BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015H23

Length=282
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228642.1|  PREDICTED: histone-lysine N-methyltransferas...    134   9e-35   Solanum lycopersicum
gb|EYU30121.1|  hypothetical protein MIMGU_mgv1a005562mg                130   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_009611032.1|  PREDICTED: histone-lysine N-methyltransferas...    129   2e-33   Nicotiana tomentosiformis
ref|XP_009768042.1|  PREDICTED: histone-lysine N-methyltransferas...    129   3e-33   Nicotiana sylvestris
ref|XP_006367610.1|  PREDICTED: histone-lysine N-methyltransferas...    127   1e-32   Solanum tuberosum [potatoes]
ref|XP_008221466.1|  PREDICTED: histone-lysine N-methyltransferas...    122   2e-30   Prunus mume [ume]
ref|XP_008221467.1|  PREDICTED: histone-lysine N-methyltransferas...    121   2e-30   
ref|XP_007222801.1|  hypothetical protein PRUPE_ppa005021mg             120   6e-30   Prunus persica
ref|XP_008381743.1|  PREDICTED: histone-lysine N-methyltransferas...    118   2e-29   Malus domestica [apple tree]
ref|XP_010107630.1|  Histone-lysine N-methyltransferase setd3           117   8e-29   
emb|CDP16308.1|  unnamed protein product                                116   2e-28   Coffea canephora [robusta coffee]
ref|XP_008389174.1|  PREDICTED: histone-lysine N-methyltransferas...    115   5e-28   
ref|XP_009351546.1|  PREDICTED: histone-lysine N-methyltransferas...    115   5e-28   Pyrus x bretschneideri [bai li]
ref|XP_010271179.1|  PREDICTED: histone-lysine N-methyltransferas...    114   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_011070578.1|  PREDICTED: histone-lysine N-methyltransferas...    113   2e-27   Sesamum indicum [beniseed]
ref|XP_007045259.1|  Rubisco methyltransferase family protein iso...    110   3e-26   
ref|XP_009420293.1|  PREDICTED: histone-lysine N-methyltransferas...    110   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007045257.1|  Rubisco methyltransferase family protein iso...    110   1e-25   
ref|XP_007045258.1|  Rubisco methyltransferase family protein iso...    110   1e-25   
gb|KHG01954.1|  Histone-lysine N-methyltransferase setd3                108   1e-25   Gossypium arboreum [tree cotton]
gb|KDP38111.1|  hypothetical protein JCGZ_04754                         108   1e-25   Jatropha curcas
gb|KHG01953.1|  Histone-lysine N-methyltransferase setd3                108   2e-25   Gossypium arboreum [tree cotton]
gb|KJB50382.1|  hypothetical protein B456_008G168000                    107   2e-25   Gossypium raimondii
ref|XP_011024040.1|  PREDICTED: histone-lysine N-methyltransferas...    107   2e-25   Populus euphratica
gb|KDO60745.1|  hypothetical protein CISIN_1g0129691mg                  104   4e-25   Citrus sinensis [apfelsine]
ref|XP_006469244.1|  PREDICTED: histone-lysine N-methyltransferas...    106   5e-25   Citrus sinensis [apfelsine]
ref|XP_003530864.1|  PREDICTED: histone-lysine N-methyltransferas...    105   1e-24   Glycine max [soybeans]
gb|KHN16537.1|  Histone-lysine N-methyltransferase setd3                105   1e-24   Glycine soja [wild soybean]
ref|XP_006448171.1|  hypothetical protein CICLE_v10015103mg             105   1e-24   
ref|XP_006448170.1|  hypothetical protein CICLE_v10015103mg             105   1e-24   Citrus clementina [clementine]
ref|XP_002312458.2|  hypothetical protein POPTR_0008s13380g             105   2e-24   
ref|XP_010681928.1|  PREDICTED: histone-lysine N-methyltransferas...    105   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004297442.1|  PREDICTED: histone-lysine N-methyltransferas...    103   1e-23   Fragaria vesca subsp. vesca
ref|XP_010906939.1|  PREDICTED: histone-lysine N-methyltransferas...    102   2e-23   Elaeis guineensis
ref|XP_003630935.1|  SET domain-containing protein                      101   7e-23   Medicago truncatula
ref|XP_010043959.1|  PREDICTED: histone-lysine N-methyltransferas...  99.8    2e-22   Eucalyptus grandis [rose gum]
ref|XP_002525993.1|  conserved hypothetical protein                   99.8    2e-22   
ref|XP_009113827.1|  PREDICTED: histone-lysine N-methyltransferas...  99.4    3e-22   Brassica rapa
ref|XP_009113825.1|  PREDICTED: histone-lysine N-methyltransferas...  99.4    3e-22   Brassica rapa
emb|CDY27575.1|  BnaA09g28320D                                        99.4    3e-22   Brassica napus [oilseed rape]
ref|XP_010556222.1|  PREDICTED: histone-lysine N-methyltransferas...  98.2    8e-22   Tarenaya hassleriana [spider flower]
gb|KFK44512.1|  hypothetical protein AALP_AA1G266300                  95.9    5e-21   Arabis alpina [alpine rockcress]
ref|XP_006415823.1|  hypothetical protein EUTSA_v10007532mg           95.9    5e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010499150.1|  PREDICTED: histone-lysine N-methyltransferas...  95.1    1e-20   Camelina sativa [gold-of-pleasure]
emb|CDX84966.1|  BnaC05g20890D                                        94.7    1e-20   
ref|XP_007160424.1|  hypothetical protein PHAVU_002G320700g           94.4    2e-20   Phaseolus vulgaris [French bean]
ref|XP_010477988.1|  PREDICTED: histone-lysine N-methyltransferas...  94.4    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010460423.1|  PREDICTED: histone-lysine N-methyltransferas...  93.2    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008467098.1|  PREDICTED: histone-lysine N-methyltransferas...  93.2    6e-20   Cucumis melo [Oriental melon]
ref|XP_008467097.1|  PREDICTED: histone-lysine N-methyltransferas...  93.2    6e-20   Cucumis melo [Oriental melon]
ref|XP_006307219.1|  hypothetical protein CARUB_v10008819mg           92.8    9e-20   
ref|XP_004503402.1|  PREDICTED: histone-lysine N-methyltransferas...  92.0    2e-19   
ref|XP_002281246.1|  PREDICTED: histone-lysine N-methyltransferas...  91.3    3e-19   Vitis vinifera
ref|XP_002890701.1|  hypothetical protein ARALYDRAFT_472886           90.1    7e-19   
ref|XP_008809406.1|  PREDICTED: histone-lysine N-methyltransferas...  90.1    7e-19   Phoenix dactylifera
ref|NP_564222.1|  rubisco methyltransferase-like protein              89.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65946.1|  unknown                                               88.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150615.1|  PREDICTED: histone-lysine N-methyltransferas...  87.8    5e-18   Cucumis sativus [cucumbers]
ref|XP_009113823.1|  PREDICTED: histone-lysine N-methyltransferas...  87.8    5e-18   Brassica rapa
gb|EPS70598.1|  hypothetical protein M569_04159                       85.9    2e-17   Genlisea aurea
ref|XP_006828432.1|  hypothetical protein AMTR_s00060p00101960        82.0    5e-16   
ref|XP_003570495.1|  PREDICTED: histone-lysine N-methyltransferas...  77.4    3e-14   Brachypodium distachyon [annual false brome]
ref|NP_001151430.1|  SET domain containing protein                    75.1    2e-13   Zea mays [maize]
gb|KHN21605.1|  Histone-lysine N-methyltransferase setd3              72.0    1e-12   Glycine soja [wild soybean]
ref|XP_006647850.1|  PREDICTED: histone-lysine N-methyltransferas...  71.2    4e-12   Oryza brachyantha
gb|EEE57758.1|  hypothetical protein OsJ_08284                        70.9    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73951.1|  hypothetical protein OsI_08832                        70.9    5e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001048036.1|  Os02g0733800                                     70.9    5e-12   
ref|XP_002454330.1|  hypothetical protein SORBIDRAFT_04g028760        68.9    3e-11   Sorghum bicolor [broomcorn]
dbj|BAK03360.1|  predicted protein                                    68.2    4e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE77120.1|  unknown                                               65.5    6e-11   Picea sitchensis
ref|XP_004953834.1|  PREDICTED: histone-lysine N-methyltransferas...  66.2    2e-10   Setaria italica
ref|XP_006580887.1|  PREDICTED: histone-lysine N-methyltransferas...  58.2    1e-07   
gb|EMT12546.1|  hypothetical protein F775_52053                       56.6    4e-07   
ref|XP_002989522.1|  hypothetical protein SELMODRAFT_129980           48.9    2e-04   
ref|XP_002964620.1|  hypothetical protein SELMODRAFT_81798            48.5    2e-04   



