: probable chlorophyll(ide) b reduc...  64.3    5e-09   Cucumis melo [Oriental melon]
ref|XP_004150053.1|  PREDICTED: probable chlorophyll(ide) b reduc...  64.3    5e-09   Cucumis sativus [cucumbers]
ref|XP_004162801.1|  PREDICTED: probable chlorophyll(ide) b reduc...  64.3    5e-09   
gb|EMT15486.1|  Carbonyl reductase family member 4                    63.5    6e-09   
gb|EMS48016.1|  putative chlorophyll(ide) b reductase NYC1, chlor...  63.5    6e-09   Triticum urartu
ref|XP_010688205.1|  PREDICTED: probable chlorophyll(ide) b reduc...  63.9    7e-09   Beta vulgaris subsp. vulgaris [field beet]
emb|CAB41935.1|  putative protein                                     62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006833298.1|  hypothetical protein AMTR_s00109p00036750        59.3    2e-07   Amborella trichopoda
ref|XP_006293296.1|  hypothetical protein CARUB_v10019631mg           52.4    5e-06   
emb|CDY72671.1|  BnaAnng41980D                                        47.4    2e-04   Brassica napus [oilseed rape]



>ref|XP_009626733.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nicotiana tomentosiformis]
Length=506

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 110/159 (69%), Gaps = 11/159 (7%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHR---RPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRs  184
            MA VAK+++S+LECH +YHR    PP  G    R V    P  VKG  RI L+PCR+F+S
Sbjct  1    MAMVAKVHVSTLECHHYYHRGSGHPPLSGNVLPRVVTTWDPLIVKGRRRIVLQPCRSFKS  60

Query  185  xeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFL  364
             +   +          E++K ++ LV   RSAVWSCSKPSLR++ KFRE +EKLEE LFL
Sbjct  61   EDEYVKGS--------ETKKPVNKLVGAIRSAVWSCSKPSLRTENKFREAIEKLEERLFL  112

Query  365  LALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            LALYVGRYI+TMMSTG ++ IGFQLS GDS MN+L WYS
Sbjct  113  LALYVGRYIITMMSTGVVMFIGFQLSGGDSQMNELIWYS  151



>ref|XP_009770954.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nicotiana sylvestris]
Length=506

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 109/159 (69%), Gaps = 11/159 (7%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHR---RPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRs  184
            MA VAK+++S+LECH +YHR    PP  G    R V    P  VKG  +I ++PCR+F+S
Sbjct  1    MAMVAKVHVSTLECHHYYHRGSGHPPLSGNVLPRVVTTWDPLIVKGRRKIVVQPCRSFKS  60

Query  185  xeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFL  364
             +   +          E +K ++ LV   RSAVWSCSKPSLR++ KFRE +EKLEE LFL
Sbjct  61   EDEYVKGS--------EIKKPMNKLVGAIRSAVWSCSKPSLRTENKFREAIEKLEERLFL  112

Query  365  LALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            LALY+GRYI+TMMSTG ++ IGFQLS GDS MN+L WYS
Sbjct  113  LALYLGRYIITMMSTGVVMFIGFQLSGGDSQMNELIWYS  151



>gb|ACH54085.1| putative chlorophyll b reductase [Nicotiana tabacum]
Length=506

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 109/159 (69%), Gaps = 11/159 (7%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHR---RPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRs  184
            MA VAK+++S+LECH +YHR    PP  G    R V    P  VKG  +I ++PCR+F+S
Sbjct  1    MAMVAKVHVSTLECHHYYHRGSGHPPLSGNVLPRVVTTWDPLIVKGRRKIVVQPCRSFKS  60

Query  185  xeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFL  364
             +   +          E +K ++ LV   RSAVWSCSKPSLR++ KFRE +EKLEE LFL
Sbjct  61   EDEYVKGS--------EIKKPMNKLVGAIRSAVWSCSKPSLRTENKFREAIEKLEERLFL  112

Query  365  LALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            LALY+GRYI+TMMSTG ++ IGFQLS GDS MN+L WYS
Sbjct  113  LALYLGRYIITMMSTGVVMFIGFQLSGGDSQMNELIWYS  151



>ref|XP_011093590.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Sesamum indicum]
 ref|XP_011093591.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Sesamum indicum]
Length=523

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 98/166 (59%), Gaps = 12/166 (7%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxeg  193
            M TVAKL++  L+C      RPPP    F R      P  VKG GRI  +PCR+FRS EG
Sbjct  1    MTTVAKLHVPPLDCRHQAGERPPPR--HFLRHRLFWDPVCVKGRGRIWARPCRSFRSEEG  58

Query  194  gseeg----------eFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEK  343
               E           E      + + K ++  + G R+A+W  SKPSLRS+ K  E +EK
Sbjct  59   VGTEEKEKKGEENCGEVRGSNGFAAGKDVNKFLGGIRNAIWRVSKPSLRSERKLAEAMEK  118

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            LEE LF  ++++GRYIVTM+STG IL+IGFQLS GD  MN L WYS
Sbjct  119  LEETLFSFSMHIGRYIVTMLSTGVILLIGFQLSGGDDQMNALVWYS  164



>ref|XP_006360473.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Solanum tuberosum]
Length=486

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 96/156 (62%), Gaps = 25/156 (16%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxeg  193
            M  VAK+++S+L+CH+       P G  FR  +         G  R+ ++PCR+F+S + 
Sbjct  1    MDMVAKVHVSTLDCHRLL-----PTGNVFRPLI---------GRRRVVVQPCRSFKSEDV  46

Query  194  gseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLAL  373
            G  E     K+           V   RSAVWSCSKPSLR++ K RE +E LEE LF LAL
Sbjct  47   GPAEYVKVNKF-----------VGAIRSAVWSCSKPSLRTENKLREAMEMLEERLFSLAL  95

Query  374  YVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            YVGRYI+TMMSTG ++ +GFQLS GDS MN+L WYS
Sbjct  96   YVGRYIITMMSTGVVMFVGFQLSGGDSQMNELIWYS  131



>ref|XP_004242955.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=484

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 94/156 (60%), Gaps = 27/156 (17%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxeg  193
            M  VAK+++S+   H        P    FR S+       V G  R+ ++PCR+F+S   
Sbjct  1    MDMVAKVHVST---HHLL-----PSSNVFRPSI-----VKVHGRRRVFVQPCRSFKSD--  45

Query  194  gseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLAL  373
                   D +Y       ++ LV   RSAVWSCSKPSLR++ K RE +E LEE LF LAL
Sbjct  46   -------DAEY-----VKVNKLVGAIRSAVWSCSKPSLRTENKLREAMEMLEERLFWLAL  93

Query  374  YVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            YVGRYI+TMMSTG ++ +GFQLS GDS MN+L WYS
Sbjct  94   YVGRYIITMMSTGVVMFVGFQLSGGDSQMNELIWYS  129



>ref|XP_010323446.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=505

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 94/156 (60%), Gaps = 27/156 (17%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxeg  193
            M  VAK+++S+   H        P    FR S+       V G  R+ ++PCR+F+S   
Sbjct  1    MDMVAKVHVST---HHLL-----PSSNVFRPSI-----VKVHGRRRVFVQPCRSFKSD--  45

Query  194  gseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLAL  373
                   D +Y       ++ LV   RSAVWSCSKPSLR++ K RE +E LEE LF LAL
Sbjct  46   -------DAEY-----VKVNKLVGAIRSAVWSCSKPSLRTENKLREAMEMLEERLFWLAL  93

Query  374  YVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            YVGRYI+TMMSTG ++ +GFQLS GDS MN+L WYS
Sbjct  94   YVGRYIITMMSTGVVMFVGFQLSGGDSQMNELIWYS  129



>emb|CDP03330.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 94/160 (59%), Gaps = 12/160 (8%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxeg  193
            MAT+AKL++S    +  +    PP+   F  S+       VKG  RIR +PCR+FRS E 
Sbjct  1    MATMAKLHVSP---YTKWTVHSPPVRQGFPPSILTWDSVSVKGRCRIRFRPCRSFRSEEE  57

Query  194  ----gseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLF  361
                 S+      K   +S+   D ++R  RS VW  SKPS RS     + LE+LEE L 
Sbjct  58   PNERASKGEILKGKNGLQSKTSADEVLRAIRSFVWKFSKPSSRS-----QALEQLEEKLS  112

