BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015H06

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004235905.1|  PREDICTED: putative adenylate cyclase regula...    185   9e-52   Solanum lycopersicum
ref|XP_006341392.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    181   5e-50   Solanum tuberosum [potatoes]
ref|XP_009611340.1|  PREDICTED: F-box/LRR-repeat protein 13 isofo...    179   2e-49   Nicotiana tomentosiformis
ref|XP_009796748.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    174   9e-48   Nicotiana sylvestris
ref|XP_011073379.1|  PREDICTED: F-box/LRR-repeat protein 14             174   1e-47   Sesamum indicum [beniseed]
emb|CDO98185.1|  unnamed protein product                                172   5e-47   Coffea canephora [robusta coffee]
ref|XP_007023315.1|  Leucine-rich repeat family protein isoform 2       166   2e-45   
ref|XP_002270172.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    166   1e-44   Vitis vinifera
ref|XP_006492112.1|  PREDICTED: LRR receptor-like serine/threonin...    165   2e-44   Citrus sinensis [apfelsine]
ref|XP_006427462.1|  hypothetical protein CICLE_v10025249mg             164   3e-44   Citrus clementina [clementine]
ref|XP_006427460.1|  hypothetical protein CICLE_v10025249mg             164   5e-44   Citrus clementina [clementine]
ref|XP_006305845.1|  hypothetical protein CARUB_v10010899mg             160   2e-42   Capsella rubella
ref|XP_010097169.1|  hypothetical protein L484_025715                   159   4e-42   Morus notabilis
gb|EYU21683.1|  hypothetical protein MIMGU_mgv1a003547mg                159   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_002517700.1|  F-box/LRR-repeat protein, putative                 158   5e-42   
ref|XP_009363926.1|  PREDICTED: F-box/LRR-repeat protein 14-like        158   9e-42   
ref|XP_008384922.1|  PREDICTED: F-box/LRR-repeat protein 14-like        157   1e-41   Malus domestica [apple tree]
ref|XP_009338390.1|  PREDICTED: F-box/LRR-repeat protein 16-like        157   2e-41   Pyrus x bretschneideri [bai li]
gb|ACB87911.1|  F-box-containing protein 1                              157   2e-41   Malus domestica [apple tree]
ref|XP_008361107.1|  PREDICTED: F-box/LRR-repeat protein 13-like        156   3e-41   
ref|XP_009148961.1|  PREDICTED: F-box/LRR-repeat protein 14             156   4e-41   Brassica rapa
ref|XP_002262830.2|  PREDICTED: F-box/LRR-repeat protein 14             155   5e-41   Vitis vinifera
ref|XP_007023314.1|  Leucine-rich repeat family protein isoform 1       155   5e-41   
emb|CDY36583.1|  BnaA06g10360D                                          155   6e-41   Brassica napus [oilseed rape]
ref|XP_009358539.1|  PREDICTED: F-box/LRR-repeat protein 16-like        155   7e-41   Pyrus x bretschneideri [bai li]
emb|CDY33388.1|  BnaC05g11950D                                          154   1e-40   Brassica napus [oilseed rape]
ref|XP_010532116.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    154   2e-40   Tarenaya hassleriana [spider flower]
gb|KDP37033.1|  hypothetical protein JCGZ_06089                         154   2e-40   Jatropha curcas
ref|XP_010532117.1|  PREDICTED: F-box/LRR-repeat protein 16 isofo...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010532111.1|  PREDICTED: F-box/LRR-repeat protein 16 isofo...    154   2e-40   Tarenaya hassleriana [spider flower]
gb|KHG11502.1|  F-box/LRR-repeat 14                                     154   2e-40   Gossypium arboreum [tree cotton]
ref|XP_010537926.1|  PREDICTED: EIN3-binding F-box protein 1-like       154   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_010532114.1|  PREDICTED: F-box/LRR-repeat protein 16 isofo...    154   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_010532113.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...    154   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_010532115.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...    154   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_010244895.1|  PREDICTED: F-box/LRR-repeat protein 13-like        153   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_003542662.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    153   5e-40   
ref|XP_010250286.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    152   9e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010250285.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    152   1e-39   Nelumbo nucifera [Indian lotus]
gb|KCW53868.1|  hypothetical protein EUGRSUZ_J03087                     150   1e-39   Eucalyptus grandis [rose gum]
gb|KHN47120.1|  F-box/LRR-repeat protein 14                             152   2e-39   Glycine soja [wild soybean]
gb|KCW53867.1|  hypothetical protein EUGRSUZ_J03087                     150   2e-39   Eucalyptus grandis [rose gum]
gb|KCW53865.1|  hypothetical protein EUGRSUZ_J03087                     150   2e-39   Eucalyptus grandis [rose gum]
gb|KCW53864.1|  hypothetical protein EUGRSUZ_J03087                     151   2e-39   Eucalyptus grandis [rose gum]
gb|KCW53866.1|  hypothetical protein EUGRSUZ_J03087                     150   2e-39   Eucalyptus grandis [rose gum]
ref|XP_007013624.1|  Binding protein, putative                          151   3e-39   
gb|KCW53862.1|  hypothetical protein EUGRSUZ_J03087                     151   3e-39   Eucalyptus grandis [rose gum]
gb|KCW53863.1|  hypothetical protein EUGRSUZ_J03087                     150   3e-39   Eucalyptus grandis [rose gum]
gb|KCW53860.1|  hypothetical protein EUGRSUZ_J03087                     151   3e-39   Eucalyptus grandis [rose gum]
gb|KCW53859.1|  hypothetical protein EUGRSUZ_J03087                     150   3e-39   Eucalyptus grandis [rose gum]
ref|XP_008461146.1|  PREDICTED: F-box/LRR-repeat protein 14             150   4e-39   Cucumis melo [Oriental melon]
gb|KCW53858.1|  hypothetical protein EUGRSUZ_J03087                     150   4e-39   Eucalyptus grandis [rose gum]
gb|KCW53857.1|  hypothetical protein EUGRSUZ_J03087                     151   4e-39   Eucalyptus grandis [rose gum]
gb|KJB23679.1|  hypothetical protein B456_004G109300                    149   7e-39   Gossypium raimondii
ref|XP_007215814.1|  hypothetical protein PRUPE_ppa004098mg             149   7e-39   
ref|XP_007215815.1|  hypothetical protein PRUPE_ppa004098mg             149   8e-39   Prunus persica
ref|XP_007204208.1|  hypothetical protein PRUPE_ppa003392mg             149   1e-38   Prunus persica
ref|XP_004287248.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    148   2e-38   Fragaria vesca subsp. vesca
ref|XP_004135866.1|  PREDICTED: F-box/LRR-repeat protein 14-like        148   2e-38   Cucumis sativus [cucumbers]
ref|XP_011457338.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    148   3e-38   Fragaria vesca subsp. vesca
gb|KJB70659.1|  hypothetical protein B456_011G085800                    147   4e-38   Gossypium raimondii
gb|KJB70657.1|  hypothetical protein B456_011G085800                    147   4e-38   Gossypium raimondii
gb|KJB23677.1|  hypothetical protein B456_004G109300                    147   4e-38   Gossypium raimondii
gb|KJB70660.1|  hypothetical protein B456_011G085800                    147   6e-38   Gossypium raimondii
ref|XP_008242881.1|  PREDICTED: F-box/LRR-repeat protein 13-like        147   6e-38   Prunus mume [ume]
ref|XP_010033984.1|  PREDICTED: F-box/LRR-repeat protein 14             145   2e-37   Eucalyptus grandis [rose gum]
ref|XP_006416883.1|  hypothetical protein EUTSA_v10007169mg             145   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_002532313.1|  protein binding protein, putative                  145   2e-37   
ref|NP_563980.2|  leucine-rich repeat-containing protein                145   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAF82144.1|AC034256_8  Contains similarity to F-box protein FB...    145   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAK28636.1|AF360339_1  unknown protein                               145   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600722.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    145   4e-37   Glycine max [soybeans]
ref|XP_003549716.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    144   4e-37   Glycine max [soybeans]
ref|XP_008228736.1|  PREDICTED: F-box/LRR-repeat protein 14             144   5e-37   Prunus mume [ume]
gb|KHN15024.1|  F-box/LRR-repeat protein 14                             144   6e-37   Glycine soja [wild soybean]
ref|XP_004303269.1|  PREDICTED: F-box/LRR-repeat protein 13             144   9e-37   Fragaria vesca subsp. vesca
ref|XP_010906010.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    143   1e-36   
ref|XP_004506962.1|  PREDICTED: internalin-A-like isoform X1            142   2e-36   Cicer arietinum [garbanzo]
ref|XP_010906009.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    142   2e-36   Elaeis guineensis
ref|XP_008801889.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    142   3e-36   Phoenix dactylifera
ref|XP_008801891.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    142   3e-36   Phoenix dactylifera
gb|KEH28673.1|  F-box/LRR protein, putative                             135   4e-36   Medicago truncatula
ref|XP_010476663.1|  PREDICTED: F-box/LRR-repeat protein 2-like i...    141   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010497352.1|  PREDICTED: F-box/LRR-repeat protein 2-like i...    141   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010497346.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    141   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010459109.1|  PREDICTED: F-box/LRR-repeat protein 14-like        141   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010476662.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    141   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002890123.1|  leucine-rich repeat family protein                 141   6e-36   
gb|KDP30209.1|  hypothetical protein JCGZ_16991                         141   8e-36   Jatropha curcas
ref|NP_001047418.1|  Os02g0613200                                       140   2e-35   
ref|XP_011020241.1|  PREDICTED: F-box/LRR-repeat protein 14             139   4e-35   Populus euphratica
ref|XP_002308980.2|  leucine-rich repeat family protein                 139   6e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004508415.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    137   8e-35   
ref|XP_004508414.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    138   1e-34   Cicer arietinum [garbanzo]
ref|NP_001147302.1|  regulatory subunit                                 137   1e-34   Zea mays [maize]
ref|XP_006647506.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    137   2e-34   Oryza brachyantha
ref|XP_006852826.1|  hypothetical protein AMTR_s00033p00180120          137   2e-34   Amborella trichopoda
ref|XP_003609481.1|  F-box/LRR-repeat protein                           137   2e-34   Medicago truncatula
gb|AFW72317.1|  hypothetical protein ZEAMMB73_434085                    135   2e-34   
ref|XP_007135773.1|  hypothetical protein PHAVU_010G157600g             137   2e-34   Phaseolus vulgaris [French bean]
gb|EAY86666.1|  hypothetical protein OsI_08050                          137   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_003604348.1|  F-box/LRR-repeat protein                           137   3e-34   
gb|AFK38491.1|  unknown                                                 136   4e-34   Medicago truncatula
ref|XP_003599715.1|  F-box/LRR-repeat protein                           136   4e-34   
ref|XP_008813122.1|  PREDICTED: F-box/LRR-repeat protein 14-like        136   5e-34   Phoenix dactylifera
gb|KHN01311.1|  F-box/LRR-repeat protein 14                             135   7e-34   Glycine soja [wild soybean]
ref|XP_007155092.1|  hypothetical protein PHAVU_003G172400g             135   7e-34   Phaseolus vulgaris [French bean]
ref|XP_003528299.1|  PREDICTED: leucine-rich repeats and immunogl...    135   7e-34   Glycine max [soybeans]
ref|XP_006583114.1|  PREDICTED: leucine-rich repeats and immunogl...    136   8e-34   
ref|XP_010687833.1|  PREDICTED: F-box/LRR-repeat protein 14             135   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009348314.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...    132   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_009348313.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    132   1e-32   Pyrus x bretschneideri [bai li]
gb|KHN38005.1|  F-box/LRR-repeat protein 14                             132   2e-32   Glycine soja [wild soybean]
dbj|BAJ98524.1|  predicted protein                                      131   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009338496.1|  PREDICTED: F-box/LRR-repeat protein 13-like        130   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_004506963.1|  PREDICTED: internalin-A-like isoform X2            130   6e-32   
ref|XP_010110472.1|  hypothetical protein L484_005452                   129   1e-31   
gb|EPS69100.1|  hypothetical protein M569_05667                         129   1e-31   Genlisea aurea
ref|XP_004953091.1|  PREDICTED: putative adenylate cyclase regula...    129   2e-31   Setaria italica
ref|XP_009401378.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    128   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403193.1|  PREDICTED: F-box/LRR-repeat protein 14             128   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401377.1|  PREDICTED: leucine-rich repeat-containing G-...    128   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009611338.1|  PREDICTED: F-box/LRR-repeat protein 13 isofo...  91.3    1e-30   Nicotiana tomentosiformis
emb|CDP10490.1|  unnamed protein product                                126   1e-30   Coffea canephora [robusta coffee]
ref|XP_009796215.1|  PREDICTED: F-box/LRR-repeat protein 2-like i...    124   4e-30   Nicotiana sylvestris
gb|KCW53861.1|  hypothetical protein EUGRSUZ_J03087                     125   5e-30   Eucalyptus grandis [rose gum]
ref|XP_009796213.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    124   9e-30   Nicotiana sylvestris
ref|XP_010313815.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    123   1e-29   Solanum lycopersicum
ref|XP_010313816.1|  PREDICTED: uncharacterized F-box/LRR-repeat ...    123   1e-29   Solanum lycopersicum
ref|XP_010313811.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    124   1e-29   Solanum lycopersicum
ref|XP_009595107.1|  PREDICTED: F-box/LRR-repeat protein 14-like        124   1e-29   Nicotiana tomentosiformis
ref|XP_003575347.1|  PREDICTED: F-box/LRR-repeat protein 14-like        119   5e-28   Brachypodium distachyon [annual false brome]
ref|XP_010323274.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    119   6e-28   Solanum lycopersicum
ref|XP_010323273.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...    119   6e-28   Solanum lycopersicum
ref|XP_004242726.1|  PREDICTED: probable LRR receptor-like serine...    119   8e-28   Solanum lycopersicum
ref|XP_009762906.1|  PREDICTED: toll-like receptor 13 isoform X3        118   1e-27   Nicotiana sylvestris
ref|XP_003580088.1|  PREDICTED: leucine-rich repeat-containing G-...    118   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_009762905.1|  PREDICTED: toll-like receptor 13 isoform X2        118   2e-27   Nicotiana sylvestris
ref|XP_009762904.1|  PREDICTED: toll-like receptor 13 isoform X1        118   2e-27   Nicotiana sylvestris
ref|XP_002448130.1|  hypothetical protein SORBIDRAFT_06g021780          117   4e-27   Sorghum bicolor [broomcorn]
ref|XP_006359507.1|  PREDICTED: F-box/LRR-repeat protein 14-like        114   4e-26   Solanum tuberosum [potatoes]
ref|XP_008372697.1|  PREDICTED: toll-like receptor 13                   114   5e-26   
ref|XP_009796749.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...  89.4    7e-26   Nicotiana sylvestris
ref|XP_009621392.1|  PREDICTED: F-box/LRR-repeat protein 2-like i...    110   3e-25   Nicotiana tomentosiformis
ref|XP_006652480.1|  PREDICTED: F-box/LRR-repeat protein 14-like        111   7e-25   Oryza brachyantha
gb|EPS71509.1|  hypothetical protein M569_03250                         108   8e-25   Genlisea aurea
ref|XP_009621391.1|  PREDICTED: EIN3-binding F-box protein 1-like...    110   1e-24   Nicotiana tomentosiformis
ref|XP_009621390.1|  PREDICTED: EIN3-binding F-box protein 1-like...    110   1e-24   Nicotiana tomentosiformis
tpg|DAA37063.1|  TPA: hypothetical protein ZEAMMB73_067914              107   2e-24   
emb|CAN67937.1|  hypothetical protein VITISV_014237                     105   3e-24   Vitis vinifera
tpg|DAA37065.1|  TPA: hypothetical protein ZEAMMB73_067914              107   3e-24   
ref|NP_001141453.1|  uncharacterized protein LOC100273563               108   8e-24   Zea mays [maize]
gb|ACG43200.1|  regulatory subunit                                      107   9e-24   Zea mays [maize]
ref|XP_004978117.1|  PREDICTED: F-box/LRR-repeat protein 13-like        107   1e-23   
gb|EMS49495.1|  hypothetical protein TRIUR3_13085                       103   1e-22   Triticum urartu
emb|CAE02935.3|  OSJNBa0014K14.7                                        103   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67587.1|  OSIGBa0112M24.4                                        103   3e-22   Oryza sativa [red rice]
gb|EMT00676.1|  hypothetical protein F775_32177                         103   3e-22   
ref|XP_010654848.1|  PREDICTED: F-box/LRR-repeat protein 14 isofo...    103   4e-22   Vitis vinifera
ref|NP_001053240.1|  Os04g0503500                                       103   4e-22   
ref|XP_002980094.1|  hypothetical protein SELMODRAFT_419616             102   6e-22   Selaginella moellendorffii
gb|KJB23678.1|  hypothetical protein B456_004G109300                  94.4    5e-19   Gossypium raimondii
ref|XP_001780819.1|  predicted protein                                92.0    3e-18   
ref|XP_006474376.1|  PREDICTED: uncharacterized protein LOC102609559  87.0    4e-18   
gb|KDO52283.1|  hypothetical protein CISIN_1g009672mg                 85.9    2e-16   Citrus sinensis [apfelsine]
gb|KDO52281.1|  hypothetical protein CISIN_1g009672mg                 86.3    2e-16   Citrus sinensis [apfelsine]
gb|KDO52282.1|  hypothetical protein CISIN_1g009672mg                 85.9    2e-16   Citrus sinensis [apfelsine]
gb|KDO52277.1|  hypothetical protein CISIN_1g009672mg                 85.9    3e-16   Citrus sinensis [apfelsine]
gb|KDO52278.1|  hypothetical protein CISIN_1g009672mg                 85.9    3e-16   Citrus sinensis [apfelsine]
gb|KDO52279.1|  hypothetical protein CISIN_1g009672mg                 85.9    3e-16   Citrus sinensis [apfelsine]
gb|KDO52276.1|  hypothetical protein CISIN_1g009672mg                 85.9    3e-16   Citrus sinensis [apfelsine]
gb|KDO52275.1|  hypothetical protein CISIN_1g009672mg                 85.9    4e-16   Citrus sinensis [apfelsine]
ref|XP_006595170.1|  PREDICTED: EIN3-binding F-box protein 1-like...  85.5    5e-16   Glycine max [soybeans]
gb|KHN44196.1|  F-box/LRR-repeat protein 14                           85.1    1e-15   Glycine soja [wild soybean]
ref|XP_003543689.1|  PREDICTED: EIN3-binding F-box protein 1-like...  84.7    1e-15   Glycine max [soybeans]
ref|XP_009796214.1|  PREDICTED: F-box/LRR-repeat protein 14-like ...  81.6    1e-14   Nicotiana sylvestris
ref|XP_001758973.1|  predicted protein                                78.6    1e-13   
gb|KDO52280.1|  hypothetical protein CISIN_1g009672mg                 73.6    6e-12   Citrus sinensis [apfelsine]
ref|XP_006597112.1|  PREDICTED: uncharacterized protein LOC102660607  68.9    1e-11   Glycine max [soybeans]
gb|KDO42721.1|  hypothetical protein CISIN_1g035038mg                 58.2    2e-08   Citrus sinensis [apfelsine]
ref|XP_002506103.1|  predicted protein                                51.2    2e-04   Micromonas commoda
gb|EWM21918.1|  Leucine-rich repeat, cysteine-containing subtype      49.7    5e-04   Nannochloropsis gaditana
ref|XP_005829196.1|  hypothetical protein GUITHDRAFT_74106            48.9    0.001   Guillardia theta CCMP2712