>ref|XP_004228642.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Solanum 
lycopersicum]
Length=471

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M +KM LMA SLTH+RPLTCAA  A +Y SRL  QPPDLIKWVK EGGFVH S+K+A  +
Sbjct  1    MSSKMMLMANSLTHVRPLTCAA--AAVYPSRLVAQPPDLIKWVKTEGGFVHKSIKVAQGD  58

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF  273
             +GLG+VAS+DIPKGSDLIALP+H+PL+F
Sbjct  59   TFGLGLVASEDIPKGSDLIALPQHIPLKF  87



>gb|EYU30121.1| hypothetical protein MIMGU_mgv1a005562mg [Erythranthe guttata]
Length=479

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 7/96 (7%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TKM LMA+SLTH RP+ CAA SA +  SRLA+QPPDLIKWV+REGGFVH S+KIA  E
Sbjct  1    MSTKMMLMASSLTHARPIACAAASAFINPSRLASQPPDLIKWVRREGGFVHHSIKIAYLE  60

Query  187  P-------YGLGVVASDDIPKGSDLIALPEHLPLQF  273
                     GLG+VA+DDIPKGSDLI LP+H+PL+F
Sbjct  61   EDKPNGPGLGLGLVATDDIPKGSDLITLPDHIPLRF  96



>ref|XP_009611032.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
tomentosiformis]
Length=476

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 4/92 (4%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TKM LMA SLTH+RPLTC A +     SRL  QPPDLIKWVK EGGFVH SV+I+  +
Sbjct  1    MSTKMMLMANSLTHVRPLTCVAAAG----SRLVPQPPDLIKWVKSEGGFVHKSVQISQGD  56

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTV  282
             +GLG+VAS+DIPKGSD+IALP+H+PL+FG++
Sbjct  57   SFGLGLVASEDIPKGSDIIALPQHIPLKFGSL  88



>ref|XP_009768042.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
sylvestris]
Length=476

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 4/92 (4%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TKM LMA SLTH+RPLTCAA +     SRL  QPPDLIKWVK EGGFVH SV+IA  +
Sbjct  1    MSTKMMLMANSLTHVRPLTCAAAAG----SRLVPQPPDLIKWVKSEGGFVHKSVQIAQGD  56

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGTV  282
             +GLG+VAS+DIPKGSD+IALP+H+PL+ G++
Sbjct  57   SFGLGLVASEDIPKGSDIIALPQHIPLKIGSL  88



>ref|XP_006367610.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Solanum 
tuberosum]
Length=475

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSAT--LYSSRLATQPPDLIKWVKREGGFVHPSVKIAI  180
            M +KM LMA SLTH+RPLTCA  +A   +Y SRL  QPPDLIKWVK EGGFVH S+KIA 
Sbjct  1    MSSKMMLMANSLTHVRPLTCATAAAAAAVYPSRLVAQPPDLIKWVKIEGGFVHKSIKIAQ  60

Query  181  SEPYGLGVVASDDIPKGSDLIALPEHLPLQF  273
             + +GLG+VAS+DIPKGSDLIALP+H+PL+F
Sbjct  61   GDSFGLGLVASEDIPKGSDLIALPQHIPLKF  91



>ref|XP_008221466.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
 ref|XP_008245922.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
Length=481

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLT  RPLTCAA ++T Y  RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  6    MVMASLTAFRPLTCAASTSTSYPGRLAPYPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTV  282
            VAS++IPKGS+LI LPEH+PL+FG++
Sbjct  66   VASEEIPKGSELIVLPEHVPLRFGSL  91