Query  362  LLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             +A+ + RYIVTMMSTGAIL+IGF+LS GD  MN+L WYS
Sbjct  113  GVAIQIARYIVTMMSTGAILLIGFRLSGGDGQMNELIWYS  152



>gb|EPS61243.1| hypothetical protein M569_13555, partial [Genlisea aurea]
Length=434

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +2

Query  251  DNLVRGFRSAVWSCSKPSLRS-DYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMI  427
            + LV   R AVWS SKPSLRS +  FRE +EKLEE LF L+++VGRYIVTM+STG IL+I
Sbjct  1    NKLVGSIRKAVWSVSKPSLRSSESAFREAMEKLEETLFALSIHVGRYIVTMLSTGVILLI  60

Query  428  GFQLSXGDSXMNDLXWYS  481
            GFQLS GD  MN L WYS
Sbjct  61   GFQLSGGDEQMNTLVWYS  78



>gb|EYU18157.1| hypothetical protein MIMGU_mgv1a0102811mg, partial [Erythranthe 
guttata]
Length=146

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 87/152 (57%), Gaps = 17/152 (11%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxeg  193
            M T+AKLNL  L+ H    + PP L   FR    +  P   KG GR  ++   +FRS EG
Sbjct  1    MTTLAKLNLRPLDSHLQTGQPPPRL--LFRHRF-LFDPVRAKGRGRFCIQ---SFRSKEG  54

Query  194  gseegeFDKKY-----------WWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLE  340
                 E +KK             + S+K L+ LV   R++VW  SKPSLRS     E +E
Sbjct  55   SGGMEEKNKKIEENRGELMTSNGYGSRKSLNKLVAAVRNSVWRVSKPSLRSQLNSIEAME  114

Query  341  KLEENLFLLALYVGRYIVTMMSTGAILMIGFQ  436
            KLE+ LF +++++GRYIVTM+STG IL+IGF+
Sbjct  115  KLEDTLFSISMHIGRYIVTMLSTGVILLIGFK  146



>ref|XP_008386425.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Malus domestica]
Length=351

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 91/169 (54%), Gaps = 23/169 (14%)
 Frame = +2

Query  14   MATVAKLNL--SSLECHQFY-HRRPPP---LGGCFRRSVXVLYPFGVKG-CGRIRLKPCR  172
            MA VA+L+    SLE   F  HR   P   +G  FRRS  +L   G  G C    LKPCR
Sbjct  1    MAVVARLHACPQSLEHFNFKDHRGTGPAVVIGSGFRRSGGLLA--GRNGFC----LKPCR  54

Query  173  AFRsxeggseegeFDKKYWWESQKGLDNLVRG------FRSAVWSCSKPSLRSDYKFRER  334
            +FR  + G +     ++   ES +   NL +G       +S+VW       R   + R+ 
Sbjct  55   SFRGEDNGGDA----EEGEAESARXRGNLKKGGGILKSLKSSVWGGFGLRFRDGDEHRKA  110

Query  335  LEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            + KLEE     A+ +GRYIVTMMSTG IL IGFQLS GD+ +N+L WYS
Sbjct  111  VAKLEEICQSAAVQIGRYIVTMMSTGVILAIGFQLSGGDADLNELVWYS  159



>ref|XP_008337383.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Malus domestica]
Length=520

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 89/166 (54%), Gaps = 14/166 (8%)
 Frame = +2

Query  14   MATVAKLNL--SSLECHQF-YHRRPPP---LGGCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA VA+L++   SLE   F  HR   P    G  FRRS  +L P G  G     LKPCR+
Sbjct  1    MAMVARLHVCPQSLEHFNFKIHRGTGPELIXGSGFRRSGGLL-PAGRNG---FSLKPCRS  56

Query  176  FRsxeggseegeFD----KKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEK  343
            FR  + G    E +    +K     + G   +++  +S+V        R   ++R  + K
Sbjct  57   FRGEDNGGGAEEGEEESARKRGNLKKGGGTGILKSLKSSVLGGFGVGFRDGEEYRNAVAK  116

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            LEE     A+ +GRYIVTMMSTG IL IGFQLS GDS +N+L WYS
Sbjct  117  LEEVCQSAAVQIGRYIVTMMSTGVILAIGFQLSGGDSDLNELVWYS  162



>ref|XP_010249726.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nelumbo nucifera]
Length=528

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 85/174 (49%), Gaps = 23/174 (13%)
 Frame = +2

Query  14   MATVAKLNLS--SLECHQFYHRRP--PPLGGCFRRSVXVLYPFGVKGCG----RIRLKPC  169
            MATVAKL++S  SL  HQ    RP   P    F RS   L    V G      RI L+PC
Sbjct  1    MATVAKLHVSPPSLRDHQRTDHRPRFQPF---FHRSPATLDAIPVPGQPNLHRRISLQPC  57

Query  170  RAFRsxeggseegeFDKKYWWESQKGLDNLVRGFRSAVW----------SCSKPSLRSDY  319
            R+FRS  G     +   K   +       L    R+             S S+P L+ + 
Sbjct  58   RSFRSENGRESVEKETGKASKDKNSKQTRLQPKKRTGALYSLKSIILKLSGSRPPLQGEC  117

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
              R+ + K EE  F +A  VGRY+VTM STG IL IGFQLS GDS MN L WYS
Sbjct  118  --RDAVAKAEEIFFSVATQVGRYLVTMTSTGVILAIGFQLSGGDSQMNTLIWYS  169



>ref|XP_008242653.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Prunus mume]
Length=518

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 92/171 (54%), Gaps = 26/171 (15%)
 Frame = +2

Query  14   MATVAKLNL--SSLECHQF--YHRRPPP--LGGCFRRSVXVLYPFGVKG-CGRIRLKPCR  172
            MA VA+L++   SLE   F  YHR  P   +G   RRS  VL P G  G C    LK CR
Sbjct  1    MAMVARLHVCPQSLEPFNFKDYHRTGPTVIIGSGIRRSGSVL-PTGRNGFC----LKQCR  55

Query  173  AFRsxeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------RSDYKFR  328
            +FR  +G        ++   ES     NL +G  S +W     ++        R+  ++R
Sbjct  56   SFRGEDGRDAV----EEKEAESAGKRGNLKKG--SGIWKSLSSTVLGGFGLRSRNSDEYR  109

Query  329  ERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            + + KLEE     A+ +GRYIVTMMSTG IL IGFQLS GDS +++L WYS
Sbjct  110  KAVAKLEEVCSSAAVQIGRYIVTMMSTGVILAIGFQLSGGDSQLSELVWYS  160



>ref|XP_009374020.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Pyrus x bretschneideri]
Length=520

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 90/166 (54%), Gaps = 14/166 (8%)
 Frame = +2

Query  14   MATVAKLNL--SSLECHQFY-HRRPPP---LGGCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA VA+L++   SLE   F  HR   P   +G  FRRS  +L P G  G     LKPCR+
Sbjct  1    MAMVARLHVCPQSLEHFNFKDHRGTGPELIIGSGFRRSGGLL-PAGRNG---FSLKPCRS  56

Query  176  FRsxeggseegeFD----KKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEK  343
            FR  + G    E +    +K     + G   +++  +S+V       LR   ++R  + K
Sbjct  57   FRGEDNGGGTEEGEEESARKCRNLKKGGGSGILKSLKSSVLGGFGVGLRDGEEYRNAVAK  116

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            LEE     A+ +GRYIVTMMSTG IL IGFQLS GDS +N+L  YS
Sbjct  117  LEEVCQSAAVQIGRYIVTMMSTGVILAIGFQLSGGDSDLNELVCYS  162



>ref|XP_007013169.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY30788.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=461

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 92/169 (54%), Gaps = 19/169 (11%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFY----HRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFR  181
            MA V KL+L + +  Q +     +R    GGCF R     +P   +    + ++ CR+FR
Sbjct  1    MAAVTKLHLCTFQKDQHFCFEEQQRNWLKGGCFVR-----FPVITRNRNGVYVQRCRSFR  55

Query  182  sxeggseegeFD---------KKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRER  334
              +GG  E +           K+   + ++G D   + FRS+V+  SK   +S  ++ + 
Sbjct  56   GEDGGEVEEKEMESEGKYGDVKENKVKLEQG-DGFWKSFRSSVFGVSKFGSQSQDEYEKA  114