>ref|XP_004235905.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
 ref|XP_010318712.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
 ref|XP_010318713.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
 ref|XP_010318714.1| PREDICTED: putative adenylate cyclase regulatory protein [Solanum 
lycopersicum]
Length=577

 Score =   185 bits (470),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   +DS+HRGVSGRY KS SSKWLGSS SR + D + G G CPSLMELC
Sbjct  1    MGGACSRKRDQQVSEDSLHRGVSGRYSKSASSKWLGSSFSRGA-DAKQGKGKCPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I+++C+DIDKYSTFS+LPRDISQQIFDELVCSQRLT V LEAFRDCALQDLN+GEYP LD
Sbjct  60   IHRVCEDIDKYSTFSVLPRDISQQIFDELVCSQRLTDVSLEAFRDCALQDLNMGEYPGLD  119

Query  526  DTWMDVI  546
            D WMDVI
Sbjct  120  DNWMDVI  126



>ref|XP_006341392.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006341393.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006341394.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X3 [Solanum 
tuberosum]
Length=577

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   +DS+HRGVSGRY KS SSKWLG+S SR + D + G G CPSLMELC
Sbjct  1    MGGACSRKRDQQVSEDSLHRGVSGRYSKSASSKWLGTSFSRGA-DAKQGKGKCPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I+++C+DIDKYSTFS+LPRDISQQIFDELVC QRLT V LEAFRDCALQDLN+GEYP L+
Sbjct  60   IHRVCEDIDKYSTFSVLPRDISQQIFDELVCLQRLTDVSLEAFRDCALQDLNMGEYPGLN  119

Query  526  DTWMDVI  546
            D WMDVI
Sbjct  120  DCWMDVI  126



>ref|XP_009611340.1| PREDICTED: F-box/LRR-repeat protein 13 isoform X2 [Nicotiana 
tomentosiformis]
Length=577

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+SIHRGVSGRY KS SSKWLG+S SR + D + GNG  PSLMELC
Sbjct  1    MGGACSRKRDQQVNDESIHRGVSGRYSKSASSKWLGTSFSRGA-DVKQGNGKYPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DIDKY+TFS+LPRDISQQIFDELV +QRLT V LEAFRDCALQDLN+GEYP L+
Sbjct  60   IRRICEDIDKYNTFSVLPRDISQQIFDELVGAQRLTDVSLEAFRDCALQDLNMGEYPGLN  119

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  120  DHWMDVISS  128



>ref|XP_009796748.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Nicotiana 
sylvestris]
Length=577

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+SIHRGVSGRY KS SSKWLG+S SR + D +  NG  PSLMELC
Sbjct  1    MGGACSRKRDQQVNDESIHRGVSGRYSKSASSKWLGTSFSRGA-DAKQRNGKYPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DIDKY+TFS+LPRDISQQIFDELV +QRLT V LEAFRDCALQDL++GEYP L+
Sbjct  60   IRKICEDIDKYNTFSVLPRDISQQIFDELVGTQRLTDVSLEAFRDCALQDLDMGEYPGLN  119

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  120  DQWMDVISS  128



>ref|XP_011073379.1| PREDICTED: F-box/LRR-repeat protein 14 [Sesamum indicum]
Length=578

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   +D+++RGVSGRY KSGSSKWLG+S SRSS+D   G  +CPSLM+LC
Sbjct  1    MGGACSRKRDQPVNEDNLNRGVSGRYTKSGSSKWLGTSFSRSSMDASQGKRSCPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            IY+I QDI+KYSTFSMLPRDISQQIFD+LVCSQ LT  +LEAFRDCALQDLNLGEYP   
Sbjct  61   IYKIRQDINKYSTFSMLPRDISQQIFDDLVCSQCLTDSVLEAFRDCALQDLNLGEYPGFS  120

Query  526  DTWMDVISS  552
            D WMDV+SS
Sbjct  121  DNWMDVVSS  129



>emb|CDO98185.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ++D+IHRG SGRYCKSGSSKWLGSS SRS  D + G G  PSLMELC
Sbjct  1    MGGACSRKRDQQVDEDNIHRGFSGRYCKSGSSKWLGSSFSRSLSDVKQGIGKSPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             Y+IC+ I  Y +FSMLPRD+SQQIFDELV SQRL  VIL+AFRDCALQDLNLGEYP  +
Sbjct  61   TYKICEAIHNYGSFSMLPRDVSQQIFDELVYSQRLNDVILQAFRDCALQDLNLGEYPGFN  120

Query  526  DTWMDVISS  552
            D+WMD+I+S
Sbjct  121  DSWMDMIAS  129



>ref|XP_007023315.1| Leucine-rich repeat family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY25937.1| Leucine-rich repeat family protein isoform 2, partial [Theobroma 
cacao]
Length=444

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQL  +D +HRGVSGRYCKSGSSKWL ++ +R  ++ + G G CPSLMELC
Sbjct  1    MGGACSRKRDQLDNEDGLHRGVSGRYCKSGSSKWLTTTFTRPVVESQRGKGKCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             Y+I +DID Y +FSMLPRD+SQQIF+ELV SQ LT V L+AFRDCALQDL LGEYP ++
Sbjct  61   TYKIREDIDNYGSFSMLPRDLSQQIFNELVNSQCLTDVSLKAFRDCALQDLYLGEYPGVN  120

Query  526  DTWMDVI  546
            D WMDVI
Sbjct  121  DNWMDVI  127



>ref|XP_002270172.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Vitis vinifera]
 ref|XP_010654847.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Vitis vinifera]
 emb|CBI36423.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD    +DS+ RGVSG+YC+ GSSKWLG+S+SR ++D   G G CPSLMELC
Sbjct  1    MGGACSRKRDPQVNEDSLQRGVSGKYCRIGSSKWLGTSISRPALDILQGRGQCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            IY+I +DIDKY+TFSMLPRDISQQIF+ELV SQ LT V L+AF+DCALQD+ LGEYP + 
Sbjct  61   IYKIREDIDKYTTFSMLPRDISQQIFNELVFSQCLTDVSLKAFQDCALQDIYLGEYPGVS  120

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  121  DSWMDVISS  129



>ref|XP_006492112.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X1 [Citrus sinensis]
 ref|XP_006492113.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X2 [Citrus sinensis]
 ref|XP_006492114.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X3 [Citrus sinensis]
 ref|XP_006492115.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like isoform X4 [Citrus sinensis]
Length=578

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ+  +D +H GV GRY KS SSKWL +S SR  +D + G G CPSLMELC
Sbjct  1    MGGACSRKRDQVDNEDGLHGGVCGRYQKSCSSKWLMTSFSRPPLDIQRGEGKCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             Y+IC+DID+YSTFSMLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++
Sbjct  61   AYKICEDIDRYSTFSMLPRDISQQIFNELVYSRYLTEVSLEAFRDCALQDLCLGQYPGVN  120

Query  526  DTWMDVISS  552
            D WMDVI+S
Sbjct  121  DKWMDVIAS  129



>ref|XP_006427462.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 gb|ESR40702.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
Length=529

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ+  +D +H GV GRY KS SSKWL +S SR  +D + G G CPSLMELC
Sbjct  1    MGGACSRKRDQVDNEDGLHGGVCGRYQKSCSSKWLMTSFSRPPLDIQRGEGKCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             Y+IC+DID+YSTFSMLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++
Sbjct  61   AYKICEDIDRYSTFSMLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVN  120

Query  526  DTWMDVISS  552
            D WMDVI+S
Sbjct  121  DKWMDVIAS  129



>ref|XP_006427460.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 ref|XP_006427461.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 gb|ESR40700.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
 gb|ESR40701.1| hypothetical protein CICLE_v10025249mg [Citrus clementina]
Length=578

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ+  +D +H GV GRY KS SSKWL +S SR  +D + G G CPSLMELC
Sbjct  1    MGGACSRKRDQVDNEDGLHGGVCGRYQKSCSSKWLMTSFSRPPLDIQRGEGKCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             Y+IC+DID+YSTFSMLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++
Sbjct  61   AYKICEDIDRYSTFSMLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVN  120

Query  526  DTWMDVISS  552
            D WMDVI+S
Sbjct  121  DKWMDVIAS  129



>ref|XP_006305845.1| hypothetical protein CARUB_v10010899mg [Capsella rubella]
 gb|EOA38743.1| hypothetical protein CARUB_v10010899mg [Capsella rubella]
Length=585

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+YCKS SSKWL +SLSRS+ D +  NG CPSLMELC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYCKSSSSKWLATSLSRSASDAKRNNGECPSLMELC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            +  I QDID+Y+ FS LPRDISQQIFDELV SQRL+   LEAFRDCA+QDL LGEYP ++
Sbjct  67   LRNIQQDIDRYTKFSDLPRDISQQIFDELVFSQRLSLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>ref|XP_010097169.1| hypothetical protein L484_025715 [Morus notabilis]
 gb|EXB67236.1| hypothetical protein L484_025715 [Morus notabilis]
Length=580

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRG--VSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLME  339
            MGG CSRKRDQ  E+D+++ G  VS RYCKSGSSKWL +S +R ++D + GNG CPSL++
Sbjct  1    MGGACSRKRDQREEEDNLNGGGGVSRRYCKSGSSKWLATSFTRPAVDFQPGNGKCPSLLD  60