>ref|XP_008221467.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
 ref|XP_008245923.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
Length=356

 Score =   121 bits (303),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLT  RPLTCAA ++T Y  RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  6    MVMASLTAFRPLTCAASTSTSYPGRLAPYPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTV  282
            VAS++IPKGS+LI LPEH+PL+FG++
Sbjct  66   VASEEIPKGSELIVLPEHVPLRFGSL  91



>ref|XP_007222801.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
 gb|EMJ24000.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
Length=481

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLT  RPLTC A ++T Y  RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  6    MVMASLTAFRPLTCGASTSTSYPGRLAPYPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGTV  282
            VAS++IPKGS+LI LPEH+PL+FG++
Sbjct  66   VASEEIPKGSELIVLPEHVPLRFGSL  91



>ref|XP_008381743.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=483

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +1

Query  1    GSMPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAI  180
            GS      ++ AS T  RPLTCAA ++  Y +RLA  PPDLIKWV+REGGFVH +VKIA 
Sbjct  4    GSTMAASKMLMASFTAFRPLTCAASAS--YPARLAPHPPDLIKWVRREGGFVHEAVKIAQ  61

Query  181  SEPYGLGVVASDDIPKGSDLIALPEHLPLQFGTV  282
               +GLG+VAS++IPKGS+LI LPEH+PL+FG++
Sbjct  62   DSSFGLGLVASEEIPKGSELIVLPEHVPLRFGSI  95



>ref|XP_010107630.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
 gb|EXC16432.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
Length=469

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAV-SATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAIS  183
            M     +MA+SLTH R LTCAA  S+  Y +RL  QPPDLIKWV+R+GGFVH S+KIA  
Sbjct  1    MAASKMVMASSLTHFRRLTCAATDSSASYPARLVPQPPDLIKWVRRQGGFVHHSLKIAQD  60

Query  184  EPYGLGVVASDDIPKGSDLIALPEHLPLQF  273
               GLG++ASD+IPKGSDLIALP H+PL+F
Sbjct  61   STNGLGLLASDEIPKGSDLIALPHHIPLRF  90



>emb|CDP16308.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M TK+  MA+SL+ +RPLTCAA +  L S RL  QPPDLIKWVKREGGFVH +VK+A  +
Sbjct  1    MSTKIMFMASSLSQVRPLTCAA-AGGLSSGRLVPQPPDLIKWVKREGGFVHQAVKVA-QQ  58

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF  273
              GLG++A+ +IPKGSDLI LPEH+PL+F
Sbjct  59   LDGLGLIATAEIPKGSDLIVLPEHIPLRF  87



>ref|XP_008389174.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=478

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ AS T  RPLTCAA ++  Y +RLA  PPDLIKWV+REGGFVH  VKIA    +GLG+
Sbjct  6    MLLASFTAFRPLTCAASAS--YPARLAPHPPDLIKWVRREGGFVHEGVKIAQDSSFGLGL  63

Query  205  VASDDIPKGSDLIALPEHLPLQFG  276
            VAS++IPKGS+LI LPEH+PL+FG
Sbjct  64   VASEEIPKGSELIVLPEHVPLRFG  87



>ref|XP_009351546.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
Length=484

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ AS T  RPLTCAA ++  Y +RLA  PPDLIKWV+REGGFVH +VKIA    +GLG+
Sbjct  12   MLMASFTAFRPLTCAASAS--YPARLAPHPPDLIKWVRREGGFVHEAVKIAQDSSFGLGL  69

Query  205  VASDDIPKGSDLIALPEHLPLQFGTV  282
            VAS++IPKGS+LI LPEH+PL+F ++
Sbjct  70   VASEEIPKGSELIVLPEHVPLRFDSI  95



>ref|XP_010271179.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=494

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +1

Query  37   SLTHLRPLTCAAVSAT--LYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVA  210
            SLTH RPLTCA+ SA+   + +RL   PPDL+KWV++EGGFVH  +KIA  + YGLG+VA
Sbjct  23   SLTHFRPLTCASASASTACHPARLVPHPPDLVKWVRQEGGFVHHGLKIAAGDSYGLGLVA  82

Query  211  SDDIPKGSDLIALPEHLPLQFGTV  282
            S++IPKGSDLIALP HLPL+F ++
Sbjct  83   SEEIPKGSDLIALPSHLPLRFRSL  106



>ref|XP_011070578.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Sesamum 
indicum]
Length=482

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 7/96 (7%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M +KM LMA SLTH RPL  AA SA LY +RL  QPPD+IKWV+REGGFVH S+KIA  E
Sbjct  1    MSSKMMLMATSLTHARPLAYAAASACLYPARLVPQPPDIIKWVRREGGFVHQSIKIAYLE  60

Query  187  P-------YGLGVVASDDIPKGSDLIALPEHLPLQF  273
                     GLG+VAS++IPKGSDLI LP+H+PL+F
Sbjct  61   EEKPNGLGLGLGLVASEEIPKGSDLIILPQHIPLRF  96



>ref|XP_007045259.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY01091.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=473

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++  SLT  RPLTCAA  A  Y +RL   PPDL+KWVKREGGFVH +VKIA     GLG+
Sbjct  6    MLIPSLTKFRPLTCAA--AAFYPTRLVPHPPDLVKWVKREGGFVHEAVKIAQDTTLGLGL  63

Query  205  VASDDIPKGSDLIALPEHLPLQFGT  279
            VAS +IPKGSDLI LP+H+PL+F +
Sbjct  64   VASGEIPKGSDLIVLPDHVPLKFQS  88



>ref|XP_009420293.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T ++  AASL H R LTC A ++   +SRL   P DLI+WV+REGGFVHP+++IA  +
Sbjct  9    MLTAVSTSAASLAHRRSLTCRATASAGTASRLVPHPSDLIRWVRREGGFVHPNLRIADGD  68

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF  273
            PYGLGVVA+++IP GS+LIALP HL L+F
Sbjct  69   PYGLGVVATNEIPPGSELIALPSHLLLRF  97



>ref|XP_007045257.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01089.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=630