Query  335  LEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            + K+EE    +A+ +GRYIVTM+STG IL+ GFQLS GDS MN L WYS
Sbjct  115  VAKVEEVFSSIAMQIGRYIVTMLSTGVILLTGFQLSGGDSQMNTLIWYS  163



>ref|XP_007013168.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY30787.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=472

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 89/168 (53%), Gaps = 17/168 (10%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFY----HRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFR  181
            MA V KL+L + +  Q +     +R    GGCF R     +P   +    + ++ CR+FR
Sbjct  1    MAAVTKLHLCTFQKDQHFCFEEQQRNWLKGGCFVR-----FPVITRNRNGVYVQRCRSFR  55

Query  182  sxeggseegeF--------DKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERL  337
              +GG  E +         D K      +  D   + FRS+V+  SK   +S  ++ + +
Sbjct  56   GEDGGEVEEKEMESEGKYGDVKENKVKLEQGDGFWKSFRSSVFGVSKFGSQSQDEYEKAV  115

Query  338  EKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             K+EE    +A+ +GRYIVTM+STG IL+ GFQLS GDS MN L WYS
Sbjct  116  AKVEEVFSSIAMQIGRYIVTMLSTGVILLTGFQLSGGDSQMNTLIWYS  163



>ref|XP_007013167.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY30786.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=522

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 89/168 (53%), Gaps = 17/168 (10%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFY----HRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFR  181
            MA V KL+L + +  Q +     +R    GGCF R     +P   +    + ++ CR+FR
Sbjct  1    MAAVTKLHLCTFQKDQHFCFEEQQRNWLKGGCFVR-----FPVITRNRNGVYVQRCRSFR  55

Query  182  sxeggseegeF--------DKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERL  337
              +GG  E +         D K      +  D   + FRS+V+  SK   +S  ++ + +
Sbjct  56   GEDGGEVEEKEMESEGKYGDVKENKVKLEQGDGFWKSFRSSVFGVSKFGSQSQDEYEKAV  115

Query  338  EKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             K+EE    +A+ +GRYIVTM+STG IL+ GFQLS GDS MN L WYS
Sbjct  116  AKVEEVFSSIAMQIGRYIVTMLSTGVILLTGFQLSGGDSQMNTLIWYS  163



>ref|XP_007013166.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY30785.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=521

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 89/168 (53%), Gaps = 17/168 (10%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFY----HRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFR  181
            MA V KL+L + +  Q +     +R    GGCF R     +P   +    + ++ CR+FR
Sbjct  1    MAAVTKLHLCTFQKDQHFCFEEQQRNWLKGGCFVR-----FPVITRNRNGVYVQRCRSFR  55

Query  182  sxeggseegeF--------DKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERL  337
              +GG  E +         D K      +  D   + FRS+V+  SK   +S  ++ + +
Sbjct  56   GEDGGEVEEKEMESEGKYGDVKENKVKLEQGDGFWKSFRSSVFGVSKFGSQSQDEYEKAV  115

Query  338  EKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             K+EE    +A+ +GRYIVTM+STG IL+ GFQLS GDS MN L WYS
Sbjct  116  AKVEEVFSSIAMQIGRYIVTMLSTGVILLTGFQLSGGDSQMNTLIWYS  163



>gb|AHM26648.1| reductase NYC [Pyrus x bretschneideri]
Length=515

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 85/165 (52%), Gaps = 17/165 (10%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFY---HRRPPP---LGGCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA VA+ +        F    HR   P   +G  FRRS  +L       C    LKPCR+
Sbjct  1    MAMVARFHACPHSLEHFNVKDHRGTGPAVIIGCGFRRSGGLLAAGRNGFC----LKPCRS  56

Query  176  FRsxeggseegeFDKKYWWESQKGLDNLVRG---FRSAVWSCSKPSLRSDYKFRERLEKL  346
            FR  + G +  E +     ES +   NL +G    +S+VW       R   + R+ + KL
Sbjct  57   FRGEDNGGDAEEGEA----ESARKRGNLKKGGGILKSSVWGGFGWGFRDGDEHRKAVAKL  112

Query  347  EENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            EE     A+ +GRYIVTMMSTG IL IGFQLS GD+ +N+L WYS
Sbjct  113  EEICQSAAVQIGRYIVTMMSTGVILAIGFQLSGGDADLNELVWYS  157



>ref|XP_009371459.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Pyrus x bretschneideri]
Length=515

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 85/165 (52%), Gaps = 17/165 (10%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFY---HRRPPP---LGGCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA VA+ +        F    HR   P   +G  FRRS  +L      G     LKPCR+
Sbjct  1    MAMVARFHACPHSLEHFNVKDHRGTGPAVIIGCGFRRSGGLL----AAGRNGFCLKPCRS  56

Query  176  FRsxeggseegeFDKKYWWESQKGLDNLVRG---FRSAVWSCSKPSLRSDYKFRERLEKL  346
            FR  + G +  E +     ES +   NL +G    +S+VW       R   + R+ + KL
Sbjct  57   FRGEDNGGDAEEGEA----ESARKRGNLKKGGGILKSSVWGGFGWGFRDGDEHRKAVAKL  112

Query  347  EENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            EE     A+ +GRYIVTMMSTG IL IGFQLS GD+ +N+L WYS
Sbjct  113  EEICQSAAVQIGRYIVTMMSTGVILAIGFQLSGGDADLNELVWYS  157



>gb|KHG20319.1| hypothetical protein F383_09127 [Gossypium arboreum]
Length=517

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 88/167 (53%), Gaps = 19/167 (11%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLG------GCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA V KL+L + +  Q +  +           GCF     V  P   +      ++ CR+
Sbjct  1    MAAVTKLHLCTFQKDQHFCFKEQKRSWFKVKRGCF-----VGLPVLTRNRRGAYVQKCRS  55

Query  176  FRsxeggseegeFDKKYWWESQKGL-----DNLVRGFRSAVWSCSKPSLRSDYKFRERLE  340
            FR  +GG  E   DK+   E + G+     D   +  +SAV+  SK   +S  ++ + + 
Sbjct  56   FRGGDGGEVE---DKEMESERKLGIWTEKGDGFWKSLKSAVFGVSKFGSQSQDEYEKAVA  112

Query  341  KLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            K+EE   L+A+ +GRYIVTMMSTG IL+ GFQLS GDS MN L WYS
Sbjct  113  KVEEVFSLIAMQIGRYIVTMMSTGVILLTGFQLSGGDSQMNTLIWYS  159



>gb|AEO19898.1| chlorophyll(ide) b reductase, partial [Pyrus x bretschneideri]
Length=304

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 83/168 (49%), Gaps = 20/168 (12%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFY---HRRPPP---LGGCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA VA+ +        F    HR   P   +G  FRRS  +L       C    LKPCR+
Sbjct  1    MAMVARFHACPQSLEHFNVKDHRGTGPAVVIGSGFRRSGGLLAAGRNGFC----LKPCRS  56

Query  176  FRsxeggseegeFDKKYWWESQKGLDNLVRG------FRSAVWSCSKPSLRSDYKFRERL  337
             R  + G +  E +     ES +   NL +G       +S+VW       R   + R+ +
Sbjct  57   LRGEDNGGDAEEGEA----ESARKRGNLKKGGGILKSLKSSVWGGFGWGFRDGDEHRKDV  112

Query  338  EKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             KLEE     A+ +GRYIVTMMSTG IL IGFQ S GD+ +N+L WYS
Sbjct  113  AKLEEICQSAAVQIGRYIVTMMSTGVILAIGFQSSGGDADLNELVWYS  160



>ref|XP_007204378.1| hypothetical protein PRUPE_ppa004339mg [Prunus persica]
 gb|EMJ05577.1| hypothetical protein PRUPE_ppa004339mg [Prunus persica]
Length=515

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 91/168 (54%), Gaps = 27/168 (16%)
 Frame = +2

Query  23   VAKLNL--SSLECHQF--YHRRPPP--LGGCFRRSVXVLYPFGVKG-CGRIRLKPCRAFR  181
            VA+L++   SLE   F  YHR  P   +G  FRRS  VL P G  G C    LK CR+FR
Sbjct  2    VARLHVCPQSLESFNFKDYHRTGPTVIIGSGFRRSGSVL-PTGRNGFC----LKQCRSFR  56

Query  182  sxeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------RSDYKFRERL  337
              +G        ++   ES     NL +G  S +W     ++        R+  ++R+ +
Sbjct  57   GEDGRDVV----EEKVAESAGKRGNL-KG--SGIWKSLSSTVLGGFGLRSRNSDEYRKAV  109