Query  340  LCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPC  519
            LCI +I +DIDKY TFSMLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LGEYP 
Sbjct  61   LCIRKIREDIDKYDTFSMLPRDISQQIFNELVYSRCLTEVTLEAFRDCALQDLYLGEYPG  120

Query  520  LDDTWMDVISS  552
            ++D+WMDV+SS
Sbjct  121  VNDSWMDVVSS  131



>gb|EYU21683.1| hypothetical protein MIMGU_mgv1a003547mg [Erythranthe guttata]
Length=579

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHR-GVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMEL  342
            MGG CSRKRD LA +D+ +R G SGRY KS SSKWLG+S SR+ +D   G  N PSL+ L
Sbjct  1    MGGACSRKRDPLANEDTSNRVGPSGRYTKSSSSKWLGTSFSRAYMDAMQGKRNRPSLINL  60

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CIY+I +DI+KYSTFSMLPRDISQQIFD+LV S  LT  +LEAFRDCALQDLNLGEYP  
Sbjct  61   CIYKIREDINKYSTFSMLPRDISQQIFDDLVYSHCLTDSVLEAFRDCALQDLNLGEYPGF  120

Query  523  DDTWMDVISS  552
            DD+WMD++SS
Sbjct  121  DDSWMDIVSS  130



>ref|XP_002517700.1| F-box/LRR-repeat protein, putative [Ricinus communis]
 gb|EEF44864.1| F-box/LRR-repeat protein, putative [Ricinus communis]
Length=529

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKR+QL  +D++ RG+S RY KSGSSKWL +S SR + +   GN  CPSLMELC
Sbjct  1    MGGACSRKRNQLENEDNLQRGISRRYSKSGSSKWLATSFSRPAYELLRGNQRCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +DIDKYSTFSMLPRDISQQIF+ELV SQRL    +EAFRDCALQDL+LGE P ++
Sbjct  61   IQKIREDIDKYSTFSMLPRDISQQIFNELVYSQRLNDATIEAFRDCALQDLHLGECPGVN  120

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  121  DSWMDVISS  129



>ref|XP_009363926.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363927.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363930.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363931.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
 ref|XP_009363932.1| PREDICTED: F-box/LRR-repeat protein 14-like [Pyrus x bretschneideri]
Length=579

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG+CSRKRDQ   +D +   V+GRY KS SSKWL +S  R +++ P  G G CPSL+EL
Sbjct  1    MGGICSRKRDQPVIEDEVRSVVAGRYGKSSSSKWLRNSSFRPAVELPPGGAGTCPSLLEL  60

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI +ICQDIDKYS+FSMLPRD+SQQIF+ELVCS  LT V LEAFRDCAL+D+ LGEYP +
Sbjct  61   CIRKICQDIDKYSSFSMLPRDLSQQIFNELVCSNSLTDVSLEAFRDCALEDIGLGEYPDV  120

Query  523  DDTWMDVISS  552
             D+WM VISS
Sbjct  121  KDSWMSVISS  130



>ref|XP_008384922.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
 ref|XP_008384930.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
 ref|XP_008384936.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
 ref|XP_008384944.1| PREDICTED: F-box/LRR-repeat protein 14-like [Malus domestica]
Length=580

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG+CSRKRDQ   +D +   V+GRY KS SSKWL +S  R +++ P  G G CPSL+EL
Sbjct  2    MGGICSRKRDQPVIEDEVRSVVAGRYGKSSSSKWLRNSSFRPAVELPPGGAGACPSLLEL  61

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI +ICQDIDKYS+FSMLPRD+SQQIF+ELVCS  LT V LEAFRDCAL+D+ LGEYP +
Sbjct  62   CIRKICQDIDKYSSFSMLPRDLSQQIFNELVCSNSLTDVSLEAFRDCALEDIGLGEYPDV  121

Query  523  DDTWMDVISS  552
             D+WM VISS
Sbjct  122  KDSWMSVISS  131



>ref|XP_009338390.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009338392.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009338393.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
Length=580

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG+CSRKR+Q   +D + R VSGRY KS SSKWL +S  R +++ P  G G CPSL+EL
Sbjct  2    MGGICSRKRNQPVIEDGVCRAVSGRYGKSSSSKWLTNSSFRPTVEQPPGGTGTCPSLLEL  61

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CIY+ICQ+IDKYS+FS LPRD+SQQIF+ELVCS  LT V L AFRDCAL+D+ LGEYP +
Sbjct  62   CIYKICQNIDKYSSFSKLPRDVSQQIFNELVCSNSLTDVSLGAFRDCALEDILLGEYPDV  121

Query  523  DDTWMDVISS  552
             D+WM VISS
Sbjct  122  KDSWMGVISS  131



>gb|ACB87911.1| F-box-containing protein 1 [Malus domestica]
Length=580

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG+CSRK++Q   +D + R VS RY KS SSKWL +S  R +++ P  G G CPSL+EL
Sbjct  2    MGGICSRKQNQPVIEDGVCRAVSRRYGKSSSSKWLTNSSFRPTVEQPPGGAGTCPSLLEL  61

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CIY+ICQ IDKYS+FSMLPRD+SQQIF+ELVCS  LT V LEAFRDCAL+D+ LGEYP +
Sbjct  62   CIYKICQSIDKYSSFSMLPRDVSQQIFNELVCSNSLTDVSLEAFRDCALEDIGLGEYPDV  121

Query  523  DDTWMDVISS  552
             D+WM VISS
Sbjct  122  KDSWMGVISS  131



>ref|XP_008361107.1| PREDICTED: F-box/LRR-repeat protein 13-like [Malus domestica]
 ref|XP_008361108.1| PREDICTED: F-box/LRR-repeat protein 13-like [Malus domestica]
 ref|XP_008361109.1| PREDICTED: F-box/LRR-repeat protein 13-like [Malus domestica]
Length=580

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG+CSRK++Q   +D + R VS RY KS SSKWL +S  R +++ P  G G CPSL+EL
Sbjct  2    MGGICSRKQNQPVIEDGVCRAVSRRYGKSSSSKWLTNSSFRPTVEQPPGGAGTCPSLLEL  61

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CIY+ICQ IDKYS+FSMLPRD+SQQIF+ELVCS  LT V LEAFRDCAL+D+ LGEYP +
Sbjct  62   CIYKICQSIDKYSSFSMLPRDVSQQIFNELVCSNSLTDVSLEAFRDCALEDIGLGEYPDV  121

Query  523  DDTWMDVISS  552
             D+WM VISS
Sbjct  122  KDSWMGVISS  131



>ref|XP_009148961.1| PREDICTED: F-box/LRR-repeat protein 14 [Brassica rapa]
Length=578

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RG  G+Y KS SSKWL +SLSRS    +  NG CPSL+ELC
Sbjct  1    MGGACSRKRDQHVED-ILNRGACGKYSKSSSSKWLATSLSRSGSGVKRSNGECPSLLELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DIDKY+TFS LPRDISQQIFDELVCSQRL+   LEAFRDCA+QDLNLGEYP ++
Sbjct  60   VRKIQEDIDKYTTFSDLPRDISQQIFDELVCSQRLSLKSLEAFRDCAIQDLNLGEYPGVN  119

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  120  DDWMDVISS  128



>ref|XP_002262830.2| PREDICTED: F-box/LRR-repeat protein 14 [Vitis vinifera]
 ref|XP_010656527.1| PREDICTED: F-box/LRR-repeat protein 14 [Vitis vinifera]
 emb|CBI25566.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ  ++D +   VSGRY KSGSSKWL +S SR  ID + G  +CPSLMELC
Sbjct  1    MGGVCSRKRDQQVDEDGVQIQVSGRYGKSGSSKWLRTSFSRPVIDCQLGRESCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++IC+DID+Y+ FSMLPRDISQQIFD  V S  LT   LEAFRDCA+QD+NLGEYP ++
Sbjct  61   IHKICEDIDRYTKFSMLPRDISQQIFDNFVDSHCLTSASLEAFRDCAIQDVNLGEYPEVN  120

Query  526  DTWMDVISS  552
            D+WMD+ISS
Sbjct  121  DSWMDIISS  129



>ref|XP_007023314.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY25936.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao]
Length=574

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  184  RKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELCIYQICQ  363
            RKRDQL  +D +HRGVSGRYCKSGSSKWL ++ +R  ++ + G G CPSLMELC Y+I +
Sbjct  3    RKRDQLDNEDGLHRGVSGRYCKSGSSKWLTTTFTRPVVESQRGKGKCPSLMELCTYKIRE  62

Query  364  DIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDV  543
            DID Y +FSMLPRD+SQQIF+ELV SQ LT V L+AFRDCALQDL LGEYP ++D WMDV
Sbjct  63   DIDNYGSFSMLPRDLSQQIFNELVNSQCLTDVSLKAFRDCALQDLYLGEYPGVNDNWMDV  122

Query  544  I  546
            I
Sbjct  123  I  123



>emb|CDY36583.1| BnaA06g10360D [Brassica napus]
Length=578

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RG  G+Y KS SSKWL +SLSRS    +  NG CPSL+ELC
Sbjct  1    MGGACSRKRDQHVED-ILNRGACGKYSKSSSSKWLATSLSRSGSGVKRTNGECPSLLELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DIDKY+TFS LPRDISQQIFDELVCSQRL+   LEAFRDCA+QDLNLGEYP ++
Sbjct  60   VRKIQEDIDKYTTFSDLPRDISQQIFDELVCSQRLSLKSLEAFRDCAIQDLNLGEYPGVN  119

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  120  DDWMDVISS  128



>ref|XP_009358539.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009358540.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
 ref|XP_009358541.1| PREDICTED: F-box/LRR-repeat protein 16-like [Pyrus x bretschneideri]
Length=580

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG+CSRKR+Q   +D + R VSGRY KS SSKWL +S  R +++ P  G G CPSL+EL
Sbjct  2    MGGICSRKRNQPVIEDGVCRAVSGRYGKSSSSKWLTNSSFRPTVEQPPGGTGTCPSLLEL  61

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CIY+ICQ+IDKY +FS LPRD+SQQIF+ELVCS  LT V L AFRDCAL+D+ LGEYP +
Sbjct  62   CIYKICQNIDKYGSFSKLPRDVSQQIFNELVCSNSLTDVSLGAFRDCALEDILLGEYPDV  121

Query  523  DDTWMDVISS  552
             D+WM VISS
Sbjct  122  KDSWMGVISS  131



>emb|CDY33388.1| BnaC05g11950D [Brassica napus]
Length=585

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RG  G+Y KS SSKWL +SLSRS    +   G CPSL+ELC
Sbjct  8    MGGACSRKRDQHVED-ILNRGACGKYSKSSSSKWLATSLSRSGSGVKRTKGECPSLLELC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DIDKY+TFS LPRDISQQIFDELVCSQRLT   LEAFRDCA+QDLNLGEYP ++
Sbjct  67   VRKIQEDIDKYTTFSDLPRDISQQIFDELVCSQRLTLKSLEAFRDCAIQDLNLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>ref|XP_010532116.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X5 [Tarenaya hassleriana]
Length=559

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+ ++RG SG+YCKS SSKWL +S SR  +D    NG CP+LMELC
Sbjct  1    MGGACSRKRDQQG-DEVLNRGFSGKYCKSSSSKWLATSFSRPGLDGHRKNGECPTLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID YS FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL+LGEYP ++
Sbjct  60   VRKIREDIDMYSKFSELPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLHLGEYPDVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DDWMSVISS  128



>gb|KDP37033.1| hypothetical protein JCGZ_06089 [Jatropha curcas]
Length=578

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQL  +DS+   +S +Y KS SSKWL +S SR + + + GN  CPSLMELC
Sbjct  1    MGGACSRKRDQLDNEDSLPSRISRQYSKSLSSKWLATSFSRPACELQWGNQRCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DI+KY+TFSMLPRDISQQIF+ELV SQ LT+V LEAFRDCALQDL+LGE P ++
Sbjct  61   IQKICKDIEKYNTFSMLPRDISQQIFNELVYSQCLTEVSLEAFRDCALQDLHLGECPAVN  120

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  121  DNWMDVISS  129



>ref|XP_010532117.1| PREDICTED: F-box/LRR-repeat protein 16 isoform X6 [Tarenaya hassleriana]
Length=555

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+ ++RG SG+YCKS SSKWL +S SR  +D    NG CP+LMELC
Sbjct  1    MGGACSRKRDQQG-DEVLNRGFSGKYCKSSSSKWLATSFSRPGLDGHRKNGECPTLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID YS FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL+LGEYP ++
Sbjct  60   VRKIREDIDMYSKFSELPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLHLGEYPDVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DDWMSVISS  128



>ref|XP_010532111.1| PREDICTED: F-box/LRR-repeat protein 16 isoform X1 [Tarenaya hassleriana]
Length=584

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+ ++RG SG+YCKS SSKWL +S SR  +D    NG CP+LMELC
Sbjct  1    MGGACSRKRDQQG-DEVLNRGFSGKYCKSSSSKWLATSFSRPGLDGHRKNGECPTLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID YS FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL+LGEYP ++
Sbjct  60   VRKIREDIDMYSKFSELPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLHLGEYPDVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DDWMSVISS  128



>gb|KHG11502.1| F-box/LRR-repeat 14 [Gossypium arboreum]
Length=554

 Score =   154 bits (388),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 85/129 (66%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ   +D + RGVSGRY KSGSSKWL +S SR  +  + G  NCPSLMELC
Sbjct  1    MGGVCSRKRDQQVVEDGMRRGVSGRYGKSGSSKWLLTSFSRPMVVHQPGLANCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++IC+DI++YS+F+MLP+DISQQIF++LV S  LT V L+ FRDCAL+D+ LGEYP + 
Sbjct  61   IHKICEDINQYSSFTMLPKDISQQIFNKLVLSHLLTDVFLQKFRDCALEDVWLGEYPGVQ  120

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  121  DSWMDVISS  129



>ref|XP_010537926.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=578

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  +++ ++RGVSG+YCKS SSKWL +S +R     +  NG CP+LMELC
Sbjct  1    MGGACSRKRDQ-QDEEILNRGVSGKYCKSSSSKWLATSFTRPGFVVQRKNGECPTLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+YS FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  60   LRKIGEDIDRYSKFSDLPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  119

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  120  DDWMDVISS  128



>ref|XP_010532114.1| PREDICTED: F-box/LRR-repeat protein 16 isoform X3 [Tarenaya hassleriana]
Length=580