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +1

Query  37   SLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASD  216
            SLT  RPLTCAA  A  Y +RL   PPDL+KWVKREGGFVH +VKIA     GLG+VAS 
Sbjct  88   SLTKFRPLTCAA--AAFYPTRLVPHPPDLVKWVKREGGFVHEAVKIAQDTTLGLGLVASG  145

Query  217  DIPKGSDLIALPEHLPLQFGT  279
            +IPKGSDLI LP+H+PL+F +
Sbjct  146  EIPKGSDLIVLPDHVPLKFQS  166



>ref|XP_007045258.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY01090.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=609

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +1

Query  37   SLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASD  216
            SLT  RPLTCAA  A  Y +RL   PPDL+KWVKREGGFVH +VKIA     GLG+VAS 
Sbjct  95   SLTKFRPLTCAA--AAFYPTRLVPHPPDLVKWVKREGGFVHEAVKIAQDTTLGLGLVASG  152

Query  217  DIPKGSDLIALPEHLPLQFGT  279
            +IPKGSDLI LP+H+PL+F +
Sbjct  153  EIPKGSDLIVLPDHVPLKFQS  173



>gb|KHG01954.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=476

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            L+  +L+H RPLTCAA  +    +RL   PPDL+KW+KREGGFVH +V I     YGLG+
Sbjct  6    LLIPTLSHFRPLTCAAAVSATNPARLVPHPPDLLKWIKREGGFVHEAVTITQDTTYGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGT  279
            VAS  IPKGSDLI LPEH+PL+F +
Sbjct  66   VASGGIPKGSDLIVLPEHVPLKFQS  90



>gb|KDP38111.1| hypothetical protein JCGZ_04754 [Jatropha curcas]
Length=482

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            ++ ASLTH RPLTCAA +   Y +RL   PP+LIKWV+REGGFVH +VKI+       G+
Sbjct  6    MVIASLTHCRPLTCAATATASYPARLVPHPPELIKWVRREGGFVHQAVKISQDGTNSFGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFG  276
            +AS  IPKGS+LI LP+H+PL+FG
Sbjct  66   IASQAIPKGSELIVLPDHIPLKFG  89



>gb|KHG01953.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=505

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            L+  +L+H RPLTCAA  +    +RL   PPDL+KW+KREGGFVH +V I     YGLG+
Sbjct  6    LLIPTLSHFRPLTCAAAVSATNPARLVPHPPDLLKWIKREGGFVHEAVTITQDTTYGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGT  279
            VAS  IPKGSDLI LPEH+PL+F +
Sbjct  66   VASGGIPKGSDLIVLPEHVPLKFQS  90



>gb|KJB50382.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=475

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV  204
            L+  +L+H RPLTCAA  +    +RL   PPDL+KW+KREGGFVH +V I     YGLG+
Sbjct  6    LLIPTLSHFRPLTCAAAVSASNPARLVPHPPDLLKWIKREGGFVHEAVTITQDTTYGLGL  65

Query  205  VASDDIPKGSDLIALPEHLPLQFGT  279
            VAS  IPKGSDLI LPEH+PL+F +
Sbjct  66   VASGGIPKGSDLIVLPEHVPLKFQS  90



>ref|XP_011024040.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Populus 
euphratica]
Length=479

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAV-SATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLG  201
             + ASLT  RPLTCAA  +A+ Y  RL   PPDLIKWV+REGGFVH ++KI+     GLG
Sbjct  6    FVMASLTTCRPLTCAATATASSYQERLVPHPPDLIKWVRREGGFVHQAIKISQDGTNGLG  65

Query  202  VVASDDIPKGSDLIALPEHLPLQFG  276
            ++AS DIPKGS LI+LP+++PL+FG
Sbjct  66   LIASHDIPKGSQLISLPDNIPLKFG  90



>gb|KDO60745.1| hypothetical protein CISIN_1g0129691mg, partial [Citrus sinensis]
Length=237

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KW+K+EGGFVH +VKI     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWIKKEGGFVHQAVKIFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQF  273
            LG+VAS DIPKGS LIALP+H+PL+F
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKF  87



>ref|XP_006469244.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Citrus 
sinensis]
Length=474

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KWVK+EGGFVH +VKI     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWVKKEGGFVHQAVKIFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQF  273
            LG+VAS DIPKGS LIALP+H+PL+F
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKF  87



>ref|XP_003530864.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=472

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-IS  183
            M T  T+M  SL+ LRPLTCA+ SA    SRL  QPPDLIKWV REGGFVH +VKI  + 
Sbjct  1    MATGKTVMC-SLSQLRPLTCASTSA----SRLVPQPPDLIKWVTREGGFVHRAVKITQLD  55

Query  184  EPYGLGVVASDDIPKGSDLIALPEHLPLQFGTV  282
               GLG+VA ++IP+GSDLI LP HLPL+F ++
Sbjct  56   SSNGLGLVAKEEIPRGSDLIVLPHHLPLRFTSL  88



>gb|KHN16537.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=470

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-IS  183
            M T  T+M  SL+ LRPLTCA+ SA    SRL  QPPDLIKWV REGGFVH +VKI  + 
Sbjct  1    MATGKTVMC-SLSQLRPLTCASTSA----SRLVPQPPDLIKWVTREGGFVHRAVKITQLD  55

Query  184  EPYGLGVVASDDIPKGSDLIALPEHLPLQFGTV  282
               GLG+VA ++IP+GSDLI LP HLPL+F ++
Sbjct  56   SSNGLGLVAKEEIPRGSDLIVLPHHLPLRFTSL  88



>ref|XP_006448171.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61411.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=373

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 7/88 (8%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KWVK+EGGFVH +VK+     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWVKKEGGFVHQAVKLFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQFGT  279
            LG+VAS DIPKGS LIALP+H+PL+F +
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKFES  89



>ref|XP_006448170.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61410.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=474

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKI---AISEPYG  195
            ++ +SL H+RP+TCAA     Y +RL   PPDL+KWVK+EGGFVH +VK+     +E YG
Sbjct  6    IVLSSLIHIRPITCAAS----YHTRLVPHPPDLVKWVKKEGGFVHQAVKLFPQEDNETYG  61

Query  196  LGVVASDDIPKGSDLIALPEHLPLQF  273
            LG+VAS DIPKGS LIALP+H+PL+F
Sbjct  62   LGLVASQDIPKGSLLIALPDHIPLKF  87