Query  338  EKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             KLEE     A+ +GRYIVTMMSTG IL IGFQLS GDS +++L WYS
Sbjct  110  AKLEEVCSSAAVQIGRYIVTMMSTGVILAIGFQLSGGDSQLSELVWYS  157



>gb|KJB54194.1| hypothetical protein B456_009G025000 [Gossypium raimondii]
Length=473

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 87/165 (53%), Gaps = 15/165 (9%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLG------GCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA V KL+L + +  Q +  +           GCF     V  P   +      ++ CR+
Sbjct  1    MAAVTKLHLCTFQKDQHFCFKEQKRSWFKVKRGCF-----VGLPVLTRNRRGAYVQKCRS  55

Query  176  FRsx---eggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKL  346
            FR     E   ++ E ++K    ++KG D   +  +SAV+  SK   +S  ++ + + K+
Sbjct  56   FRGGDGGEVEEKDMESERKLGIWTEKG-DGFWKCLKSAVFGVSKFGSQSQDEYEKAVAKV  114

Query  347  EENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            EE    +A+ +GRYIVTMMSTG IL+ GFQLS GDS MN L WYS
Sbjct  115  EEVFSSIAMQIGRYIVTMMSTGVILLTGFQLSGGDSQMNTLIWYS  159



>gb|KJB54193.1| hypothetical protein B456_009G025000 [Gossypium raimondii]
Length=517

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 87/165 (53%), Gaps = 15/165 (9%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLG------GCFRRSVXVLYPFGVKGCGRIRLKPCRA  175
            MA V KL+L + +  Q +  +           GCF     V  P   +      ++ CR+
Sbjct  1    MAAVTKLHLCTFQKDQHFCFKEQKRSWFKVKRGCF-----VGLPVLTRNRRGAYVQKCRS  55

Query  176  FRsx---eggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKL  346
            FR     E   ++ E ++K    ++KG D   +  +SAV+  SK   +S  ++ + + K+
Sbjct  56   FRGGDGGEVEEKDMESERKLGIWTEKG-DGFWKCLKSAVFGVSKFGSQSQDEYEKAVAKV  114

Query  347  EENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            EE    +A+ +GRYIVTMMSTG IL+ GFQLS GDS MN L WYS
Sbjct  115  EEVFSSIAMQIGRYIVTMMSTGVILLTGFQLSGGDSQMNTLIWYS  159



>ref|XP_006583379.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
isoform X2 [Glycine max]
Length=437

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 84/168 (50%), Gaps = 25/168 (15%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKG----CGRIRLKPCRAFR  181
            MATV KL++   EC      R        RR        GV G    C R  +K CRAFR
Sbjct  1    MATVVKLHVVP-ECLNQQKTRS------LRRGFGSCPSPGVLGFGHYCDRFSVKVCRAFR  53

Query  182  sxeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------RSDYKFRERL  337
            + +GG       +K     +K  +   R   S  WS  K  L        +SD ++R+ +
Sbjct  54   TEDGGD----VKEKKLRNLKKNEEKTKR--ESGFWSSLKSILLRNFMVGSKSDDEYRQAV  107

Query  338  EKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             K+E  L  +A+ +GRYIVTMMSTG IL IGFQ+S GDS M+ L WYS
Sbjct  108  AKVEGLLSSIAIQIGRYIVTMMSTGVILSIGFQMSGGDSQMDALIWYS  155



>ref|XP_011043468.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Populus euphratica]
Length=518

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 88/167 (53%), Gaps = 15/167 (9%)
 Frame = +2

Query  2    IFFTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGV-KGCGRIRLKPCRAF  178
            +  T   ++  NL  L   +  H+R   LG  F  S      FGV K    + ++ CR+F
Sbjct  3    VMITKLHISPQNLDKLSFEE--HQRSRSLGRGFLSS-----GFGVHKKSYALCVQQCRSF  55

Query  179  RsxeggseegeFDKKY------WWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLE  340
            ++ +G   E +  +KY        +S+KG        ++  W  + PS +S+ + RE + 
Sbjct  56   KTKDGEGVEEKQKEKYEILKENQSKSKKGSGFWTSLKKAVSWVGTLPS-QSNEEHREAVA  114

Query  341  KLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +LEE     AL +GRYIVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  115  RLEEVFSSAALQIGRYIVTMMSTGVVLAVGFQLSGGDSQMNTLIWYS  161



>ref|XP_010099589.1| putative chlorophyll(ide) b reductase NYC1 [Morus notabilis]
 gb|EXB79941.1| putative chlorophyll(ide) b reductase NYC1 [Morus notabilis]
Length=515

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 67/118 (57%), Gaps = 8/118 (7%)
 Frame = +2

Query  152  IRLKPCRAFRsxeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------  307
            +RLK CRA+RS E    E E +        K  + L     S  WSC K ++        
Sbjct  39   VRLKGCRAYRSEEDQLGEKEMESARKSGKVKEKETLKLRKGSGFWSCLKYAVTRGFGFGP  98

Query  308  RSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            R+D ++ + + KLEE    +A+ +GRYIVTMMSTG IL +GFQLS GD+ +N L WYS
Sbjct  99   RNDDEYSKAVAKLEEVFSSIAIQIGRYIVTMMSTGVILGVGFQLSGGDNQLNTLIWYS  156



>ref|XP_002280953.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X2 [Vitis vinifera]
 emb|CBI28069.3| unnamed protein product [Vitis vinifera]
Length=517

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 87/167 (52%), Gaps = 20/167 (12%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPP--PLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsx  187
            MA V KL +S    H   H R    PL    RR   V +    +G   + L PCR+FRS 
Sbjct  1    MAAVTKLQISPYSLHPRTHHRAARWPL----RRPQFVSF----RGRRGVYLLPCRSFRSG  52

Query  188  eggseegeFDKKYWWESQKGLDNLVRGFR-SAVWSCSKPSL--------RSDYKFRERLE  340
            +GG  E + +K+   +     +N V G   S + S +K           R++ + R  + 
Sbjct  53   DGGELEEQ-EKESVRKGGNLKENRVEGKEGSGILSFAKSVFVRVSGSFPRTEEEHRIAVA  111

Query  341  KLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            KLEE    +A+ +GRYIVTMMSTG IL IGFQLS GDS MN L WYS
Sbjct  112  KLEEIFSSIAVQIGRYIVTMMSTGVILAIGFQLSGGDSQMNALIWYS  158



>ref|XP_010254115.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Nelumbo nucifera]
Length=528

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 88/181 (49%), Gaps = 37/181 (20%)
 Frame = +2

Query  14   MATVAKLNLSSL---ECHQ---------FYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIR  157
            MA VAKL++S     +C++          +HR P  L     R      P G +G   + 
Sbjct  1    MAIVAKLHMSPQSLGDCYRIDLGPRFRPLFHRSPATLDAIPLRG----QPNGRRG---LS  53

Query  158  LKPCRAFRsxeggseegeFDKKYWWESQKGLDNLVR-----------GFRSAVW--SCSK  298
            L+ CR+FRS  G       +K+    S+ G     R             +S +   S S+
Sbjct  54   LQTCRSFRSDGGSES---VEKEVGEVSKGGASEQTRLQPKKKSRALYSLKSFILKVSGSR  110

Query  299  PSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWY  478
            P L+ +Y  R+ + K EE  F +A  VG Y+VTMMSTG +L IGFQLS GDS MN L WY
Sbjct  111  PPLQGEY--RDAVAKAEEIFFSVATQVGSYLVTMMSTGVVLTIGFQLSGGDSQMNTLIWY  168

Query  479  S  481
            S
Sbjct  169  S  169



>ref|XP_002324420.2| hypothetical protein POPTR_0018s08790g [Populus trichocarpa]
 gb|EEF02985.2| hypothetical protein POPTR_0018s08790g [Populus trichocarpa]
Length=518

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 89/167 (53%), Gaps = 15/167 (9%)
 Frame = +2

Query  2    IFFTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGV-KGCGRIRLKPCRAF  178
            +  T   ++  NL  L   +  H+R   LG  F  S      FGV K    + ++ CR+F
Sbjct  3    VMITKLHISPQNLDKLSFEE--HQRSRSLGRGFLSS-----GFGVHKKSYALCVQQCRSF  55