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+ ++RG SG+YCKS SSKWL +S SR  +D    NG CP+LMELC
Sbjct  1    MGGACSRKRDQQG-DEVLNRGFSGKYCKSSSSKWLATSFSRPGLDGHRKNGECPTLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID YS FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL+LGEYP ++
Sbjct  60   VRKIREDIDMYSKFSELPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLHLGEYPDVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DDWMSVISS  128



>ref|XP_010532113.1| PREDICTED: F-box/LRR-repeat protein 2 isoform X2 [Tarenaya hassleriana]
Length=582

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+ ++RG SG+YCKS SSKWL +S SR  +D    NG CP+LMELC
Sbjct  1    MGGACSRKRDQQG-DEVLNRGFSGKYCKSSSSKWLATSFSRPGLDGHRKNGECPTLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID YS FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL+LGEYP ++
Sbjct  60   VRKIREDIDMYSKFSELPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLHLGEYPDVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DDWMSVISS  128



>ref|XP_010532115.1| PREDICTED: F-box/LRR-repeat protein 2 isoform X4 [Tarenaya hassleriana]
Length=578

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D+ ++RG SG+YCKS SSKWL +S SR  +D    NG CP+LMELC
Sbjct  1    MGGACSRKRDQQG-DEVLNRGFSGKYCKSSSSKWLATSFSRPGLDGHRKNGECPTLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID YS FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL+LGEYP ++
Sbjct  60   VRKIREDIDMYSKFSELPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLHLGEYPDVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DDWMSVISS  128



>ref|XP_010244895.1| PREDICTED: F-box/LRR-repeat protein 13-like [Nelumbo nucifera]
Length=578

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   ++S+ RGVSGRY KSGSSKWL +S SR  +D + G GNCPSLMELC
Sbjct  1    MGGACSRKRDQQVNEESVRRGVSGRYSKSGSSKWLVTSFSRPGVDIQQGRGNCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++I +DIDKYSTFSMLPRDISQQIF+ELV    LT   LE F DCALQD+ LGE P + 
Sbjct  61   IHKIRKDIDKYSTFSMLPRDISQQIFNELVTYHCLTDSSLEYFWDCALQDICLGECPEVK  120

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  121  DSWMDVISS  129



>ref|XP_003542662.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Glycine 
max]
 ref|XP_006594261.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Glycine 
max]
Length=578

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH--GNGNCPSLME  339
            MGGVCSRKRDQ   +D +HRGVSGRYC+SGS+KWL +   R+   P H  G G CPSLM+
Sbjct  1    MGGVCSRKRDQHVVEDDLHRGVSGRYCRSGSTKWLRARSLRA--KPNHCAGGGTCPSLMD  58

Query  340  LCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPC  519
            LCI ++ +D  KY++FS+LPRDISQQIF+ELV S  LT+V LEAFRDCALQD++LGEY  
Sbjct  59   LCIKKMREDFHKYNSFSILPRDISQQIFNELVDSHCLTEVSLEAFRDCALQDIDLGEYVG  118

Query  520  LDDTWMDVISS  552
            ++D WMDVISS
Sbjct  119  VNDDWMDVISS  129



>ref|XP_010250286.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Nelumbo 
nucifera]
Length=554

 Score =   152 bits (384),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ   ++SI RG SGRY KSGSSKWLG+   RSS+D +   G CPSLMELC
Sbjct  1    MGGVCSRKRDQQVNEESIRRGTSGRYSKSGSSKWLGTLFLRSSVDIQQRGGKCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++I ++I+ Y+TFSMLPRDISQQIF+ELV    LT V LE+FRDCALQD+ LGEYP + 
Sbjct  61   IHKIRENINNYNTFSMLPRDISQQIFNELVSFHCLTDVSLESFRDCALQDICLGEYPEVK  120

Query  526  DTWMDVISS  552
            D+WMDVI+S
Sbjct  121  DSWMDVIAS  129



>ref|XP_010250285.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Nelumbo 
nucifera]
Length=578

 Score =   152 bits (384),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ   ++SI RG SGRY KSGSSKWLG+   RSS+D +   G CPSLMELC
Sbjct  1    MGGVCSRKRDQQVNEESIRRGTSGRYSKSGSSKWLGTLFLRSSVDIQQRGGKCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++I ++I+ Y+TFSMLPRDISQQIF+ELV    LT V LE+FRDCALQD+ LGEYP + 
Sbjct  61   IHKIRENINNYNTFSMLPRDISQQIFNELVSFHCLTDVSLESFRDCALQDICLGEYPEVK  120

Query  526  DTWMDVISS  552
            D+WMDVI+S
Sbjct  121  DSWMDVIAS  129



>gb|KCW53868.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=457

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KHN47120.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=675

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ   +D +HRGVSGRYC+SGS+KWL +   R+  +   G G CPSLM+LC
Sbjct  1    MGGVCSRKRDQHVVEDDLHRGVSGRYCRSGSTKWLRARSLRAKPNHCAGGGTCPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I ++ +D  KY++FS+LPRDISQQIF+ELV S  LT+V LEAFRDCALQD++LGEY  ++
Sbjct  61   IKKMREDFHKYNSFSILPRDISQQIFNELVDSHCLTEVSLEAFRDCALQDIDLGEYVGVN  120

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  121  DDWMDVISS  129



>gb|KCW53867.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=476

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KCW53865.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=490

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KCW53864.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=610

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KCW53866.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=498

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>ref|XP_007013624.1| Binding protein, putative [Theobroma cacao]
 gb|EOY31243.1| Binding protein, putative [Theobroma cacao]
Length=578

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ   +D + RGVSGRY KS SSKWL +S SR  +  + G   CPSLMELC
Sbjct  1    MGGVCSRKRDQQVVEDGMRRGVSGRYGKSNSSKWLVTSFSRPMVVHQPGLTICPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DID+YS+FSMLP+DISQQIF++LV S  LT V L+ FRDCAL+D+ LGEYP + 
Sbjct  61   IDKICEDIDQYSSFSMLPKDISQQIFNKLVLSHLLTDVSLQKFRDCALEDVWLGEYPGVQ  120

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  121  DSWMDVISS  129



>gb|KCW53862.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=608

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KCW53863.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=569

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KCW53860.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=645

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = +1

Query  109  AKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsr  288
            A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S SR
Sbjct  97   ALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFSR  156

Query  289  ssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILE  468
            S  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V LE
Sbjct  157  SFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSLE  216

Query  469  AFRDCALQDLNLGEYPCLDDTWMDVISS  552
            AFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  217  AFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KCW53859.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=622

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>ref|XP_008461146.1| PREDICTED: F-box/LRR-repeat protein 14 [Cucumis melo]
 ref|XP_008461147.1| PREDICTED: F-box/LRR-repeat protein 14 [Cucumis melo]
 ref|XP_008461148.1| PREDICTED: F-box/LRR-repeat protein 14 [Cucumis melo]
Length=578

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgssk--wlgsslsrssIDPRHGNGNCPSLME  339
            MGG CSRKRDQL  +DS+ RGVSG+YCKSGSSK      S     IDPR G   CPSLM+
Sbjct  1    MGGACSRKRDQLDNEDSLPRGVSGKYCKSGSSKWLTTSFSRPFVDIDPRRGK--CPSLMD  58

Query  340  LCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPC  519
            LCI +IC+DID+Y +FSMLPRDISQ I +ELV SQ L  + ++AFRDCALQDL+ GE P 
Sbjct  59   LCIRRICKDIDQYDSFSMLPRDISQLILNELVYSQLLNNISIQAFRDCALQDLHFGECPG  118

Query  520  LDDTWMDVISS  552
            ++D W+DVISS
Sbjct  119  VNDAWIDVISS  129



>gb|KCW53858.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=646

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  106  TAKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgssls  285
             A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S S
Sbjct  96   VALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFS  155

Query  286  rssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVIL  465
            RS  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V L
Sbjct  156  RSFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSL  215

Query  466  EAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            EAFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  216  EAFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KCW53857.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=694

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = +1

Query  109  AKCTIPPVICKCESTTVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsr  288
            A C+I        +  +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S SR
Sbjct  97   ALCSIIHEAFVVLTRRISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFSR  156

Query  289  ssIDPRHGNGNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILE  468
            S  D +H  G CPSLM+LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V LE
Sbjct  157  SFSDVQHDRGKCPSLMDLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSLE  216

Query  469  AFRDCALQDLNLGEYPCLDDTWMDVISS  552
            AFRDCALQDL+LGEYP +DD W+DVISS
Sbjct  217  AFRDCALQDLHLGEYPGVDDKWLDVISS  244



>gb|KJB23679.1| hypothetical protein B456_004G109300 [Gossypium raimondii]
Length=470

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ   +D + RGVSGRY KSGSSKWL +S SR  +  + G   CPSLMELC
Sbjct  1    MGGVCSRKRDQQVVEDGMRRGVSGRYGKSGSSKWLLTSFSRPMVVHQPGLAICPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DI++YS+F+MLP+DISQQIF++LV S  LT V L+ FRDCAL+D+ LGEYP + 
Sbjct  61   IDKICEDINQYSSFTMLPKDISQQIFNKLVLSHLLTDVFLQKFRDCALEDVWLGEYPGVQ  120

Query  526  DTWMDVISS  552
            D+WMDVIS+
Sbjct  121  DSWMDVIST  129



>ref|XP_007215814.1| hypothetical protein PRUPE_ppa004098mg [Prunus persica]
 gb|EMJ17013.1| hypothetical protein PRUPE_ppa004098mg [Prunus persica]
Length=476

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD   ++D  H GVS RYCKSGSSKWL +S +R  +D + G G  PSLM+LC
Sbjct  1    MGGACSRKRDHRDDEDDFHLGVSRRYCKSGSSKWLTTSFTRPVLDNQPGRGKGPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DIDKY+TFSMLPRDISQQI +ELV S  LT V  E FRDCALQDL LGEYP ++
Sbjct  61   IRKICEDIDKYNTFSMLPRDISQQIINELVYSGCLTDVSFEGFRDCALQDLYLGEYPGVN  120

Query  526  DTWMDVI  546
            D WMDVI
Sbjct  121  DCWMDVI  127



>ref|XP_007215815.1| hypothetical protein PRUPE_ppa004098mg [Prunus persica]
 gb|EMJ17014.1| hypothetical protein PRUPE_ppa004098mg [Prunus persica]
Length=530

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD   ++D  H GVS RYCKSGSSKWL +S +R  +D + G G  PSLM+LC
Sbjct  1    MGGACSRKRDHRDDEDDFHLGVSRRYCKSGSSKWLTTSFTRPVLDNQPGRGKGPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DIDKY+TFSMLPRDISQQI +ELV S  LT V  E FRDCALQDL LGEYP ++
Sbjct  61   IRKICEDIDKYNTFSMLPRDISQQIINELVYSGCLTDVSFEGFRDCALQDLYLGEYPGVN  120

Query  526  DTWMDVI  546
            D WMDVI
Sbjct  121  DCWMDVI  127



>ref|XP_007204208.1| hypothetical protein PRUPE_ppa003392mg [Prunus persica]
 gb|EMJ05407.1| hypothetical protein PRUPE_ppa003392mg [Prunus persica]
Length=578

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKR+Q   +D I R VSGR   S          +        G G CPSL+ELC
Sbjct  2    MGGICSRKRNQPVVEDGICRAVSGRSGSSKWLGPSSLRPTVE--QSSGGAGICPSLLELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +ICQDIDKYS+FSMLPRD+SQQIF+ELV S  LT+V LEAFRDCAL+D+ LGE+P + 
Sbjct  60   ICKICQDIDKYSSFSMLPRDVSQQIFNELVSSHSLTEVSLEAFRDCALEDIGLGEFPDVK  119

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  120  DSWMDVISS  128



>ref|XP_004287248.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=583

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQ--LAEDDSIHRGVSGRYCksgsskwlgsslsr-ssIDPRHG-NGNCPSL  333
            MG +CSRKR+Q  + E+ +  R VSGRYCKS SSKWLG++     +++   G  G CPSL
Sbjct  2    MGSICSRKREQSVIEEEVATRRLVSGRYCKSSSSKWLGAASFHCRNVEHSPGVAGICPSL  61

Query  334  MELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEY  513
            +ELCI +IC DIDKYS+FSMLPRD+SQQ+F+ELVCSQ L+ V LEAFRDCAL+D+ LGEY
Sbjct  62   LELCISKICMDIDKYSSFSMLPRDVSQQVFNELVCSQSLSDVSLEAFRDCALEDIGLGEY  121

Query  514  PCLDDTWMDVISS  552
            PC++D+WM+ I S
Sbjct  122  PCVEDSWMEAICS  134



>ref|XP_004135866.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus]
 ref|XP_004163550.1| PREDICTED: F-box/LRR-repeat protein 14-like [Cucumis sativus]
 gb|KGN45244.1| hypothetical protein Csa_7G432250 [Cucumis sativus]
Length=578

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgssk--wlgsslsrssIDPRHGNGNCPSLME  339
            MGG CSRKRDQL  +DS+ RGVSG+YCKSGSSK      S     IDPR G   CPSLM+
Sbjct  1    MGGACSRKRDQLDNEDSLPRGVSGKYCKSGSSKWLTTSFSRPFVDIDPRRGQ--CPSLMD  58

Query  340  LCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPC  519
            LCI +IC+D+D+Y +F MLPRD+SQ I +ELV SQ LT + ++AFRDCALQDL+ GE P 
Sbjct  59   LCIQRICKDLDQYDSFGMLPRDLSQLILNELVYSQLLTDISIQAFRDCALQDLHFGECPG  118

Query  520  LDDTWMDVISS  552
            ++D W+DVISS
Sbjct  119  VNDAWIDVISS  129



>ref|XP_011457338.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457369.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=584

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQ--LAEDDSIHRGVSGRYCksgsskwlgsslsr-ssIDPRHG-NGNCPSL  333
            MG +CSRKR+Q  + E+ +  R VSGRYCKS SSKWLG++     +++   G  G CPSL
Sbjct  2    MGSICSRKREQSVIEEEVATRRLVSGRYCKSSSSKWLGAASFHCRNVEHSPGVAGICPSL  61

Query  334  MELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEY  513
            +ELCI +IC DIDKYS+FSMLPRD+SQQ+F+ELVCSQ L+ V LEAFRDCAL+D+ LGEY
Sbjct  62   LELCISKICMDIDKYSSFSMLPRDVSQQVFNELVCSQSLSDVSLEAFRDCALEDIGLGEY  121