>ref|XP_002312458.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
 gb|EEE89825.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
Length=479

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAV-SATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLG  201
             + ASLT+ RPLTCAA  +A+ Y  RL   PPDLIKWV+REGGFVH ++KI+     G G
Sbjct  6    FVMASLTNCRPLTCAATFTASSYQERLVPNPPDLIKWVRREGGFVHQAIKISQDGTNGPG  65

Query  202  VVASDDIPKGSDLIALPEHLPLQFG  276
            ++AS DIPKGS LI LP+++PL+FG
Sbjct  66   LIASHDIPKGSQLIVLPDNIPLKFG  90



>ref|XP_010681928.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Beta vulgaris 
subsp. vulgaris]
Length=491

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  37   SLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASD  216
            S  H RPLTC+A+S   Y SRL   PPDL+KWV++EGGFVH S+  A    YGLG+VAS 
Sbjct  26   SRAHFRPLTCSAIS---YPSRLVLYPPDLLKWVRKEGGFVHDSINFAHIPSYGLGLVASH  82

Query  217  DIPKGSDLIALPEHLPLQF  273
            DIP+G DLIALP HLPL+F
Sbjct  83   DIPQGCDLIALPPHLPLKF  101



>ref|XP_004297442.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Fragaria vesca subsp. vesca]
Length=482

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  25   LMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGL  198
            ++ ASLT +RP +CAA ++    Y  RLA   PDLIKWV+REGGFVH +VKIA    +GL
Sbjct  6    MVMASLTAIRPFSCAAAASASASYPGRLAPHTPDLIKWVRREGGFVHEAVKIAQDTSFGL  65

Query  199  GVVASDDIPKGSDLIALPEHLPLQF  273
            G+VA+D+IPKGS+L+ LPEH+PL+F
Sbjct  66   GLVATDEIPKGSELVVLPEHVPLRF  90



>ref|XP_010906939.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Elaeis guineensis]
Length=492

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVAS  213
            +SLTH RPLTC+A +  + ++R+   PPDL++WV+REGG VHP +KIA    +GLGVVA+
Sbjct  22   SSLTHRRPLTCSAPATAVAAARIVPHPPDLVRWVRREGGLVHPKLKIADHPSHGLGVVAT  81

Query  214  DDIPKGSDLIALPEHLPLQF  273
            ++IP+GS+L+ LP HLPL+F
Sbjct  82   EEIPQGSELVVLPSHLPLRF  101



>ref|XP_003630935.1| SET domain-containing protein [Medicago truncatula]
 gb|AET05411.1| histone-lysine N-methyltransferase setd3-like protein [Medicago 
truncatula]
Length=482

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = +1

Query  1    GSMPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-  177
            GS  T M LM++SL+H+RPLTC++ +++  SSR+A  P DLIKWV REGGFVH +VKIA 
Sbjct  7    GSWKTAM-LMSSSLSHVRPLTCSSSTSS--SSRIAPHPHDLIKWVTREGGFVHRAVKIAQ  63

Query  178  ISEPYGLGVVASDDIPKGSDLIALPEHLPLQFG  276
            +    GLG+VA +DIP G+DLIALP+H+PL F 
Sbjct  64   LDSSNGLGLVAKEDIPIGTDLIALPQHIPLHFN  96



>ref|XP_010043959.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Eucalyptus 
grandis]
 gb|KCW85967.1| hypothetical protein EUGRSUZ_B02671 [Eucalyptus grandis]
Length=477

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYS--SRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            ASL H RPLTCAA ++   S  +RL    PDLIKWV+REGGFVH +V+IA  E  GLG+ 
Sbjct  9    ASLIHYRPLTCAASASASASQPARLVPHAPDLIKWVRREGGFVHEAVRIAQDELSGLGLA  68

Query  208  ASDDIPKGSDLIALPEHLPLQF  273
            A+D IPKGSDLIALP H+PL+F
Sbjct  69   AADKIPKGSDLIALPHHVPLRF  90



>ref|XP_002525993.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36417.1| conserved hypothetical protein [Ricinus communis]
Length=473

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 63/90 (70%), Gaps = 6/90 (7%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            MP    +MA SL H RPLTCAA       +RL + PPDLIKWV+ EGGFVH +VKI+   
Sbjct  1    MPASKMVMA-SLIHRRPLTCAA-----SITRLVSHPPDLIKWVRHEGGFVHQAVKISQDG  54

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFG  276
              G G++ S+ IPKGS+LI LP+H+PL+FG
Sbjct  55   RNGFGLIVSEAIPKGSELIVLPDHIPLKFG  84



>ref|XP_009113827.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Brassica rapa]
Length=474

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+A S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF  273
            P+G+G+++++ IP+G+DLI+LP H+PL+F
Sbjct  58   PFGIGLISTEQIPQGTDLISLPPHVPLRF  86



>ref|XP_009113825.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
 ref|XP_009113826.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
Length=474

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+A S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGT  279
            P+G+G+++++ IP+G+DLI+LP H+PL+F +
Sbjct  58   PFGIGLISTEQIPQGTDLISLPPHVPLRFES  88



>emb|CDY27575.1| BnaA09g28320D [Brassica napus]
Length=475

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+A S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGT  279
            P+G+G+++++ IP+G+DLI+LP H+PL+F +
Sbjct  58   PFGIGLISTEQIPQGTDLISLPPHVPLRFES  88



>ref|XP_010556222.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Tarenaya 
hassleriana]
Length=477

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 4/89 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPY  192
            +KM L + +L H+RPLTC A S     SRLA  PPDLI WVKREGGFVH S+K++     
Sbjct  4    SKMALASLAL-HIRPLTCMAASQP---SRLAPHPPDLILWVKREGGFVHHSLKLSDDGSS  59

Query  193  GLGVVASDDIPKGSDLIALPEHLPLQFGT  279
            GLG+V+S+ IP+GSDLI+LP H+PL+F +
Sbjct  60   GLGLVSSEKIPQGSDLISLPPHVPLRFES  88