Query  179  RsxeggseegeFDKKY------WWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLE  340
            ++ +GG  E +  +KY        +S+KG        ++  W  + PS +S+ + RE + 
Sbjct  56   KTKDGGGVEEKQKEKYEILKENQSKSKKGSGFWTSLKKAVSWVGTLPS-QSNEEHREAVA  114

Query  341  KLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +LEE     AL +GRYIVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  115  RLEEVFSSAALQIGRYIVTMMSTGVVLAVGFQLSGGDSQMNTLIWYS  161



>ref|XP_003528914.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN20677.1| Putative chlorophyll(ide) b reductase NYC1, chloroplastic [Glycine 
soja]
Length=514

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 84/168 (50%), Gaps = 25/168 (15%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKG----CGRIRLKPCRAFR  181
            MATV KL++   EC      R        RR        GV G    C R  +K CRAFR
Sbjct  1    MATVVKLHVVP-ECLNQQKTRS------LRRGFGSCPSPGVLGFGHYCDRFSVKVCRAFR  53

Query  182  sxeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------RSDYKFRERL  337
            + +GG       +K     +K  +   R   S  WS  K  L        +SD ++R+ +
Sbjct  54   TEDGGD----VKEKKLRNLKKNEEKTKR--ESGFWSSLKSILLRNFMVGSKSDDEYRQAV  107

Query  338  EKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             K+E  L  +A+ +GRYIVTMMSTG IL IGFQ+S GDS M+ L WYS
Sbjct  108  AKVEGLLSSIAIQIGRYIVTMMSTGVILSIGFQMSGGDSQMDALIWYS  155



>ref|XP_003534200.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Glycine max]
 gb|KHN45640.1| Putative chlorophyll(ide) b reductase NYC1, chloroplastic [Glycine 
soja]
Length=515

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 87/166 (52%), Gaps = 20/166 (12%)
 Frame = +2

Query  14   MATVAKLNL--SSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsx  187
            MATV KL++   SL  H+    R    G C    V     FG K   +  +K CRAFR+ 
Sbjct  1    MATVVKLHVFPESLNQHKTRLLRRG-FGSCPSPGV---LGFGHKNYDQFSVKVCRAFRTE  56

Query  188  eggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------RSDYKFRERLEK  343
            +GG       +K +   +K  +   R   S  WS  K  L        +SD ++R+ + K
Sbjct  57   DGGD----VKEKKFRNLKKNEEKTKR--ESGFWSSLKSILLRNFMVGSKSDDEYRQAVVK  110

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +E  L  +A+ +GRYIVTMMSTG IL IGFQ+S GDS M+ L WYS
Sbjct  111  VEGLLSSIAIQIGRYIVTMMSTGVILSIGFQMSGGDSQMDALIWYS  156



>ref|XP_006451162.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|ESR64402.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
Length=471

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 86/166 (52%), Gaps = 22/166 (13%)
 Frame = +2

Query  8    FTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGR---IRLKPCRAF  178
             T AT+ K ++S L+   +Y  +    G C R +    Y  G+    R   + ++PCR+F
Sbjct  1    MTTATLTKPHIS-LQTLHYYCFKDQQRGPCLRPAS---YRSGLGAHKRRYGLHMQPCRSF  56

Query  179  RsxeggseegeFDKKYWWESQKGLD-NLVRGF----RSAVWSCSKPSLRSDYKFRERLEK  343
            ++          D K   E++  L      GF    +  ++  + P  +S  ++ + + K
Sbjct  57   KT----------DDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAK  106

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +E+    +A+ +GRYIVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  107  VEKVFSSIAIQIGRYIVTMMSTGVVLAVGFQLSGGDSQMNALIWYS  152



>ref|XP_006451163.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
 gb|ESR64403.1| hypothetical protein CICLE_v10008039mg [Citrus clementina]
Length=512

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 86/166 (52%), Gaps = 22/166 (13%)
 Frame = +2

Query  8    FTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGR---IRLKPCRAF  178
             T AT+ K ++S L+   +Y  +    G C R +    Y  G+    R   + ++PCR+F
Sbjct  1    MTTATLTKPHIS-LQTLHYYCFKDQQRGPCLRPAS---YRSGLGAHKRRYGLHMQPCRSF  56

Query  179  RsxeggseegeFDKKYWWESQKGLD-NLVRGF----RSAVWSCSKPSLRSDYKFRERLEK  343
            ++          D K   E++  L      GF    +  ++  + P  +S  ++ + + K
Sbjct  57   KT----------DDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAK  106

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +E+    +A+ +GRYIVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  107  VEKVFSSIAIQIGRYIVTMMSTGVVLAVGFQLSGGDSQMNALIWYS  152



>ref|XP_004287406.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=501

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 81/165 (49%), Gaps = 32/165 (19%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPL-GGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxe  190
            MA VA+L++       F ++ P  + G  FR       P G+   G    + CR+FR+ E
Sbjct  1    MAMVARLHICPQSLDSFNYQSPTVVFGSGFR-------PTGLGRNGLCSRQLCRSFRAEE  53

Query  191  ggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------RSDYKFRERLEKL  346
                            ++G   L +G  S VW C + +L        R   ++++ + K+
Sbjct  54   --------------SKEEGEVKLKKG--SGVWKCLRSTLLGGVGLRSRHTEEYKKAVAKV  97

Query  347  EENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            EE     A+ +GRYIVTMMSTG IL IG QLS GDS +N L WYS
Sbjct  98   EEVCSSAAVQIGRYIVTMMSTGVILTIGSQLSGGDSQLNTLVWYS  142



>ref|XP_007152835.1| hypothetical protein PHAVU_004G163900g [Phaseolus vulgaris]
 gb|ESW24829.1| hypothetical protein PHAVU_004G163900g [Phaseolus vulgaris]
Length=512

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 83/170 (49%), Gaps = 29/170 (17%)
 Frame = +2

Query  14   MATVAKLNL--SSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKG----CGRIRLKPCRA  175
            MAT+ KL+L   SL  H+             +R        GV G    C R  ++ CRA
Sbjct  1    MATLVKLHLFPESLSSHRTR---------LLKREFSSCPSSGVVGFGHNCDRFSVRECRA  51

Query  176  FRsxeggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSL--------RSDYKFRE  331
            FR+ +GG      D K           ++    S  WS  +  L        +SD ++R+
Sbjct  52   FRTEDGG------DAKDKKSRNLKKSEVISKRESGFWSSLQSILLRNFMVGSKSDDEYRQ  105

Query  332  RLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             + K+E  L  +A+ +GRYIVTMMSTG IL IGFQ+S GDS M+ L WYS
Sbjct  106  AVVKVEGLLSSIAIQIGRYIVTMMSTGVILSIGFQMSGGDSQMDALIWYS  155



>ref|XP_006475625.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Citrus sinensis]
Length=512

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 86/166 (52%), Gaps = 22/166 (13%)
 Frame = +2

Query  8    FTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGR---IRLKPCRAF  178
             T AT+ K ++S L+   +Y  +    G C R +    Y  G+    R   + ++PCR+F
Sbjct  1    MTPATLTKPHIS-LQTLHYYCFKDQQRGPCLRPAS---YRSGLGAYKRRYGLHMQPCRSF  56

Query  179  RsxeggseegeFDKKYWWESQKGLD-NLVRGF----RSAVWSCSKPSLRSDYKFRERLEK  343
            ++          D K   E++  L      GF    +  ++  + P  +S  ++ + + K
Sbjct  57   KT----------DDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAK  106

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +E+    +A+ +GRYIVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  107  VEKVFSSIAIQIGRYIVTMMSTGVVLAVGFQLSGGDSQMNALIWYS  152



>emb|CDY47326.1| BnaCnng14630D [Brassica napus]
Length=492

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S V   SK    S  ++ +++EKLE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  69   LKSGVLGVSKLGFLSKDEYNQKIEKLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLSGG  128

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  129  DSSMNSLVWYS  139



>ref|XP_006414943.1| hypothetical protein EUTSA_v10024970mg [Eutrema salsugineum]
 dbj|BAJ33699.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ56396.1| hypothetical protein EUTSA_v10024970mg [Eutrema salsugineum]
Length=504

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S V   SK    S  ++ +++EKLE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  74   LKSGVLGVSKLGFISKDEYNQKVEKLEMVFSSIAVQIARYIVTMASTGAILLIGFQLSGG  133

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  134  DSSMNSLVWYS  144



>ref|XP_010450312.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Camelina sativa]
Length=499