Query  514  PCLDDTWMDVISS  552
            PC++D+WM+ I S
Sbjct  122  PCVEDSWMEAICS  134



>gb|KJB70659.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
Length=554

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG  CSRKRDQL   D   RGVSGRYCKSGSSKWL ++LSR  ++ +     CPSL+ELC
Sbjct  1    MGAACSRKRDQLDNVDGFDRGVSGRYCKSGSSKWLATTLSRPILEIQREKKKCPSLLELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             ++I +DID Y +FS LPRD+SQQIF+ELV SQRLT V LEAFRDCALQDL LG+YP ++
Sbjct  61   THKIREDIDNYVSFSTLPRDLSQQIFNELVKSQRLTDVSLEAFRDCALQDLYLGDYPGVN  120

Query  526  DTWMDVI  546
            + WMDVI
Sbjct  121  ENWMDVI  127



>gb|KJB70657.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
 gb|KJB70658.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
 gb|KJB70661.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
Length=578

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG  CSRKRDQL   D   RGVSGRYCKSGSSKWL ++LSR  ++ +     CPSL+ELC
Sbjct  1    MGAACSRKRDQLDNVDGFDRGVSGRYCKSGSSKWLATTLSRPILEIQREKKKCPSLLELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             ++I +DID Y +FS LPRD+SQQIF+ELV SQRLT V LEAFRDCALQDL LG+YP ++
Sbjct  61   THKIREDIDNYVSFSTLPRDLSQQIFNELVKSQRLTDVSLEAFRDCALQDLYLGDYPGVN  120

Query  526  DTWMDVI  546
            + WMDVI
Sbjct  121  ENWMDVI  127



>gb|KJB23677.1| hypothetical protein B456_004G109300 [Gossypium raimondii]
 gb|KJB23680.1| hypothetical protein B456_004G109300 [Gossypium raimondii]
Length=578

 Score =   147 bits (372),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGGVCSRKRDQ   +D + RGVSGRY KSGSSKWL +S SR  +  + G   CPSLMELC
Sbjct  1    MGGVCSRKRDQQVVEDGMRRGVSGRYGKSGSSKWLLTSFSRPMVVHQPGLAICPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DI++YS+F+MLP+DISQQIF++LV S  LT V L+ FRDCAL+D+ LGEYP + 
Sbjct  61   IDKICEDINQYSSFTMLPKDISQQIFNKLVLSHLLTDVFLQKFRDCALEDVWLGEYPGVQ  120

Query  526  DTWMDVISS  552
            D+WMDVIS+
Sbjct  121  DSWMDVIST  129



>gb|KJB70660.1| hypothetical protein B456_011G085800 [Gossypium raimondii]
Length=583

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG  CSRKRDQL   D   RGVSGRYCKSGSSKWL ++LSR  ++ +     CPSL+ELC
Sbjct  1    MGAACSRKRDQLDNVDGFDRGVSGRYCKSGSSKWLATTLSRPILEIQREKKKCPSLLELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             ++I +DID Y +FS LPRD+SQQIF+ELV SQRLT V LEAFRDCALQDL LG+YP ++
Sbjct  61   THKIREDIDNYVSFSTLPRDLSQQIFNELVKSQRLTDVSLEAFRDCALQDLYLGDYPGVN  120

Query  526  DTWMDVI  546
            + WMDVI
Sbjct  121  ENWMDVI  127



>ref|XP_008242881.1| PREDICTED: F-box/LRR-repeat protein 13-like [Prunus mume]
 ref|XP_008242882.1| PREDICTED: F-box/LRR-repeat protein 13-like [Prunus mume]
Length=579

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKR+Q   +D I R VSGR   S       S           G G CPSL+ELC
Sbjct  2    MGGICSRKRNQPVIEDGICRAVSGRRSGSSKWLGPSSLRPTVE-QSSGGAGICPSLLELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +ICQDIDKYS+FSMLPRD+SQQIF+ LV S  LT+V LEAFRDCAL+D+ LGE+P + 
Sbjct  61   ICKICQDIDKYSSFSMLPRDVSQQIFNALVSSHSLTEVSLEAFRDCALEDIGLGEFPDVK  120

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  121  DSWMDVISS  129



>ref|XP_010033984.1| PREDICTED: F-box/LRR-repeat protein 14 [Eucalyptus grandis]
 gb|KCW53869.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=579

 Score =   145 bits (367),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S SRS  D +H  G CPSLM+LC
Sbjct  1    MGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFSRSFSDVQHDRGKCPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V LEAFRDCALQDL+LGEYP +D
Sbjct  61   VQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSLEAFRDCALQDLHLGEYPGVD  120

Query  526  DTWMDVISS  552
            D W+DVISS
Sbjct  121  DKWLDVISS  129



>ref|XP_006416883.1| hypothetical protein EUTSA_v10007169mg [Eutrema salsugineum]
 gb|ESQ35236.1| hypothetical protein EUTSA_v10007169mg [Eutrema salsugineum]
Length=586

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   +D ++RG SG+Y KS SSKWL +SLSRS  D +  NG CPSL+ELC
Sbjct  8    MGGACSRKRDQQQVEDILNRGASGKYSKSSSSKWLATSLSRSGSDVKRRNGECPSLLELC  67

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +D+D+Y+TFS LPRDISQQIFDELV SQR+T   LEAFRDCA+QDL LGEYP ++
Sbjct  68   IRKIQEDVDRYTTFSHLPRDISQQIFDELVYSQRITLKSLEAFRDCAIQDLYLGEYPGVN  127

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  128  DDWMDVISS  136



>ref|XP_002532313.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30065.1| protein binding protein, putative [Ricinus communis]
Length=597

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKR+Q   ++ +  GVSGRY     S     S +R + D + G GNCPSLMELC
Sbjct  1    MGGICSRKRNQQVVEEGVQVGVSGRY-NKSGSSKWLGSFARPAADLQPGRGNCPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            +Y+I +DIDKYSTFSMLPRD+SQQIF+ELV S  LT   LEAFRDCALQD+ LGEYP + 
Sbjct  60   VYKIREDIDKYSTFSMLPRDLSQQIFNELVISHCLTDATLEAFRDCALQDILLGEYPGVK  119

Query  526  DTWMDVISS  552
            D+WMD++SS
Sbjct  120  DSWMDIVSS  128



>ref|NP_563980.2| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AAN13089.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29355.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=585

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +  NG CPSLMELC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRKNGECPSLMELC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  67   VRKIQEDIDRYTKFSDLPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>gb|AAF82144.1|AC034256_8 Contains similarity to F-box protein FBL2 from Homo sapiens gb|AF176518 
and contains multiple Leucine Rich PF|00560 repeats. 
ESTs gb|Z34572, gb|Z34571, gb|AI100681, gb|AI100675, gb|AA395320, 
gb|AI100674, gb|AA651378, gb|AA007067, gb|T46145, 
gb|T22090, gb|AI995016, gb|H36884, gb|AI995066, gb|H37061, gb|T43537 
come from this gene [Arabidopsis thaliana]
Length=568

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +  NG CPSLMELC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRKNGECPSLMELC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  67   VRKIQEDIDRYTKFSDLPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>gb|AAK28636.1|AF360339_1 unknown protein [Arabidopsis thaliana]
Length=585

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +  NG CPSLMELC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRKNGECPSLMELC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  67   VRKIQEDIDRYTKFSDLPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>ref|XP_006600722.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Glycine 
max]
 ref|XP_006600723.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X3 [Glycine 
max]
Length=581

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 6/133 (5%)
 Frame = +1

Query  166  MGGVCSRKRDQLAE--DDSIHRGVSGRYCksgsskwlgsslsrssIDPRH--GNGNCPSL  333
            MGG+CSRKRD+     +D +HRGVSGRYC+SGS+KW+ +   R+   P H  G G CPSL
Sbjct  1    MGGICSRKRDEHEHVVEDELHRGVSGRYCRSGSTKWMRARSLRA--KPNHCAGGGTCPSL  58

Query  334  MELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEY  513
            M+LCI ++ +D  KY++FS+LPRDISQQIF+ELV S  LT++ LEAFRDCALQD++LGEY
Sbjct  59   MDLCINKMREDFHKYNSFSILPRDISQQIFNELVDSHCLTQLSLEAFRDCALQDIDLGEY  118

Query  514  PCLDDTWMDVISS  552
              + D WMDVISS
Sbjct  119  VGVSDDWMDVISS  131



>ref|XP_003549716.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X1 [Glycine 
max]
Length=580

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 6/133 (5%)
 Frame = +1

Query  166  MGGVCSRKRDQLAE--DDSIHRGVSGRYCksgsskwlgsslsrssIDPRH--GNGNCPSL  333
            MGG+CSRKRD+     +D +HRGVSGRYC+SGS+KW+ +   R+   P H  G G CPSL
Sbjct  1    MGGICSRKRDEHEHVVEDELHRGVSGRYCRSGSTKWMRARSLRA--KPNHCAGGGTCPSL  58

Query  334  MELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEY  513
            M+LCI ++ +D  KY++FS+LPRDISQQIF+ELV S  LT++ LEAFRDCALQD++LGEY
Sbjct  59   MDLCINKMREDFHKYNSFSILPRDISQQIFNELVDSHCLTQLSLEAFRDCALQDIDLGEY  118

Query  514  PCLDDTWMDVISS  552
              + D WMDVISS
Sbjct  119  VGVSDDWMDVISS  131



>ref|XP_008228736.1| PREDICTED: F-box/LRR-repeat protein 14 [Prunus mume]
Length=577

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD   ++   H GVS RYCKSGSSKWL +S +R  +D + G G  PSLM+LC
Sbjct  1    MGGACSRKRDHRDDEHDFHLGVSRRYCKSGSSKWLTTSFTRPVLDIQPGRG--PSLMDLC  58

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DIDKY+TFSMLPRDISQQI +ELV S  LT V  E FRDCALQDL LGEYP ++
Sbjct  59   IRKICEDIDKYNTFSMLPRDISQQIINELVYSGCLTDVSFEGFRDCALQDLYLGEYPGVN  118

Query  526  DTWMDVI  546
            D+WMDVI
Sbjct  119  DSWMDVI  125



>gb|KHN15024.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=584

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 6/133 (5%)
 Frame = +1

Query  166  MGGVCSRKRDQLAE--DDSIHRGVSGRYCksgsskwlgsslsrssIDPRH--GNGNCPSL  333
            MGG+CSRKRD+     +D +HRGVSGRYC+SGS+KW+ +   R+   P H  G G CPSL
Sbjct  1    MGGICSRKRDEHEHVVEDELHRGVSGRYCRSGSTKWMRARSLRA--KPNHCAGGGTCPSL  58

Query  334  MELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEY  513
            M+LCI ++ +D  KY++FS+LPRDISQQIF+ELV S  LT++ LEAFRDCALQD++LGEY
Sbjct  59   MDLCINKMREDFHKYNSFSILPRDISQQIFNELVDSHCLTQLSLEAFRDCALQDIDLGEY  118

Query  514  PCLDDTWMDVISS  552
              + D WMDVISS
Sbjct  119  VGVSDDWMDVISS  131



>ref|XP_004303269.1| PREDICTED: F-box/LRR-repeat protein 13 [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKR+   ++D+  RG++ RY KSGSSKWL +S SR + D +H  G CPSLM+LC
Sbjct  1    MGGACSRKRNHRDDEDNFPRGITRRYSKSGSSKWLATSFSRPAADIQHDKGQCPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
             ++IC+DIDKYSTFS LPRDISQ I +ELV S  LT V  E FRDCALQDL LGEYP ++
Sbjct  61   AWKICEDIDKYSTFSKLPRDISQHIINELVYSGCLTDVSFEGFRDCALQDLYLGEYPNVN  120

Query  526  DTWMDVI  546
            D WMDVI
Sbjct  121  DAWMDVI  127



>ref|XP_010906010.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X2 [Elaeis guineensis]
Length=528

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG CSRKRD + E D+  R  SGRY KSGSS+WL  SLSRS  D  R G G CPSLMEL
Sbjct  1    MGGACSRKRDLVDESDT--RTTSGRYSKSGSSRWLLFSLSRSGADVARRGQGKCPSLMEL  58

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            C+ ++ +DI+KYS+FSMLPRDISQQIFDELV S+ LT V L+AF DCALQD++LGEYP +
Sbjct  59   CVAKVREDINKYSSFSMLPRDISQQIFDELVESRCLTDVSLKAFHDCALQDIHLGEYPGV  118

Query  523  DDTWMDVISS  552
             D WM +ISS
Sbjct  119  KDNWMGIISS  128



>ref|XP_004506962.1| PREDICTED: internalin-A-like isoform X1 [Cicer arietinum]
Length=588

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  157  VSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLM  336
            +S MGG CSRK+++   +D + RG S ++CK GS KW  SS S SS+D R   G CPSL+
Sbjct  9    ISSMGGACSRKQER-NNEDGLCRGFSRKFCKCGSLKWWTSSFSYSSMDLRIQKGECPSLL  67

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            +LCI +I +D+D+++TFSMLPRDISQQIF+ LV SQRLT+  LE FRDCALQDL LGEY 
Sbjct  68   DLCIQKISEDLDRHNTFSMLPRDISQQIFNNLVYSQRLTRGSLETFRDCALQDLYLGEYA  127

Query  517  CLDDTWMDVISS  552
             +DD+WMDVISS
Sbjct  128  GVDDSWMDVISS  139



>ref|XP_010906009.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Elaeis guineensis]
Length=577

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG CSRKRD + E D+  R  SGRY KSGSS+WL  SLSRS  D  R G G CPSLMEL
Sbjct  1    MGGACSRKRDLVDESDT--RTTSGRYSKSGSSRWLLFSLSRSGADVARRGQGKCPSLMEL  58

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            C+ ++ +DI+KYS+FSMLPRDISQQIFDELV S+ LT V L+AF DCALQD++LGEYP +
Sbjct  59   CVAKVREDINKYSSFSMLPRDISQQIFDELVESRCLTDVSLKAFHDCALQDIHLGEYPGV  118

Query  523  DDTWMDVISS  552
             D WM +ISS
Sbjct  119  KDNWMGIISS  128



>ref|XP_008801889.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Phoenix dactylifera]
 ref|XP_008801890.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X1 [Phoenix dactylifera]
Length=577