>gb|KFK44512.1| hypothetical protein AALP_AA1G266300 [Arabis alpina]
Length=475

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    MA+  +H+RP +C A      +SRLA  PPDLI+W+KREGGFVH SVK++   
Sbjct  1    MATSKMAMASLSSHIRPFSCLA------ASRLAPHPPDLIRWIKREGGFVHHSVKLSHHT  54

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQFGT  279
            P GL ++++D IP G++LI+LP HLPL+F +
Sbjct  55   PLGLTLISTDLIPHGTNLISLPPHLPLRFQS  85



>ref|XP_006415823.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
 gb|ESQ34176.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
Length=474

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 3/89 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T  T MA+    +RP TC A S     SRLA  P DL++W+KREGGFVH +VK++   
Sbjct  1    MATSKTAMASLAAQIRPFTCLAASQ---PSRLAPHPADLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF  273
            P+G+G+++++ I +G+DLIALP H+PL+F
Sbjct  58   PFGIGLISTEKIREGTDLIALPPHVPLRF  86



>ref|XP_010499150.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Camelina sativa]
 ref|XP_010499151.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Camelina sativa]
Length=479

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++    +G+G++
Sbjct  9    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQETQFGIGLI  65

Query  208  ASDDIPKGSDLIALPEHLPLQF  273
            +++ IP+G+DLI+LP H+PL+F
Sbjct  66   STEQIPQGTDLISLPPHIPLRF  87



>emb|CDX84966.1| BnaC05g20890D [Brassica napus]
Length=471

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (71%), Gaps = 3/89 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M T    + +   H+RP TC+  S     SRLA  PPDL++W+KREGGFVH +VK++   
Sbjct  1    MATSKLAITSLAAHIRPFTCSVASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQDT  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF  273
            P+G+G+++++ I +G+DLI+LP H+PL+F
Sbjct  58   PFGIGLISTEQIAQGTDLISLPPHVPLRF  86



>ref|XP_007160424.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
 gb|ESW32418.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
Length=465

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPYGLGVVA  210
             SLTHLRPL+CAA +A    SRL   PPDL+KWV REGGFVH +++IA +    GLG+VA
Sbjct  2    CSLTHLRPLSCAASAAA---SRLVPYPPDLVKWVTREGGFVHRALEIAQLGSSNGLGIVA  58

Query  211  SDDIPKGSDLIALPEHLPLQFGTV  282
             + IP+G+DLI LP HLPL+F T+
Sbjct  59   KEQIPRGTDLIVLPHHLPLRFTTL  82



>ref|XP_010477988.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477989.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477990.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
Length=479

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++    +G+G++
Sbjct  9    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQETQFGIGLI  65

Query  208  ASDDIPKGSDLIALPEHLPLQF  273
            +++ IP+G+DLI+LP H+PL+F
Sbjct  66   STERIPQGTDLISLPPHIPLRF  87



>ref|XP_010460423.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460424.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460425.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=479

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++    +G+G++
Sbjct  9    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQETQFGIGLI  65

Query  208  ASDDIPKGSDLIALPEHLPLQF  273
            +++ IP+G++LI+LP H+PL+F
Sbjct  66   STEQIPQGTNLISLPPHIPLRF  87



>ref|XP_008467098.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Cucumis melo]
Length=481

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-  183
            +K+ +   SLTH RP + A++ +    +SSRL   PPDLIKWV+REGGFVH ++ IA S 
Sbjct  4    SKIAVATLSLTHFRPFSSASMPSLSPSFSSRLVPHPPDLIKWVRREGGFVHHALNIAPSP  63

Query  184  -EPYGLGVVASDDIPKGSDLIALPEHLPLQF  273
                GLG++ASD IPKGS+LI LP +LPL+F
Sbjct  64   DAHTGLGLLASDHIPKGSELIILPHNLPLRF  94



>ref|XP_008467097.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Cucumis melo]
Length=483

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-  183
            +K+ +   SLTH RP + A++ +    +SSRL   PPDLIKWV+REGGFVH ++ IA S 
Sbjct  4    SKIAVATLSLTHFRPFSSASMPSLSPSFSSRLVPHPPDLIKWVRREGGFVHHALNIAPSP  63

Query  184  -EPYGLGVVASDDIPKGSDLIALPEHLPLQF  273
                GLG++ASD IPKGS+LI LP +LPL+F
Sbjct  64   DAHTGLGLLASDHIPKGSELIILPHNLPLRF  94



>ref|XP_006307219.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 ref|XP_006307220.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40117.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40118.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
Length=532

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +1

Query  4    SMPTKMTLMAASLT-HLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAI  180
            SM     +  ASL   +RP TC A S     SRLA  PPDL++W+KREGGFVH +VK++ 
Sbjct  55   SMAANSKMAIASLAAQIRPFTCLAASQ---PSRLAPHPPDLVRWIKREGGFVHHAVKLSQ  111

Query  181  SEPYGLGVVASDDIPKGSDLIALPEHLPLQF  273
               +G+G+++++ IP+G++LI+LP H+PL+F
Sbjct  112  ETQFGIGLISTEQIPQGTNLISLPPHIPLRF  142



>ref|XP_004503402.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Cicer arietinum]
Length=490

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 61/87 (70%), Gaps = 8/87 (9%)
 Frame = +1

Query  16   KMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPY  192
            K  ++ +SL+H+RPLT A       SSRL  QP DLIKWV REGGFVH +VKI+      
Sbjct  27   KAAMLMSSLSHVRPLTYA-------SSRLVPQPHDLIKWVTREGGFVHRAVKISQFDSSN  79

Query  193  GLGVVASDDIPKGSDLIALPEHLPLQF  273
            GLG++ +++IP G+DLI LP+H+PL F
Sbjct  80   GLGLIVNEEIPIGTDLIVLPQHIPLHF  106



>ref|XP_002281246.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Vitis vinifera]
 emb|CBI26837.3| unnamed protein product [Vitis vinifera]
Length=483

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 4/85 (5%)
 Frame = +1

Query  40   LTHLRPLTCAAVSATL---YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-EPYGLGVV  207
            LT  RPLTCAA +AT    +  RL   PPDLIKWV+REGGFVH +V IA S +  GLG+V
Sbjct  10   LTQFRPLTCAAATATATACHPGRLVPHPPDLIKWVRREGGFVHQAVTIAPSADSCGLGLV  69