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 48/85 (56%), Gaps = 10/85 (12%)
 Frame = +2

Query  227  WWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMS  406
            WW S           +S V   SK    S  +F  ++EKLE     +A+ + RYIVTM S
Sbjct  65   WWSS----------LKSGVLDVSKLGFLSKDEFNHKVEKLEMVFSSIAVQIARYIVTMTS  114

Query  407  TGAILMIGFQLSXGDSXMNDLXWYS  481
            TGAIL+IGFQLS GD  MN L WYS
Sbjct  115  TGAILLIGFQLSGGDGSMNSLVWYS  139



>ref|XP_009139641.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Brassica rapa]
Length=499

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S V   +K    S  ++ +++EKLE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  69   LKSGVLGVTKLGFLSKDEYNQKIEKLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLSGG  128

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  129  DSSMNSLVWYS  139



>emb|CDY01120.1| BnaA04g06990D [Brassica napus]
Length=513

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S V   +K    S  ++ +++EKLE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  69   LKSGVLGVTKLGFLSKDEYNQKIEKLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLSGG  128

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  129  DSSMNSLVWYS  139



>ref|XP_004512981.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Cicer arietinum]
Length=511

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 82/160 (51%), Gaps = 13/160 (8%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsx--  187
            MATVAK+   S   +Q   R+    G C   S  VL  FG    G   LK CRAF++   
Sbjct  1    MATVAKIQFFSDCLNQQRLRK----GFCSYTSSGVL-GFGHNFDG---LKKCRAFKNEDG  52

Query  188  --eggseegeFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLF  361
                  +     K Y  + Q+        FRS +        + D ++R+ + +++E L 
Sbjct  53   GEVKEKKIRNLKKNYEVKVQRE-SGFWNSFRSVLLGNLMVGSKLDDEYRQAVVRVDEVLS  111

Query  362  LLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
             +A+ +GRYIVTMMSTG IL IGFQ+S GDS M+ L WYS
Sbjct  112  KIAVQIGRYIVTMMSTGVILAIGFQMSGGDSQMDALIWYS  151



>ref|XP_010656325.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X1 [Vitis vinifera]
Length=521

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 87/171 (51%), Gaps = 24/171 (14%)
 Frame = +2

Query  14   MATVAKLNLSSLECHQFYHRRPP--PLGGCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsx  187
            MA V KL +S    H   H R    PL    RR   V +    +G   + L PCR+FRS 
Sbjct  1    MAAVTKLQISPYSLHPRTHHRAARWPL----RRPQFVSF----RGRRGVYLLPCRSFRSG  52

Query  188  eggseegeFDKKYWWESQKGLDNLVRGFR-SAVWSCSKPSL--------RSDYKFRERLE  340
            +GG  E + +K+   +     +N V G   S + S +K           R++ + R  + 
Sbjct  53   DGGELEEQ-EKESVRKGGNLKENRVEGKEGSGILSFAKSVFVRVSGSFPRTEEEHRIAVA  111

Query  341  KLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSX----GDSXMNDLXWYS  481
            KLEE    +A+ +GRYIVTMMSTG IL IGFQLS     GDS MN L WYS
Sbjct  112  KLEEIFSSIAVQIGRYIVTMMSTGVILAIGFQLSEFCEGGDSQMNALIWYS  162



>gb|KDO50905.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=308

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 85/166 (51%), Gaps = 22/166 (13%)
 Frame = +2

Query  8    FTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGR---IRLKPCRAF  178
             T AT+ K ++S L+   +Y  +    G C R +    Y  G+    R   + ++PCR+F
Sbjct  1    MTPATLTKPHIS-LQTLHYYCFKDQQRGPCLRPAS---YRSGLGAYKRRYGLHMQPCRSF  56

Query  179  RsxeggseegeFDKKYWWESQKGLD-NLVRGF----RSAVWSCSKPSLRSDYKFRERLEK  343
            ++          D K   E++  L      GF    +  ++  + P  +S  ++ + + K
Sbjct  57   KT----------DDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAK  106

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +E+    +A+ +GR IVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  107  VEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYS  152



>gb|KDO50904.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=396

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 85/166 (51%), Gaps = 22/166 (13%)
 Frame = +2

Query  8    FTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGR---IRLKPCRAF  178
             T AT+ K ++S L+   +Y  +    G C R +    Y  G+    R   + ++PCR+F
Sbjct  1    MTPATLTKPHIS-LQTLHYYCFKDQQRGPCLRPAS---YRSGLGAYKRRYGLHMQPCRSF  56

Query  179  RsxeggseegeFDKKYWWESQKGLD-NLVRGF----RSAVWSCSKPSLRSDYKFRERLEK  343
            ++          D K   E++  L      GF    +  ++  + P  +S  ++ + + K
Sbjct  57   KT----------DDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAK  106

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +E+    +A+ +GR IVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  107  VEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYS  152



>ref|XP_010435297.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Camelina sativa]
Length=499

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S V   SK    S  ++  ++EKLE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  69   LKSGVLGVSKLGFLSKDEYNHKVEKLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLSGG  128

Query  449  DSXMNDLXWYS  481
            D  MN L WYS
Sbjct  129  DGSMNSLVWYS  139



>ref|XP_010440670.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Camelina sativa]
Length=499

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S V   SK    S  ++  ++EKLE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  69   LKSGVLGVSKLGFLSKDEYNHKVEKLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLSGG  128

Query  449  DSXMNDLXWYS  481
            D  MN L WYS
Sbjct  129  DGSMNSLVWYS  139



>ref|NP_001147506.1| LOC100281115 [Zea mays]
 gb|ACG27755.1| oxidoreductase [Zea mays]
Length=509

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  314  DYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +Y+++  +EK EE  F +A  +GRY++TMMS+G +L +GFQLS GDS MN+L WYS
Sbjct  95   EYQYQRAVEKAEEIFFSVATQLGRYVITMMSSGVVLGVGFQLSGGDSQMNELIWYS  150



>ref|XP_002514298.1| short-chain dehydrogenase, putative [Ricinus communis]
 gb|EEF48252.1| short-chain dehydrogenase, putative [Ricinus communis]
Length=517

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +2

Query  308  RSDYKFRER----LEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXW  475
            RSD   +E     + KLEE    +AL +GRYIVTMMSTG IL +GFQLS GDS MN L W
Sbjct  97   RSDSHSKEEYAKAVAKLEEAFSSIALQIGRYIVTMMSTGVILAVGFQLSGGDSQMNTLIW  156

Query  476  YS  481
            YS
Sbjct  157  YS  158



>gb|KDO50903.1| hypothetical protein CISIN_1g010380mg [Citrus sinensis]
Length=512

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 85/166 (51%), Gaps = 22/166 (13%)
 Frame = +2

Query  8    FTMATVAKLNLSSLECHQFYHRRPPPLGGCFRRSVXVLYPFGVKGCGR---IRLKPCRAF  178
             T AT+ K ++S L+   +Y  +    G C R +    Y  G+    R   + ++PCR+F
Sbjct  1    MTPATLTKPHIS-LQTLHYYCFKDQQRGPCLRPAS---YRSGLGAYKRRYGLHMQPCRSF  56

Query  179  RsxeggseegeFDKKYWWESQKGLD-NLVRGF----RSAVWSCSKPSLRSDYKFRERLEK  343
            ++          D K   E++  L      GF    +  ++  + P  +S  ++ + + K
Sbjct  57   KT----------DDKGENEAESELKLKKTSGFWSSLKDVIFRVNGPGSQSSDEYCKAVAK  106

Query  344  LEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +E+    +A+ +GR IVTMMSTG +L +GFQLS GDS MN L WYS
Sbjct  107  VEKVFSSIAIQIGRCIVTMMSTGVVLAVGFQLSGGDSQMNALIWYS  152



>gb|KDP33676.1| hypothetical protein JCGZ_07247 [Jatropha curcas]
Length=523

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             + AV +  +   +S+ +++  + KLEE    +A+ + RYIVTMMSTG IL  GFQLS G
Sbjct  94   LKDAVSTFGRSDTQSNEEYKTAIAKLEEIFSSIAVQIARYIVTMMSTGVILATGFQLSGG  153

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  154  DSQMNTLIWYS  164



>tpg|DAA52781.1| TPA: hypothetical protein ZEAMMB73_885268 [Zea mays]
Length=386

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 63/109 (58%), Gaps = 8/109 (7%)
 Frame = +2