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG CSRKRD + E D+  R  SGRY KSGSSKWL  SL R  +D  R G G CPSLMEL
Sbjct  1    MGGACSRKRDLVDESDT--RTTSGRYSKSGSSKWLLFSLPRCVVDVARRGQGKCPSLMEL  58

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            C+ +I +DI+KYS+F+MLPRDISQQIFDELV S+ LT V L+AF+DCALQD++LGEYP +
Sbjct  59   CVAKIREDINKYSSFAMLPRDISQQIFDELVESRCLTDVSLKAFQDCALQDIHLGEYPGV  118

Query  523  DDTWMDVISS  552
             D WM +ISS
Sbjct  119  KDNWMGIISS  128



>ref|XP_008801891.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X2 [Phoenix dactylifera]
Length=473

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGNCPSLMEL  342
            MGG CSRKRD + E D+  R  SGRY KSGSSKWL  SL R  +D  R G G CPSLMEL
Sbjct  1    MGGACSRKRDLVDESDT--RTTSGRYSKSGSSKWLLFSLPRCVVDVARRGQGKCPSLMEL  58

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            C+ +I +DI+KYS+F+MLPRDISQQIFDELV S+ LT V L+AF+DCALQD++LGEYP +
Sbjct  59   CVAKIREDINKYSSFAMLPRDISQQIFDELVESRCLTDVSLKAFQDCALQDIHLGEYPGV  118

Query  523  DDTWMDVISS  552
             D WM +ISS
Sbjct  119  KDNWMGIISS  128



>gb|KEH28673.1| F-box/LRR protein, putative [Medicago truncatula]
Length=181

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRK+++  ED  + RG S +YCK GS KW  SS S  S+D R   G CPSL++LC
Sbjct  1    MGGACSRKQERDNED-ILTRGFSRKYCKCGSLKWWTSSFSYPSMDLRTQKGECPSLLDLC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +D+D+++TFSMLPRDISQQI + LV S+RLT   LEAFRDCALQDL LGEY  +D
Sbjct  60   VQKISEDLDRHNTFSMLPRDISQQILNNLVYSRRLTGDSLEAFRDCALQDLYLGEYAGVD  119

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  120  DSWMDVISS  128



>ref|XP_010476663.1| PREDICTED: F-box/LRR-repeat protein 2-like isoform X2 [Camelina 
sativa]
Length=561

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +   G CPSLM+LC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRNRGGCPSLMDLC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  67   VRKIQEDIDRYTKFSDLPRDISQQIFDELVFSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>ref|XP_010497352.1| PREDICTED: F-box/LRR-repeat protein 2-like isoform X2 [Camelina 
sativa]
Length=561

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +  +G CPSLM+LC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRNHGGCPSLMDLC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  67   LRKIQEDIDRYTKFSDLPRDISQQIFDELVFSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>ref|XP_010497346.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Camelina 
sativa]
Length=585

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +  +G CPSLM+LC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRNHGGCPSLMDLC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  67   LRKIQEDIDRYTKFSDLPRDISQQIFDELVFSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>ref|XP_010459109.1| PREDICTED: F-box/LRR-repeat protein 14-like [Camelina sativa]
Length=586

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +  +G CPSLM+LC
Sbjct  9    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRNHGGCPSLMDLC  67

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  68   LRKIQEDIDRYTKFSDLPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  127

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  128  DDWMDVISS  136



>ref|XP_010476662.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Camelina 
sativa]
Length=585

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +   G CPSLM+LC
Sbjct  8    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRNRGGCPSLMDLC  66

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +DID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  67   VRKIQEDIDRYTKFSDLPRDISQQIFDELVFSQRLTLKSLEAFRDCAIQDLYLGEYPGVN  126

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  127  DDWMDVISS  135



>ref|XP_002890123.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66382.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=578

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ  ED  ++RGVSG+Y KS SSKWL +SLSRS  D +  NG CPSLMELC
Sbjct  1    MGGACSRKRDQQVED-ILNRGVSGKYSKSSSSKWLATSLSRSGSDVKRKNGECPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I + ID+Y+ FS LPRDISQQIFDELV SQRLT   LEAFRDCA+QDL LGEYP ++
Sbjct  60   IRKIQEVIDRYTKFSDLPRDISQQIFDELVYSQRLTLKSLEAFRDCAIQDLCLGEYPGVN  119

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  120  DDWMDVISS  128



>gb|KDP30209.1| hypothetical protein JCGZ_16991 [Jatropha curcas]
Length=577

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKRDQ A +  +  GV GRY KSGSSKWLG+SL+R   D + G G+CPSLMELC
Sbjct  1    MGGICSRKRDQQAIEVGVRSGVFGRYSKSGSSKWLGNSLARHVTDLQPG-GSCPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +DIDKYS+FS+LPRDISQQI +ELV S+ LT   LE FRDCALQD+ L EYP + 
Sbjct  60   IRKIREDIDKYSSFSILPRDISQQILNELVLSRCLTDASLETFRDCALQDVLLTEYPGVK  119

Query  526  DTWMDVISS  552
            D+WMDV+SS
Sbjct  120  DSWMDVVSS  128



>ref|NP_001047418.1| Os02g0613200 [Oryza sativa Japonica Group]
 dbj|BAD19701.1| leucine-rich repeat-like protein [Oryza sativa Japonica Group]
 dbj|BAF09332.1| Os02g0613200 [Oryza sativa Japonica Group]
 gb|EAZ23798.1| hypothetical protein OsJ_07510 [Oryza sativa Japonica Group]
 dbj|BAG93840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=582

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 8/135 (6%)
 Frame = +1

Query  166  MGGVCSRKRDQLA-EDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH-----GNGNCP  327
            MG VCSRKR QL  EDDS     S R+ K+ S KWL  +L RS+ D        G G CP
Sbjct  1    MGAVCSRKRSQLVHEDDSFQ--TSSRFSKTSSLKWLLLTLPRSNSDVSRKGQGKGPGRCP  58

Query  328  SLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLG  507
            SLMELC+ + C+DI+KYS+FS+LPRD+SQQIF+ELV S RLT+ +LE FRDCALQD++LG
Sbjct  59   SLMELCVAKACEDINKYSSFSVLPRDLSQQIFNELVASNRLTETLLETFRDCALQDIDLG  118

Query  508  EYPCLDDTWMDVISS  552
            EYP ++D WM+V++S
Sbjct  119  EYPGVNDAWMEVVAS  133



>ref|XP_011020241.1| PREDICTED: F-box/LRR-repeat protein 14 [Populus euphratica]
 ref|XP_011020242.1| PREDICTED: F-box/LRR-repeat protein 14 [Populus euphratica]
Length=588

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKRDQ   +  + RGVSG Y KS SSKWLG++ +R + D + G  + PSL+ELC
Sbjct  13   MGGICSRKRDQQVFEGRVRRGVSGNYSKSSSSKWLGTTFARPNADLQPG-CSFPSLLELC  71

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            IY+I +DI +Y +FSMLPRDISQQIF+ELV S  LT   LEAFRDCALQD+ LGEYP + 
Sbjct  72   IYRIREDISRYKSFSMLPRDISQQIFNELVISHCLTAASLEAFRDCALQDVLLGEYPGVM  131

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  132  DSWMDVISS  140



>ref|XP_002308980.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE92503.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=588

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKRDQ   +  + RGVSG Y KS SSKWLG++ +R + D + G  + PSL+ELC
Sbjct  13   MGGICSRKRDQQVLEGRVRRGVSGNYSKSSSSKWLGTTFARPNADLQPG-CSFPSLLELC  71

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            IY+I +DI +Y ++SMLPRD+SQQIF+ELV S  LT   LEAFRDCALQD+ LGEYP + 
Sbjct  72   IYRIREDISRYKSYSMLPRDLSQQIFNELVISHSLTAASLEAFRDCALQDVLLGEYPGVM  131

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  132  DSWMDVISS  140



>ref|XP_004508415.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Cicer 
arietinum]
Length=468

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKRDQ   +D + RGVSGRYC+S S+KWLGS   RS  +   G G CPSLM+LC
Sbjct  1    MGGICSRKRDQQVIEDDLRRGVSGRYCRSASTKWLGSRSLRSKANHCPGGGTCPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I ++ +D  KY +FS+LPRDISQ IF+ELV S  LT+  L AFRDCALQD+ LGEY  + 
Sbjct  61   INKMREDFHKYDSFSILPRDISQLIFNELVDSHCLTETSLNAFRDCALQDVYLGEYVEVH  120

Query  526  DTWMDVISS  552
            D WMDVI+S
Sbjct  121  DGWMDVIAS  129



>ref|XP_004508414.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Cicer 
arietinum]
Length=581

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKRDQ   +D + RGVSGRYC+S S+KWLGS   RS  +   G G CPSLM+LC
Sbjct  1    MGGICSRKRDQQVIEDDLRRGVSGRYCRSASTKWLGSRSLRSKANHCPGGGTCPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I ++ +D  KY +FS+LPRDISQ IF+ELV S  LT+  L AFRDCALQD+ LGEY  + 
Sbjct  61   INKMREDFHKYDSFSILPRDISQLIFNELVDSHCLTETSLNAFRDCALQDVYLGEYVEVH  120

Query  526  DTWMDVISS  552
            D WMDVI+S
Sbjct  121  DGWMDVIAS  129



>ref|NP_001147302.1| regulatory subunit [Zea mays]
 ref|XP_008643583.1| PREDICTED: regulatory subunit isoform X1 [Zea mays]
 ref|XP_008643584.1| PREDICTED: regulatory subunit isoform X1 [Zea mays]
 gb|ACG26679.1| regulatory subunit [Zea mays]
 gb|AFW72318.1| regulatory subunit isoform 1 [Zea mays]
 gb|AFW72319.1| regulatory subunit isoform 2 [Zea mays]
Length=582

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 8/135 (6%)
 Frame = +1

Query  166  MGGVCSRKRDQLA-EDDSIHRGVSGRYCksgsskwlgsslsrssID---PRHGN--GNCP  327
            MGGVCSRKR QL  E D++    S R+ K+ S KWL  +L RSS D      GN  G CP
Sbjct  1    MGGVCSRKRSQLVDEGDALQ--TSPRFSKTSSLKWLLLTLPRSSSDVSGKGQGNEPGRCP  58

Query  328  SLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLG  507
            SLMELC+ ++CQDID+YSTF+MLPRD+SQQIF+ELV S RLT+  L+ FRDCALQD+ LG
Sbjct  59   SLMELCVARVCQDIDRYSTFAMLPRDLSQQIFNELVNSNRLTEASLQVFRDCALQDIGLG  118

Query  508  EYPCLDDTWMDVISS  552
            EYP + D WM+V++S
Sbjct  119  EYPGVKDAWMEVVAS  133



>ref|XP_006647506.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647507.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Oryza 
brachyantha]
Length=582

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 8/135 (6%)
 Frame = +1

Query  166  MGGVCSRKRDQLA-EDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGN----CP  327
            MGGVCSRKR QL  EDDS     S R+ K+ S KWL  +L RS+ D  R G G     CP
Sbjct  1    MGGVCSRKRSQLVHEDDSFQ--TSTRFSKTSSLKWLLLTLPRSNSDLSRKGQGKGPGRCP  58

Query  328  SLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLG  507
            SLMELC+ + C+DI+KYS+FS+LPRD+SQQIF++LV S RLT+ +LE FRDCALQD+ LG
Sbjct  59   SLMELCVAKACEDINKYSSFSVLPRDLSQQIFNQLVESNRLTETLLETFRDCALQDIYLG  118

Query  508  EYPCLDDTWMDVISS  552
            EYP ++D WM+V++S
Sbjct  119  EYPGVNDAWMEVVAS  133



>ref|XP_006852826.1| hypothetical protein AMTR_s00033p00180120 [Amborella trichopoda]
 gb|ERN14293.1| hypothetical protein AMTR_s00033p00180120 [Amborella trichopoda]
Length=578

 Score =   137 bits (345),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 77/129 (60%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG  CSRKRDQL  +D I RG+SG++ K+ SS+WLGSS++R+SID     G  PSLMELC
Sbjct  1    MGSACSRKRDQLVNEDDIRRGISGKFSKNLSSRWLGSSMNRTSIDIHQEIGKVPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC++I  Y +FS+LPRD+SQQIF+ELV SQ L  V LEAF+DCALQD+ LG+YP + 
Sbjct  61   IRKICEEIKGYKSFSILPRDLSQQIFNELVNSQGLNDVSLEAFQDCALQDVFLGDYPGVK  120

Query  526  DTWMDVISS  552
            D+W+  I+S
Sbjct  121  DSWIRTIAS  129



>ref|XP_003609481.1| F-box/LRR-repeat protein [Medicago truncatula]
 gb|AES91678.1| F-box/LRR-like protein [Medicago truncatula]
Length=576

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 2/129 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+CSRKR+Q   +D I RGVS RYC+SGS+KWLG+   +++  P  G G CPSLM+LC
Sbjct  1    MGGICSRKRNQQVIEDDIRRGVSRRYCRSGSTKWLGARSFKANHSP--GGGTCPSLMDLC  58

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +D  KY +FS+LPRDISQ IF+ELV S  LT+  L AFRDCALQD+ LGEY  ++
Sbjct  59   INKIREDFHKYESFSILPRDISQLIFNELVESHCLTETSLNAFRDCALQDVYLGEYLGVN  118

Query  526  DTWMDVISS  552
            D WMDVI+S
Sbjct  119  DGWMDVIAS  127



>gb|AFW72317.1| hypothetical protein ZEAMMB73_434085 [Zea mays]
Length=403

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 8/135 (6%)
 Frame = +1

Query  166  MGGVCSRKRDQLA-EDDSIHRGVSGRYCksgsskwlgsslsrssID---PRHGN--GNCP  327
            MGGVCSRKR QL  E D++    S R+ K+ S KWL  +L RSS D      GN  G CP
Sbjct  1    MGGVCSRKRSQLVDEGDALQ--TSPRFSKTSSLKWLLLTLPRSSSDVSGKGQGNEPGRCP  58

Query  328  SLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLG  507
            SLMELC+ ++CQDID+YSTF+MLPRD+SQQIF+ELV S RLT+  L+ FRDCALQD+ LG
Sbjct  59   SLMELCVARVCQDIDRYSTFAMLPRDLSQQIFNELVNSNRLTEASLQVFRDCALQDIGLG  118