Query  208  ASDDIPKGSDLIALPEHLPLQFGTV  282
            AS DIPKGSDLIALP H+PL+F ++
Sbjct  70   ASQDIPKGSDLIALPHHIPLRFSSL  94



>ref|XP_002890701.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66960.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            MA+    +RP TC A S     SRLA  PPDLI+W+KREGGFVH ++K++    +G+G++
Sbjct  3    MASLAAQIRPFTCLAASQ---PSRLAPHPPDLIRWIKREGGFVHHAIKLSQETQFGIGLI  59

Query  208  ASDDIPKGSDLIALPEHLPLQF  273
            +++ I  G+DLI+LP H+PL+F
Sbjct  60   STEQISPGTDLISLPPHVPLRF  81



>ref|XP_008809406.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Phoenix 
dactylifera]
Length=491

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVAS  213
            +SLTH R LT +A   T  ++R+   PPDL++WV+REGG +HP +KIA    +GLGVVA+
Sbjct  22   SSLTHRRQLTSSAPPVT-AAARIVPHPPDLVRWVRREGGLLHPKLKIADHPYHGLGVVAT  80

Query  214  DDIPKGSDLIALPEHLPLQF  273
            DDIP+ S+L+ LP HLPL+ 
Sbjct  81   DDIPQRSELVVLPSHLPLRL  100



>ref|NP_564222.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAF97974.1|AC000103_24 F21J9.27 [Arabidopsis thaliana]
 gb|AEE30553.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
Length=476

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +1

Query  7    MPTKMTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISE  186
            M      +A+    +RP TC A S     SRLA  PPDLI+W+KREGGFVH +VK++   
Sbjct  1    MANSKMAIASLAAQIRPFTCLAAS---LPSRLAPHPPDLIRWIKREGGFVHHAVKLSQET  57

Query  187  PYGLGVVASDDIPKGSDLIALPEHLPLQF  273
             +G+G+++++ I  G+DLI+LP H+PL+F
Sbjct  58   QFGIGLISTEQISPGTDLISLPPHVPLRF  86



>gb|AAM65946.1| unknown [Arabidopsis thaliana]
Length=471

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVV  207
            +A+    +RP TC A S     SRLA  PPDLI+W+KREGGFVH +VK++    +G+G++
Sbjct  3    IASLAAQIRPFTCLAAS---LPSRLAPHPPDLIRWIKREGGFVHHAVKLSQETQFGIGLI  59

Query  208  ASDDIPKGSDLIALPEHLPLQF  273
            +++ I  G+DLI+LP H+PL+F
Sbjct  60   STEQISPGTDLISLPPHVPLRF  81



>ref|XP_004150615.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Cucumis 
sativus]
 ref|XP_004169009.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Cucumis 
sativus]
 gb|KGN51466.1| hypothetical protein Csa_5G561260 [Cucumis sativus]
Length=483

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +1

Query  13   TKMTLMAASLTHLRPLTCAAVSATL--YSSRLATQPPDLIKWVKREGGFVHPSVKIAIS-  183
            +K  + + S TH RP + A++ +    +SSRL   PPDLIKWV+REGGFVH ++ IA + 
Sbjct  4    SKTAMASLSFTHFRPFSSASMPSLSPSFSSRLVPHPPDLIKWVRREGGFVHHALNIAPAP  63

Query  184  -EPYGLGVVASDDIPKGSDLIALPEHLPLQF  273
                GLG++AS  IPKGS+LI LP +LPL+F
Sbjct  64   GAHTGLGLLASHHIPKGSELIILPHNLPLRF  94



>ref|XP_009113823.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=468

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  19   MTLMAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGL  198
            M  + A++T L+      + A+    RL+  PPDL++W++REGGFVH +VK++   P+G 
Sbjct  1    MATLKAAITFLKANIRGLICASQRPPRLSHHPPDLVRWIEREGGFVHHAVKLSQDTPFGF  60

Query  199  GVVASDDIPKGSDLIALPEHLPLQF  273
            G+++++ IP+G+DLI LP H+PL+F
Sbjct  61   GLISTEQIPQGTDLITLPPHVPLRF  85



>gb|EPS70598.1| hypothetical protein M569_04159, partial [Genlisea aurea]
Length=458

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 12/88 (14%)
 Frame = +1

Query  28   MAASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEP------  189
            M + L H RPL C      L ++RL   PPDL+KW++REGGF+H SV+++  E       
Sbjct  3    MPSLLNHSRPLAC------LSTARLVPSPPDLVKWIRREGGFLHDSVRVSPLEDEKQVVG  56

Query  190  YGLGVVASDDIPKGSDLIALPEHLPLQF  273
             GLG+VA DDI KG++LIALP H+PL+F
Sbjct  57   LGLGLVALDDIAKGTELIALPPHIPLRF  84



>ref|XP_006828432.1| hypothetical protein AMTR_s00060p00101960 [Amborella trichopoda]
 gb|ERM95848.1| hypothetical protein AMTR_s00060p00101960 [Amborella trichopoda]
Length=480

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  67   AAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIA  246
            AAVSA++ S RL   PPDL+ WV REGGFVH  ++IA  E  GL ++AS DI  GSDLI+
Sbjct  24   AAVSASM-SKRLVPNPPDLVSWVVREGGFVHKGLRIADGEASGLCLMASSDIEAGSDLIS  82

Query  247  LPEHLPLQF  273
            LP+H+PL F
Sbjct  83   LPKHIPLSF  91



>ref|XP_003570495.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brachypodium 
distachyon]
Length=485

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 5/75 (7%)
 Frame = +1

Query  58   LTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVAS---DDIPK  228
            L C+A SAT  + R+A QPPDL++WV+REGGFVHP+++++    YGLGV A+    DIP 
Sbjct  37   LACSAASAT--APRIAPQPPDLLRWVQREGGFVHPALRVSDHPEYGLGVSATGADGDIPP  94

Query  229  GSDLIALPEHLPLQF  273
            G+ LI LP  +PL+ 
Sbjct  95   GTVLIDLPGRIPLRL  109



>ref|NP_001151430.1| SET domain containing protein [Zea mays]
 gb|ACG42857.1| SET domain containing protein [Zea mays]
 gb|AFW63825.1| SET domain containing protein [Zea mays]
Length=491