Query  167  CRAFRsxeggseegeFDKKYWWESQKG----LDNLVRGFRSAVWSCSKPSLRSDYKFRER  334
            CRAF+   G  +  E D +   + +KG    L   ++G  +   S +      +Y+++  
Sbjct  48   CRAFKQEAGDGDPAEADAR---KRRKGPLYKLKAAIQGL-AGSRSAAAEVYGGEYQYQRA  103

Query  335  LEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +EK EE  F +   +GRY++TMMS+G +L +GFQLS GDS MN+L WYS
Sbjct  104  VEKAEEIFFSVTTQLGRYVITMMSSGVVLGVGFQLSGGDSQMNELIWYS  152



>ref|XP_006283586.1| hypothetical protein CARUB_v10004643mg [Capsella rubella]
 gb|EOA16484.1| hypothetical protein CARUB_v10004643mg [Capsella rubella]
Length=499

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S V   SK    S  ++  ++EKLE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  69   LKSGVLGFSKLGFLSKDEYNHKVEKLEMVFSKIAVQIARYIVTMTSTGAILLIGFQLSGG  128

Query  449  DSXMNDLXWYS  481
            D  MN L WYS
Sbjct  129  DGSMNSLVWYS  139



>gb|KFK39772.1| hypothetical protein AALP_AA3G285600 [Arabis alpina]
Length=497

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = +2

Query  212  FDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYI  391
             +K+   E+ KG + L    +S  +  SK    S  ++  ++ KLE     +A+ + RYI
Sbjct  49   VEKRRKRENSKG-NGLWNSVKSGFFGVSKLGFLSSDEYNHKVAKLEMVFSSIAVQIARYI  107

Query  392  VTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            VTM STGAIL+IGFQLS GD  MN L WYS
Sbjct  108  VTMTSTGAILLIGFQLSGGDGSMNSLVWYS  137



>ref|XP_010532859.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Tarenaya hassleriana]
Length=507

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S +    K    S   + E++  LE+    +A+ +GRYIVTM STG IL+IGFQLS G
Sbjct  77   VKSGILGVRKLGFSSRDDYNEKVANLEKVFSSIAIQIGRYIVTMTSTGVILLIGFQLSGG  136

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  137  DSQMNSLIWYS  147



>gb|ACN31897.1| unknown [Zea mays]
 tpg|DAA52782.1| TPA: oxidoreductase [Zea mays]
Length=511

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  314  DYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +Y+++  +EK EE  F +   +GRY++TMMS+G +L +GFQLS GDS MN+L WYS
Sbjct  97   EYQYQRAVEKAEEIFFSVTTQLGRYVITMMSSGVVLGVGFQLSGGDSQMNELIWYS  152



>ref|XP_003620674.1| Oxidoreductase [Medicago truncatula]
 gb|AES76892.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=389

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  314  DYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            D ++R+ + +++E L  +A+ +GRYIVTMMSTG IL IGFQ+S GDS M+ L WYS
Sbjct  100  DDEYRQAVVRVDEVLSKIAVQIGRYIVTMMSTGVILAIGFQMSGGDSQMDALIWYS  155



>ref|XP_002863155.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39414.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=496

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S     SK    S  ++ +++E LE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  66   LKSGFLGFSKLGFLSKDEYNQKVENLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLSGG  125

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  126  DSSMNSLVWYS  136



>ref|XP_010915806.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Elaeis guineensis]
Length=533

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            ++R+ +EK E   F     VGRY+VTMMSTG IL IGFQLS GDS MN L WYS
Sbjct  121  QYRKAVEKAEAIFFSFVTQVGRYLVTMMSTGVILAIGFQLSGGDSQMNTLIWYS  174



>ref|NP_001190716.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
 gb|AEE83252.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
Length=494

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S     SK    S  ++ +++E LE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  66   LKSGFLGFSKLGFLSKDEYNQKVENLEMVFSSVAVQIARYIVTMTSTGAILLIGFQLSGG  125

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  126  DSSMNSLVWYS  136



>ref|NP_567400.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
 sp|Q93ZA0.1|NYC1_ARATH RecName: Full=Probable chlorophyll(ide) b reductase NYC1, chloroplastic; 
AltName: Full=Protein NON-YELLOW COLORING 1; Short=AtNYC1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL15327.1| AT4g13250/F17N18_140 [Arabidopsis thaliana]
 dbj|BAF49743.1| short-chain dehydrogenase/reductase AtNYC1 [Arabidopsis thaliana]
 gb|AEE83251.1| probable chlorophyll(ide) b reductase NYC1 [Arabidopsis thaliana]
Length=496

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             +S     SK    S  ++ +++E LE     +A+ + RYIVTM STGAIL+IGFQLS G
Sbjct  66   LKSGFLGFSKLGFLSKDEYNQKVENLEMVFSSVAVQIARYIVTMTSTGAILLIGFQLSGG  125

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  126  DSSMNSLVWYS  136



>ref|XP_002457093.1| hypothetical protein SORBIDRAFT_03g001100 [Sorghum bicolor]
 gb|EES02213.1| hypothetical protein SORBIDRAFT_03g001100 [Sorghum bicolor]
Length=512

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  314  DYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +++++  +EK EE  F +A  +GRY +TMMS+G +L +GFQLS GDS MN+L WYS
Sbjct  98   EHQYQRAVEKAEEIFFSVATQLGRYAITMMSSGVVLGVGFQLSGGDSQMNELIWYS  153



>ref|NP_001042468.1| Os01g0227100 [Oryza sativa Japonica Group]
 sp|Q5N800.1|NYC1_ORYSJ RecName: Full=Probable chlorophyll(ide) b reductase NYC1, chloroplastic; 
AltName: Full=Protein NON-YELLOW COLORING 1; Short=OsNYC1; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD81513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD82407.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04382.1| Os01g0227100 [Oryza sativa Japonica Group]
 dbj|BAF49740.1| short-chain dehydrogenase/reductase NYC1 [Oryza sativa Japonica 
Group]
 dbj|BAG90942.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54154.1| hypothetical protein OsJ_00960 [Oryza sativa Japonica Group]
Length=504

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +++  +EK EE  F +A  VGRY++TMMS+G +L +GFQLS GDS MN L WYS
Sbjct  92   EYQRAVEKAEEIFFSVATQVGRYVITMMSSGVVLGVGFQLSGGDSQMNTLIWYS  145



>gb|EEC70221.1| hypothetical protein OsI_00981 [Oryza sativa Indica Group]
Length=504

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +++  +EK EE  F +A  VGRY++TMMS+G +L +GFQLS GDS MN L WYS
Sbjct  92   EYQRAVEKAEEIFFSVATQVGRYVITMMSSGVVLGVGFQLSGGDSQMNTLIWYS  145



>ref|XP_003620673.1| Oxidoreductase [Medicago truncatula]
 gb|AES76891.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=514

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  314  DYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            D ++R+ + +++E L  +A+ +GRYIVTMMSTG IL IGFQ+S GDS M+ L WYS
Sbjct  100  DDEYRQAVVRVDEVLSKIAVQIGRYIVTMMSTGVILAIGFQMSGGDSQMDALIWYS  155



>ref|XP_004967428.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Setaria italica]
Length=504

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +++  +EK EE  F +A ++G+Y++TMMS+G +L +GFQLS GDS MN+L WYS
Sbjct  92   EYQRAVEKAEEIFFSVATHLGKYVITMMSSGVVLGVGFQLSGGDSQMNELIWYS  145



>ref|XP_009381052.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=538

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 3/109 (3%)
 Frame = +2

Query  164  PCRAFRsxeggsee---geFDKKYWWESQKGLDNLVRGFRSAVWSCSKPSLRSDYKFRER  334
            PCR+FRS   G E        K+     Q      +  F+S + + S    R   ++R+ 
Sbjct  71   PCRSFRSENSGEESDGRMAVVKEERESRQLKRKGALYSFKSMLVTLSGSDSRPAGQYRKY  130

Query  335  LEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +EK EE  F     +GRY+VTMMST  IL  GFQLS GDS MN L WYS
Sbjct  131  VEKTEEIFFSFITQLGRYLVTMMSTEVILATGFQLSGGDSQMNTLIWYS  179



>ref|XP_006645666.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like, 
partial [Oryza brachyantha]
Length=478