Query  508  EYPCLDDTWMDVISS  552
            EYP + D WM+V++S
Sbjct  119  EYPGVKDAWMEVVAS  133



>ref|XP_007135773.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
 ref|XP_007135774.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
 gb|ESW07767.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
 gb|ESW07768.1| hypothetical protein PHAVU_010G157600g [Phaseolus vulgaris]
Length=577

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKR+Q   +DS+ RG+S RYCK GS KW  SS S  S++     G CP L++LC
Sbjct  1    MGGACSRKREQ-DNEDSLIRGLSRRYCKCGSLKWWTSSFSYPSVNFHLQKGECPPLLDLC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +DIDKY++FSMLPRDISQ IF+ LV S+RLT   LEAFRDCALQDL LGEY  ++
Sbjct  60   IQKINEDIDKYTSFSMLPRDISQLIFNNLVYSRRLTSASLEAFRDCALQDLYLGEYDGVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DDWMGVISS  128



>gb|EAY86666.1| hypothetical protein OsI_08050 [Oryza sativa Indica Group]
Length=582

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 99/135 (73%), Gaps = 8/135 (6%)
 Frame = +1

Query  166  MGGVCSRKRDQLA-EDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH-----GNGNCP  327
            MG VCSRKR QL  EDDS     S R+ K+ S KWL  +L RS+ D        G G CP
Sbjct  1    MGAVCSRKRSQLVHEDDSFQ--TSSRFSKTSSLKWLLLTLPRSNSDVSRKGQGKGPGRCP  58

Query  328  SLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLG  507
            SLMELC+ + C+DI+KYS+FS+LPRD+SQQIF+ELV S RLT+ +LE F DCALQD++LG
Sbjct  59   SLMELCVAKACEDINKYSSFSVLPRDLSQQIFNELVASNRLTETLLETFWDCALQDIDLG  118

Query  508  EYPCLDDTWMDVISS  552
            EYP ++D WM+V++S
Sbjct  119  EYPGVNDAWMEVVAS  133



>ref|XP_003604348.1| F-box/LRR-repeat protein [Medicago truncatula]
Length=573

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRK+++   +D + RG S +YCK GS KW  SS S  S+D R   G CPSL++LC
Sbjct  1    MGGACSRKQER-DNEDILTRGFSRKYCKCGSLKWWTSSFSYPSMDLRTQKGECPSLLDLC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +D+D+++TFSMLPRDISQQI + LV S+RLT   LEAFRDCALQDL LGEY  +D
Sbjct  60   VQKISEDLDRHNTFSMLPRDISQQILNNLVYSRRLTGDSLEAFRDCALQDLYLGEYAGVD  119

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  120  DSWMDVISS  128



>gb|AFK38491.1| unknown [Medicago truncatula]
Length=577

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRK+++   +D + RG S +YCK GS KW  SS S  S+D R   G CPSL++LC
Sbjct  1    MGGACSRKQER-DNEDILTRGFSRKYCKCGSLKWWTSSFSYPSMDLRTQKGECPSLLDLC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +D+D+++TFSMLPRDISQQI + LV S+RLT   LEAFRDCALQDL LGEY  +D
Sbjct  60   VQKISEDLDRHNTFSMLPRDISQQILNNLVYSRRLTGDSLEAFRDCALQDLYLGEYAGVD  119

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  120  DSWMDVISS  128



>ref|XP_003599715.1| F-box/LRR-repeat protein [Medicago truncatula]
Length=585

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRK+++   +D + RG S +YCK GS KW  SS S  S+D R   G CPSL++LC
Sbjct  1    MGGACSRKQER-DNEDILTRGFSRKYCKCGSLKWWTSSFSYPSMDLRTQKGECPSLLDLC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +I +D+D+++TFSMLPRDISQQI + LV S+RLT   LEAFRDCALQDL LGEY  +D
Sbjct  60   VQKISEDLDRHNTFSMLPRDISQQILNNLVYSRRLTGDSLEAFRDCALQDLYLGEYAGVD  119

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  120  DSWMDVISS  128



>ref|XP_008813122.1| PREDICTED: F-box/LRR-repeat protein 14-like [Phoenix dactylifera]
 ref|XP_008813123.1| PREDICTED: F-box/LRR-repeat protein 14-like [Phoenix dactylifera]
Length=577

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH-GNGNCPSLMEL  342
            MGG CSRK+D   +D+S  R  SGR  KSGSSKWL  +L   SID R  G G CPSL+EL
Sbjct  1    MGGACSRKKD--LDDESDTRRTSGRCSKSGSSKWLLFTLPHCSIDARRRGEGKCPSLLEL  58

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI + C+DIDKY +FSMLPRDISQQI DELV S  LT V LEAFRDCALQD++L EY  +
Sbjct  59   CIAKSCEDIDKYGSFSMLPRDISQQILDELVESHCLTDVSLEAFRDCALQDIHLEEYSGV  118

Query  523  DDTWMDVISS  552
             D+WMDVISS
Sbjct  119  KDSWMDVISS  128



>gb|KHN01311.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=577

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRK+++    DS  RG+S RYCKSG+ KW  SS S  S+D     G CP L++LC
Sbjct  1    MGGACSRKQER-DNKDSPTRGLSRRYCKSGTLKWWTSSFSYPSVDFHLRKGECPPLLDLC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +DIDKY+TFSMLPRDISQ IF+ LV S+RLT   LEAFRDCALQDL LGEY  ++
Sbjct  60   IQKINEDIDKYNTFSMLPRDISQLIFNNLVYSRRLTSASLEAFRDCALQDLYLGEYDGVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DNWMGVISS  128



>ref|XP_007155092.1| hypothetical protein PHAVU_003G172400g [Phaseolus vulgaris]
 gb|ESW27086.1| hypothetical protein PHAVU_003G172400g [Phaseolus vulgaris]
Length=571

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 91/129 (71%), Gaps = 7/129 (5%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG+ SRKRDQ   +D + RG+SGRY +SG +    S       +   G G CPSLM+LC
Sbjct  1    MGGISSRKRDQHVVEDDLQRGISGRYFRSGRNLRSKS-------NQCPGRGTCPSLMDLC  53

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +D  KY++FS+LPRDISQQIF+E V S  LT+  LEAFRDCALQD++LGEY  + 
Sbjct  54   INRIREDFHKYNSFSILPRDISQQIFNEFVDSHCLTEASLEAFRDCALQDIDLGEYGGVH  113

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  114  DNWMDVISS  122



>ref|XP_003528299.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoformX1 [Glycine max]
 ref|XP_006583115.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X3 [Glycine max]
 ref|XP_006583116.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X4 [Glycine max]
 ref|XP_006583117.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X5 [Glycine max]
Length=577

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRK+++    DS  RG+S RYCKSG+ KW  SS S  S+D     G CP L++LC
Sbjct  1    MGGACSRKQER-DNKDSPTRGLSRRYCKSGTLKWWTSSFSYPSVDFHLRKGECPPLLDLC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +I +DIDKY+TFSMLPRDISQ IF+ LV S+RLT   LEAFRDCALQDL LGEY  ++
Sbjct  60   IQKINEDIDKYNTFSMLPRDISQLIFNNLVYSRRLTSASLEAFRDCALQDLYLGEYDGVN  119

Query  526  DTWMDVISS  552
            D WM VISS
Sbjct  120  DNWMGVISS  128



>ref|XP_006583114.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains 
protein 1-like isoform X2 [Glycine max]
Length=658

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +1

Query  163  QMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMEL  342
            +MGG CSRK+++    DS  RG+S RYCKSG+ KW  SS S  S+D     G CP L++L
Sbjct  81   RMGGACSRKQER-DNKDSPTRGLSRRYCKSGTLKWWTSSFSYPSVDFHLRKGECPPLLDL  139

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI +I +DIDKY+TFSMLPRDISQ IF+ LV S+RLT   LEAFRDCALQDL LGEY  +
Sbjct  140  CIQKINEDIDKYNTFSMLPRDISQLIFNNLVYSRRLTSASLEAFRDCALQDLYLGEYDGV  199

Query  523  DDTWMDVISS  552
            +D WM VISS
Sbjct  200  NDNWMGVISS  209



>ref|XP_010687833.1| PREDICTED: F-box/LRR-repeat protein 14 [Beta vulgaris subsp. 
vulgaris]
Length=579

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDP-RHGNGNCPSLMEL  342
            MGGVCSRKR     +D +  GV+ RYCK+GSSKWL  +    +    +  + +CPSLMEL
Sbjct  1    MGGVCSRKRGNQVNEDGVRVGVNRRYCKNGSSKWLQGTPFFRTTSGCQPEDVSCPSLMEL  60

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI++  QDIDKYS+FS+LPRDISQQIFDELV S  LT+  LEAFRDCALQD+ LG+Y  +
Sbjct  61   CIHKARQDIDKYSSFSVLPRDISQQIFDELVLSNCLTETSLEAFRDCALQDIYLGDYLGV  120

Query  523  DDTWMDVISS  552
            DD W+DVISS
Sbjct  121  DDGWIDVISS  130



>ref|XP_009348314.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009348319.1| PREDICTED: F-box/LRR-repeat protein 13-like isoform X2 [Pyrus 
x bretschneideri]
Length=580

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD   +     RG S RY KSGSSKWL +S +R  +D + G  N PSLM+LC
Sbjct  1    MGGACSRKRDHQDDVYDFQRGFSRRYAKSGSSKWLATSFTRPVLDIQPGTRNGPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +IC+DI+K++TFSMLPRDISQQI +ELV S  LT V  E FRDCALQDL LGE P ++
Sbjct  61   VRKICKDINKFNTFSMLPRDISQQIINELVYSGCLTDVSFEGFRDCALQDLYLGECPGVN  120

Query  526  DTWMDVI  546
            D+WMDVI
Sbjct  121  DSWMDVI  127



>ref|XP_009348313.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009348318.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Pyrus 
x bretschneideri]
Length=583

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD   +     RG S RY KSGSSKWL +S +R  +D + G  N PSLM+LC
Sbjct  1    MGGACSRKRDHQDDVYDFQRGFSRRYAKSGSSKWLATSFTRPVLDIQPGTRNGPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +IC+DI+K++TFSMLPRDISQQI +ELV S  LT V  E FRDCALQDL LGE P ++
Sbjct  61   VRKICKDINKFNTFSMLPRDISQQIINELVYSGCLTDVSFEGFRDCALQDLYLGECPGVN  120

Query  526  DTWMDVI  546
            D+WMDVI
Sbjct  121  DSWMDVI  127



>gb|KHN38005.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=674

 Score =   132 bits (332),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  157  VSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLM  336
            V+ MGG CSRK+ +   +DS+ RG+  RYCK GS KW  SS S  S+D     G CPSL+
Sbjct  76   VAYMGGACSRKQ-EWDNEDSLIRGLPRRYCKCGSLKWWTSSFSYPSVDFHLRKGECPSLL  134

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            +LCI +I +DIDKY+TFSMLPRDISQ IF+ LV S+ LT   LEAFRDCALQDL LGEY 
Sbjct  135  DLCIQKINEDIDKYNTFSMLPRDISQLIFNNLVYSRCLTSASLEAFRDCALQDLYLGEYD  194

Query  517  CLDDTWMDVISS  552
             ++D WM VISS
Sbjct  195  GVNDNWMGVISS  206



>dbj|BAJ98524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=583

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 93/134 (69%), Gaps = 5/134 (4%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-PRHGNGN----CPS  330
            MGGVCSRKR QL E+D        R+ K+ S KWL  +L RSS D  R G G     CP+
Sbjct  1    MGGVCSRKRSQLVEEDDDSLQTPTRFSKTSSLKWLLLTLPRSSSDVSRKGQGKYPDRCPT  60

Query  331  LMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGE  510
            LM LC+ ++C+DI KYST +MLP DISQQIFDELV S RLT+  LE FRDCAL D+ LGE
Sbjct  61   LMNLCVAKVCKDISKYSTLAMLPSDISQQIFDELVGSNRLTEESLETFRDCALHDICLGE  120

Query  511  YPCLDDTWMDVISS  552
            YP + D WM+V++S
Sbjct  121  YPGVTDAWMEVVAS  134



>ref|XP_009338496.1| PREDICTED: F-box/LRR-repeat protein 13-like [Pyrus x bretschneideri]
Length=580

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD   +     RG S RY KSGSSKWL +S +R  +D + G  N PSLM+LC
Sbjct  1    MGGACSRKRDHQDDVYDFQRGFSRRYAKSGSSKWLATSFTRPVLDIQPGTRNGPSLMDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +IC+DI+K++TFSMLPRDISQQI +ELV S  L  V  E FRDCALQDL LGE P ++
Sbjct  61   VRKICKDINKFNTFSMLPRDISQQIINELVYSGCLADVSFEGFRDCALQDLYLGECPGVN  120

Query  526  DTWMDVI  546
            D+WMDVI
Sbjct  121  DSWMDVI  127



>ref|XP_004506963.1| PREDICTED: internalin-A-like isoform X2 [Cicer arietinum]
Length=573

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  181  SRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELCIYQIC  360
            SRK+++   +D + RG S ++CK GS KW  SS S SS+D R   G CPSL++LCI +I 
Sbjct  2    SRKQER-NNEDGLCRGFSRKFCKCGSLKWWTSSFSYSSMDLRIQKGECPSLLDLCIQKIS  60

Query  361  QDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMD  540
            +D+D+++TFSMLPRDISQQIF+ LV SQRLT+  LE FRDCALQDL LGEY  +DD+WMD
Sbjct  61   EDLDRHNTFSMLPRDISQQIFNNLVYSQRLTRGSLETFRDCALQDLYLGEYAGVDDSWMD  120

Query  541  VISS  552
            VISS
Sbjct  121  VISS  124



>ref|XP_010110472.1| hypothetical protein L484_005452 [Morus notabilis]
 gb|EXC26520.1| hypothetical protein L484_005452 [Morus notabilis]
Length=564

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 91/115 (79%), Gaps = 1/115 (1%)
 Frame = +1

Query  208  DDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELCIYQICQDIDKYSTF  387
            +D++ R  S RYCKSGSSKWLG+S   + ID + G GNCPSL++LCI  +C+DI +YS+F
Sbjct  2    EDAVPRETSARYCKSGSSKWLGASCRPA-IDCQSGGGNCPSLLDLCIQSVCKDIGRYSSF  60

Query  388  SMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            SMLPRD+SQQIF+ELV S  LT V  EAFRDCALQD+ L EYPC+ D+WMD ISS
Sbjct  61   SMLPRDVSQQIFNELVYSNCLTDVSFEAFRDCALQDVCLVEYPCVKDSWMDAISS  115