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 7/77 (9%)
 Frame = +1

Query  58   LTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASD-----DI  222
            L+C+A  A   ++RLA QPPDL++WV+REGGFVH ++++A    +GLG+ AS      DI
Sbjct  41   LSCSA--AFTAATRLAPQPPDLVRWVQREGGFVHRALRVANHPEHGLGISASSAAAYGDI  98

Query  223  PKGSDLIALPEHLPLQF  273
            P G  LIALP  LPL+ 
Sbjct  99   PIGDVLIALPSQLPLRL  115



>gb|KHN21605.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=423

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 49/79 (62%), Gaps = 13/79 (16%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPYGLGVVA  210
             SLT LRPLTCAA +            PDLIKWV REGGFVH +VKIA +    GLG+V 
Sbjct  2    CSLTQLRPLTCAASA------------PDLIKWVAREGGFVHRAVKIAQLDSSNGLGLVT  49

Query  211  SDDIPKGSDLIALPEHLPL  267
             ++IP+G +L A+   L L
Sbjct  50   KEEIPRGKELWAMKLGLKL  68



>ref|XP_006647850.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Oryza 
brachyantha]
Length=486

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QF  273
            + 
Sbjct  109  RL  110



>gb|EEE57758.1| hypothetical protein OsJ_08284 [Oryza sativa Japonica Group]
Length=437

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QF  273
            + 
Sbjct  109  RL  110



>gb|EEC73951.1| hypothetical protein OsI_08832 [Oryza sativa Indica Group]
Length=486

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QF  273
            + 
Sbjct  109  RL  110



>ref|NP_001048036.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAD16153.1| SET domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF09950.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAH00588.1| unnamed protein product [Oryza sativa Japonica Group]
Length=486

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP++++     +GLGV    A  DIP G  LIALP  LPL
Sbjct  49   RIAPQPPDLLRWVQREGGFVHPALRVVDHPEHGLGVSAAAAEGDIPPGDVLIALPGRLPL  108

Query  268  QF  273
            + 
Sbjct  109  RL  110



>ref|XP_002454330.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
 gb|EES07306.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
Length=490

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +1

Query  109  QPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVAS---DDIPKGSDLIALPEHLPLQF  273
            QPPDL++WV+REGGFVHP++++A    +GLGV A+    DIP G  LIALP  LPL+ 
Sbjct  57   QPPDLVRWVQREGGFVHPALRVANHPEHGLGVSAAAPDGDIPPGDVLIALPGRLPLRL  114



>dbj|BAK03360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPL  267
            R+A QPPDL++WV+REGGFVHP+++++    YGLGV    A   IP G+ LI LP  +PL
Sbjct  48   RIAQQPPDLLRWVQREGGFVHPALRVSDHPEYGLGVSATAADGAIPPGAVLIDLPGRIPL  107

Query  268  QF  273
            + 
Sbjct  108  RL  109



>gb|ADE77120.1| unknown [Picea sitchensis]
Length=191

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  88   YSSRLATQPPDLIKWVKREGGFVHPSVKIAISEPYGLGVVASDDIPKGSDLIALPEHLPL  267
            YS RL+   PDL++W++ EGGFVH  +K+      GLG+V+S  I  G+++I+LP H+PL
Sbjct  35   YSPRLSPNAPDLVQWIRDEGGFVHEGLKLENESFTGLGLVSSTPISAGTEIISLPRHIPL  94



>ref|XP_004953834.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Setaria 
italica]
Length=485

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = +1

Query  109  QPPDLIKWVKREGGFVHPSVKIAISEPYGLGV---VASDDIPKGSDLIALPEHLPLQF  273
            QPPDL++WV+REGGFVHP+++++    +GLGV    A  DIP G  LI LP  LPL+ 
Sbjct  52   QPPDLVRWVQREGGFVHPALRVSDHPEHGLGVSAAAADGDIPPGEVLITLPGRLPLRL  109



>ref|XP_006580887.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=419

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 13/64 (20%)
 Frame = +1

Query  34   ASLTHLRPLTCAAVSATLYSSRLATQPPDLIKWVKREGGFVHPSVKIA-ISEPYGLGVVA  210
             SLT LRPLTCAA +            PDLIKWV REGGFVH +VKIA +    GLG+  
Sbjct  2    CSLTQLRPLTCAASA------------PDLIKWVAREGGFVHRAVKIAQLDSSNGLGLHL  49

Query  211  SDDI  222
            ++++
Sbjct  50   AEEL  53



>gb|EMT12546.1| hypothetical protein F775_52053 [Aegilops tauschii]
Length=500

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 6/65 (9%)
 Frame = +1

Query  97   RLATQPPDLIKWVKREGGFVHPSVKI-AISEPYGLGV-----VASDDIPKGSDLIALPEH  258
            R+A QPPDL++WV+REGGFVHP++++     P   G+      A   IP G+ LI LP  
Sbjct  48   RIAQQPPDLLRWVQREGGFVHPALRVYGARSPLAAGLGGPAPGADGIIPPGAVLIDLPGR  107

Query  259  LPLQF  273
            +PL+ 
Sbjct  108  IPLRL  112



>ref|XP_002989522.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
 gb|EFJ09398.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
Length=464

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAIS-EPYGLGVVASDDIPKGSDLIALPEHLPL  267
            DL  WVK +GGFV   + +  S   +G+G+VA+ D+P+GS +I LP  +P+
Sbjct  21   DLRGWVKNQGGFVWSGLHVVHSGSSHGMGLVATQDLPQGSTIITLPRRIPM  71



>ref|XP_002964620.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
 gb|EFJ34953.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
Length=464

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +1

Query  118  DLIKWVKREGGFVHPSVKIAIS-EPYGLGVVASDDIPKGSDLIALPEHLPL  267
            DL  WVK +GGFV   + +  S   +G+G+VA+ D+P+GS +I LP  +P+
Sbjct  21   DLRGWVKNQGGFVWSGLHVVHSGSSHGMGLVATQDLPQGSTIITLPRRVPM  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556016196600