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  335  LEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +EK EE  F +A  VGRY++TMMS+G I+ +GFQLS GDS MN L WYS
Sbjct  71   VEKAEEIFFSVATQVGRYVITMMSSGVIVAVGFQLSGGDSQMNTLIWYS  119



>ref|XP_009409056.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=546

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  326  RERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            R+ +EK+EE  F  A  +GRY+VTM STG IL IGFQLS GDS MN L WYS
Sbjct  136  RKLVEKVEEIFFSFATQLGRYLVTMTSTGIILAIGFQLSGGDSQMNTLIWYS  187



>ref|XP_003565871.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Brachypodium distachyon]
Length=496

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 66/130 (51%), Gaps = 4/130 (3%)
 Frame = +2

Query  92   GCFRRSVXVLYPFGVKGCGRIRLKPCRAFRsxeggseegeFDKKYWWESQKGLDNLVRGF  271
            G  RRS  +L     + C R  L  CRAF+   GG +E     +     +  L  L    
Sbjct  12   GRLRRSPDILS----QTCYRPSLLRCRAFKQETGGDDEKPSPTEARKRKKGPLYKLKAAI  67

Query  272  RSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGD  451
            +    S S  +     ++   +EK EE  F +A  +GRY++TMMS+G +L +GFQLS GD
Sbjct  68   QGLAGSRSAAAEVYGGQYELAVEKAEEIFFSVATQLGRYVITMMSSGVVLGVGFQLSGGD  127

Query  452  SXMNDLXWYS  481
            S MN L WYS
Sbjct  128  SQMNTLIWYS  137



>ref|XP_008795044.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=533

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWY  478
            ++R+ +EK E   F     +GRY+VTMMSTG IL IGFQLS GDS MN L WY
Sbjct  121  QYRKAVEKAEAIFFSFVTQIGRYLVTMMSTGVILAIGFQLSGGDSQMNTLIWY  173



>gb|KCW79681.1| hypothetical protein EUGRSUZ_C01035 [Eucalyptus grandis]
Length=460

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  305  LRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            L+ DY   + + +LE+ L   AL +GRYI+TMMSTG IL +GFQ+S GDS ++ L WYS
Sbjct  104  LKDDYN--KSVAELEKILSAAALQIGRYIITMMSTGVILAVGFQMSGGDSQLDTLIWYS  160



>dbj|BAJ87391.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  335  LEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            +EK EE  F +A  VGRY++TMMSTG +L +GFQLS GDS  + L WYS
Sbjct  93   VEKAEEIFFSVATQVGRYVITMMSTGVVLAVGFQLSGGDSQTDALIWYS  141



>ref|XP_010047726.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW79682.1| hypothetical protein EUGRSUZ_C01035 [Eucalyptus grandis]
Length=521

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  305  LRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            L+ DY   + + +LE+ L   AL +GRYI+TMMSTG IL +GFQ+S GDS ++ L WYS
Sbjct  104  LKDDYN--KSVAELEKILSAAALQIGRYIITMMSTGVILAVGFQMSGGDSQLDTLIWYS  160



>ref|XP_009107686.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Brassica rapa]
Length=497

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            ++ ++++ LE     +A+ + RYIVTM STGAIL+IGFQLS GD  MN L WYS
Sbjct  84   EYNQKVQNLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLSGGDGSMNSLVWYS  137



>gb|KCW79680.1| hypothetical protein EUGRSUZ_C01035 [Eucalyptus grandis]
Length=539

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  305  LRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            L+ DY   + + +LE+ L   AL +GRYI+TMMSTG IL +GFQ+S GDS ++ L WYS
Sbjct  104  LKDDYN--KSVAELEKILSAAALQIGRYIITMMSTGVILAVGFQMSGGDSQLDTLIWYS  160



>ref|XP_008463393.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Cucumis melo]
Length=521

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             RS V       + SD    + +  +E  L   A+ +GRYIVTMMSTG +L +GFQLS G
Sbjct  93   LRSGVLGKFNLLMGSDVDQGKLMANMEGLLSSAAVQIGRYIVTMMSTGVVLAVGFQLSGG  152

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  153  DSQMNTLIWYS  163



>ref|XP_004150053.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65150.1| hypothetical protein Csa_1G250130 [Cucumis sativus]
Length=521

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             RS V       + SD    + +  +E  L   A+ +GRYIVTMMSTG +L +GFQLS G
Sbjct  93   LRSGVLGKFNLLMGSDVDQGKLMANMEGLLSSAAVQIGRYIVTMMSTGVVLAVGFQLSGG  152

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  153  DSQMNTLIWYS  163



>ref|XP_004162801.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic-like 
[Cucumis sativus]
Length=521

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  FRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXG  448
             RS V       + SD    + +  +E  L   A+ +GRYIVTMMSTG +L +GFQLS G
Sbjct  93   LRSGVLGKFNLLMGSDVDQGKLMANMEGLLSSAAVQIGRYIVTMMSTGVVLAVGFQLSGG  152

Query  449  DSXMNDLXWYS  481
            DS MN L WYS
Sbjct  153  DSQMNTLIWYS  163



>gb|EMT15486.1| Carbonyl reductase family member 4 [Aegilops tauschii]
Length=405

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            ++   +EK EE  F +A  VGRY++TMMS+G +L +GFQLS GDS  + L WYS
Sbjct  18   QYELAVEKAEEIFFSVATQVGRYVITMMSSGVVLAVGFQLSGGDSQTDALIWYS  71



>gb|EMS48016.1| putative chlorophyll(ide) b reductase NYC1, chloroplastic [Triticum 
urartu]
Length=430

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            ++   +EK EE  F +A  VGRY++TMMS+G +L +GFQLS GDS  + L WYS
Sbjct  18   QYELAVEKAEEIFFSVATQVGRYVITMMSSGVVLAVGFQLSGGDSQTDALIWYS  71



>ref|XP_010688205.1| PREDICTED: probable chlorophyll(ide) b reductase NYC1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=506

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 2/52 (4%)
 Frame = +2

Query  326  RERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            R+ L +LE+ LF  AL+ GRYIVTMMSTG +L+ GFQLS G+  M+DL WYS
Sbjct  102  RDALAELEKVLFSAALHFGRYIVTMMSTGVVLLTGFQLSGGE--MHDLIWYS  151



>emb|CAB41935.1| putative protein [Arabidopsis thaliana]
 emb|CAB78367.1| putative protein [Arabidopsis thaliana]
Length=447

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 7/70 (10%)
 Frame = +2

Query  293  SKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSX-------GD  451
            SK    S  ++ +++E LE     +A+ + RYIVTM STGAIL+IGFQLS        GD
Sbjct  11   SKLGFLSKDEYNQKVENLEMVFSSVAVQIARYIVTMTSTGAILLIGFQLSVYVFVMKGGD  70

Query  452  SXMNDLXWYS  481
            S MN L WYS
Sbjct  71   SSMNSLVWYS  80



>ref|XP_006833298.1| hypothetical protein AMTR_s00109p00036750 [Amborella trichopoda]
 gb|ERM98576.1| hypothetical protein AMTR_s00109p00036750 [Amborella trichopoda]
Length=522

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  KFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLSXGDSXMNDLXWYS  481
            + R+ L ++++  FL ++++GRY++TMM TG IL IGFQ S G+S M+ L WYS
Sbjct  109  ELRKALLEVKKGFFLFSIHLGRYLLTMMCTGVILSIGFQFSGGNSQMDALIWYS  162



>ref|XP_006293296.1| hypothetical protein CARUB_v10019631mg [Capsella rubella]
 gb|EOA26194.1| hypothetical protein CARUB_v10019631mg [Capsella rubella]
Length=141

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +2

Query  266  GFRSAVWSCSKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLS  442
              +S V   SK    S  ++  ++EKLE     +A+ + RYIVTM STGAIL+IGFQLS
Sbjct  68   SLKSGVLGFSKLGFLSKDEYNHKVEKLEMVFSKIAVQIARYIVTMTSTGAILLIGFQLS  126



>emb|CDY72671.1| BnaAnng41980D [Brassica napus]
Length=105

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  293  SKPSLRSDYKFRERLEKLEENLFLLALYVGRYIVTMMSTGAILMIGFQLS  442
            SK    +  ++ ++++ LE     +A+ + RYIVTM STGAIL+IGFQLS
Sbjct  55   SKLGFLTKDEYNQKVQNLEMVFSSIAVQIARYIVTMTSTGAILLIGFQLS  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140