>gb|EPS69100.1| hypothetical protein M569_05667, partial [Genlisea aurea]
Length=575

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = +1

Query  166  MGGVCSRKRDQL-AEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMEL  342
            MGGVCSRKRDQ    +++++R VSGRY        L  S     +D   G    PSL++L
Sbjct  1    MGGVCSRKRDQQQVNEETLNRRVSGRYISKCLGSSLNVSS----LDASQGKQCIPSLIDL  56

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI++I +DIDKY++F+MLPRD+ Q IF++LVCS  LT  + EAFR+C+LQDLNL +YP +
Sbjct  57   CIHKIQKDIDKYASFTMLPRDMIQLIFNDLVCSLCLTNSLFEAFRECSLQDLNLSDYPGV  116

Query  523  DDTWMDVISS  552
            +D WMDV+ S
Sbjct  117  NDRWMDVVVS  126



>ref|XP_004953091.1| PREDICTED: putative adenylate cyclase regulatory protein-like 
isoform X1 [Setaria italica]
 ref|XP_004953092.1| PREDICTED: putative adenylate cyclase regulatory protein-like 
isoform X2 [Setaria italica]
Length=582

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 98/135 (73%), Gaps = 8/135 (6%)
 Frame = +1

Query  166  MGGVCSRKRDQLA-EDDSIHRGVSGRYCksgsskwlgsslsrssIDPR-----HGNGNCP  327
            MGGVCSRKR QL  E DS+    S R+ K+ S KWL  SL R++ D        G G CP
Sbjct  1    MGGVCSRKRSQLVDEGDSLQ--TSPRFSKTSSLKWLLLSLPRTNSDVSRKGQGEGPGRCP  58

Query  328  SLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLG  507
            SLM+LC+ ++C+DIDKYSTF+MLPRD+SQQIF++LV S  LT+  L+ FRDCALQD+ LG
Sbjct  59   SLMDLCVARVCKDIDKYSTFTMLPRDLSQQIFNKLVESNCLTEASLQTFRDCALQDICLG  118

Query  508  EYPCLDDTWMDVISS  552
            EYP + D WM+V++S
Sbjct  119  EYPGVKDAWMEVVAS  133



>ref|XP_009401378.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401379.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401381.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401382.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401383.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401384.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=576

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHG-NGNCPSLMEL  342
            MGG CSRKRD L EDD + R  SGRY KSGSSKWL   L R S D   G  G CPSLMEL
Sbjct  1    MGGACSRKRDLLDEDD-LRR--SGRYSKSGSSKWLLLMLPRCSTDVTAGRQGKCPSLMEL  57

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            C+ ++ +DI +Y++FSMLPRD+SQQIF+ELV S  LT   LEAF DCALQD++LGEYP +
Sbjct  58   CVAKVREDIKRYTSFSMLPRDLSQQIFNELVESHCLTDGSLEAFWDCALQDIHLGEYPGV  117

Query  523  DDTWMDVISS  552
             D WM ++SS
Sbjct  118  KDGWMGIVSS  127



>ref|XP_009403193.1| PREDICTED: F-box/LRR-repeat protein 14 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403194.1| PREDICTED: F-box/LRR-repeat protein 14 [Musa acuminata subsp. 
malaccensis]
Length=576

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPR-HGNGNCPSLMEL  342
            MGG CSRKR+ L EDD + R  SGR+ K+GSSKWL  SL R S D      G CPSLMEL
Sbjct  1    MGGACSRKRNVLDEDD-LRR--SGRFSKTGSSKWLLFSLPRCSTDVTVRRQGKCPSLMEL  57

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            C+ +I +DI KYS+FSMLPRDISQQIF+ELV S  LT V L AF+DCALQD++LGEYP +
Sbjct  58   CVAKIREDIKKYSSFSMLPRDISQQIFNELVESHGLTDVSLAAFQDCALQDIHLGEYPGV  117

Query  523  DDTWMDVISS  552
             D+W+  +SS
Sbjct  118  KDSWLSTVSS  127



>ref|XP_009401377.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=627

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHG-NGNCPSLMEL  342
            MGG CSRKRD L EDD + R  SGRY KSGSSKWL   L R S D   G  G CPSLMEL
Sbjct  1    MGGACSRKRDLLDEDD-LRR--SGRYSKSGSSKWLLLMLPRCSTDVTAGRQGKCPSLMEL  57

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            C+ ++ +DI +Y++FSMLPRD+SQQIF+ELV S  LT   LEAF DCALQD++LGEYP +
Sbjct  58   CVAKVREDIKRYTSFSMLPRDLSQQIFNELVESHCLTDGSLEAFWDCALQDIHLGEYPGV  117

Query  523  DDTWMDVISS  552
             D WM ++SS
Sbjct  118  KDGWMGIVSS  127



>ref|XP_009611338.1| PREDICTED: F-box/LRR-repeat protein 13 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611339.1| PREDICTED: F-box/LRR-repeat protein 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=590

 Score = 91.3 bits (225),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  400  RDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            RDISQQIFDELV +QRLT V LEAFRDCALQDLN+GEYP L+D WMDVISS
Sbjct  91   RDISQQIFDELVGAQRLTDVSLEAFRDCALQDLNMGEYPGLNDHWMDVISS  141


 Score = 68.9 bits (167),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  152  QQCLRWGEFVLESETNWLRMTAYIEEFQDDIARVVVQNG*EVHFRGHL*ILGMEMEIALL  331
            + C+RW E VL S T+   M  YIEEF DDI +V VQNG E+HF     +L  EME   L
Sbjct  12   EHCIRWEEHVLGSVTSKSMMKVYIEEFLDDIPKVQVQNGWELHFLEEQ-MLNREMENTHL  70

Query  332  SWNCASIKFVKTLTNIAPSLC  394
            SWNC    FV+++  + P  C
Sbjct  71   SWNCV---FVESVKYVLPLEC  88



>emb|CDP10490.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CS KRD  A+   +HRG+SG Y K G SK   +S+  +S  P  G G+CPSLMELC
Sbjct  1    MGGACSLKRDYSADGYGLHRGISGMYFKCGYSKERRASVHSNSGCPPQG-GSCPSLMELC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            IY+I Q+I KY++F MLPRDISQ IF++L     L+   ++AFRDCALQD+ L +YP + 
Sbjct  60   IYKIRQEIHKYTSFYMLPRDISQLIFNDLASCHALSDCSIKAFRDCALQDICLADYPRVK  119

Query  526  DTWMDVISS  552
            D+WMDVI+S
Sbjct  120  DSWMDVITS  128



>ref|XP_009796215.1| PREDICTED: F-box/LRR-repeat protein 2-like isoform X3 [Nicotiana 
sylvestris]
Length=467

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGN-CPSLMEL  342
            MGG CS KRDQ  +D+   RG S R+ K GSS  L   L +  ID  H  G+ CPSLMEL
Sbjct  1    MGGACSLKRDQHDDDNISRRGFSSRHFKFGSSNCLQHFLFQRVIDVCHSGGSSCPSLMEL  60

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI++I +D+DKY +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ +GEY  +
Sbjct  61   CIHRIRKDLDKYQSFSMLPRDISQLIFNYLVYSNCLSDDCIEAFRDCALHDMWMGEYKGV  120

Query  523  DDTWMDVISS  552
             D WMDV+SS
Sbjct  121  KDNWMDVVSS  130



>gb|KCW53861.1| hypothetical protein EUGRSUZ_J03087 [Eucalyptus grandis]
Length=629

 Score =   125 bits (315),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  157  VSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLM  336
            +S MGG CSRKR+Q  ++D  H GVSGR  KS SSKWL +S SRS  D +H  G CPSLM
Sbjct  113  ISSMGGACSRKRNQQDDEDVAHGGVSGRCTKSPSSKWLWTSFSRSFSDVQHDRGKCPSLM  172

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLG  507
            +LC+ +I +DI KY TFS LPRDI+Q IF+ELV S+RL +V LEAFRDCALQDL+LG
Sbjct  173  DLCVQKIIEDIGKYRTFSKLPRDITQLIFNELVFSRRLDEVSLEAFRDCALQDLHLG  229



>ref|XP_009796213.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGN-CPSLMEL  342
            MGG CS KRDQ  +D+   RG S R+ K GSS  L   L +  ID  H  G+ CPSLMEL
Sbjct  1    MGGACSLKRDQHDDDNISRRGFSSRHFKFGSSNCLQHFLFQRVIDVCHSGGSSCPSLMEL  60

Query  343  CIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCL  522
            CI++I +D+DKY +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ +GEY  +
Sbjct  61   CIHRIRKDLDKYQSFSMLPRDISQLIFNYLVYSNCLSDDCIEAFRDCALHDMWMGEYKGV  120

Query  523  DDTWMDVISS  552
             D WMDV+SS
Sbjct  121  KDNWMDVVSS  130



>ref|XP_010313815.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG VCS KRD   +D+ I RG S R  K G S  L S L    +D   G  NCPSLMELC
Sbjct  1    MGSVCSSKRDAHDDDNIIRRGFSSRRFKVGRSSCLESFLLGRGVDCPLGRNNCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            +++I +D+DKY +FSMLPRDISQ IF+ LV S RL+   +EAFRDCAL D+  GEY  + 
Sbjct  61   VHRIRKDLDKYKSFSMLPRDISQLIFNNLVYSNRLSDDNIEAFRDCALHDMWTGEYKGVK  120

Query  526  DTWMDVISS  552
              WMDV SS
Sbjct  121  HNWMDVFSS  129



>ref|XP_010313816.1| PREDICTED: uncharacterized F-box/LRR-repeat protein C02F5.7-like 
isoform X3 [Solanum lycopersicum]
Length=473

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG VCS KRD   +D+ I RG S R  K G S  L S L    +D   G  NCPSLMELC
Sbjct  1    MGSVCSSKRDAHDDDNIIRRGFSSRRFKVGRSSCLESFLLGRGVDCPLGRNNCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            +++I +D+DKY +FSMLPRDISQ IF+ LV S RL+   +EAFRDCAL D+  GEY  + 
Sbjct  61   VHRIRKDLDKYKSFSMLPRDISQLIFNNLVYSNRLSDDNIEAFRDCALHDMWTGEYKGVK  120

Query  526  DTWMDVISS  552
              WMDV SS
Sbjct  121  HNWMDVFSS  129



>ref|XP_010313811.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313812.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313813.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313814.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X1 [Solanum 
lycopersicum]
Length=554

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG VCS KRD   +D+ I RG S R  K G S  L S L    +D   G  NCPSLMELC
Sbjct  1    MGSVCSSKRDAHDDDNIIRRGFSSRRFKVGRSSCLESFLLGRGVDCPLGRNNCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            +++I +D+DKY +FSMLPRDISQ IF+ LV S RL+   +EAFRDCAL D+  GEY  + 
Sbjct  61   VHRIRKDLDKYKSFSMLPRDISQLIFNNLVYSNRLSDDNIEAFRDCALHDMWTGEYKGVK  120

Query  526  DTWMDVISS  552
              WMDV SS
Sbjct  121  HNWMDVFSS  129



>ref|XP_009595107.1| PREDICTED: F-box/LRR-repeat protein 14-like [Nicotiana tomentosiformis]
Length=556

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CS KRDQ  +D+   RG S R  K GSS  L S L  S ID   G   CPSLMELC
Sbjct  1    MGGACSLKRDQHDDDNISRRGFSSRRFKFGSSNCLQSFLLESVIDYHPGGSGCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++I +D+++Y +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ +GEY  + 
Sbjct  61   IHRIRKDLNRYHSFSMLPRDISQLIFNNLVYSNCLSDDCIEAFRDCALHDMWMGEYKGVK  120

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  121  DNWMDVISS  129



>ref|XP_003575347.1| PREDICTED: F-box/LRR-repeat protein 14-like [Brachypodium distachyon]
Length=582

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 4/133 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLA-EDDSIHRGVSGRYCksgsskwlgsslsrssIDPR---HGNGNCPSL  333
            MGGVCSRKR QL  EDDS           S     L    S S +  +    G G CPSL
Sbjct  1    MGGVCSRKRSQLVDEDDSFQSPTRFSKTSSLKWLLLTLPRSSSDVSRKGLGKGPGRCPSL  60

Query  334  MELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEY  513
            MELC+ ++C+DI KYS+F++LP D+SQQ+F++LV S  L +  LE FRDCAL D+ LGE+
Sbjct  61   MELCVAKVCKDISKYSSFAVLPSDLSQQVFNQLVDSNCLKEASLETFRDCALHDICLGEF  120

Query  514  PCLDDTWMDVISS  552
            P + D WM+V++S
Sbjct  121  PGVKDAWMEVVAS  133



>ref|XP_010323274.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X3 [Solanum 
lycopersicum]
Length=542

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +1

Query  160  SQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLME  339
            S MG VCS KRD  A+++   RG SGRY K GSSKWL SSL   +   +     CPSLME
Sbjct  11   SLMGSVCSCKRDHYADENITRRGFSGRYFKFGSSKWLESSLFLPATCCQFQQSRCPSLME  70

Query  340  LCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPC  519
            LCI +IC+DIDKY +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ + E+  
Sbjct  71   LCICKICKDIDKYRSFSMLPRDISQLIFNHLVDSCSLSDSRIEAFRDCALHDMCMREHTR  130

Query  520  LDDTWMDVISS  552
            +++ WMDVISS
Sbjct  131  VNNKWMDVISS  141



>ref|XP_010323273.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Solanum 
lycopersicum]
Length=567

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +1

Query  160  SQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLME  339
            S MG VCS KRD  A+++   RG SGRY K GSSKWL SSL   +   +     CPSLME
Sbjct  11   SLMGSVCSCKRDHYADENITRRGFSGRYFKFGSSKWLESSLFLPATCCQFQQSRCPSLME  70

Query  340  LCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPC  519
            LCI +IC+DIDKY +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ + E+  
Sbjct  71   LCICKICKDIDKYRSFSMLPRDISQLIFNHLVDSCSLSDSRIEAFRDCALHDMCMREHTR  130

Query  520  LDDTWMDVISS  552
            +++ WMDVISS
Sbjct  131  VNNKWMDVISS  141



>ref|XP_004242726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g26540 isoform X1 [Solanum lycopersicum]
Length=591

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +1

Query  160  SQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLME  339
            S MG VCS KRD  A+++   RG SGRY K GSSKWL SSL   +   +     CPSLME
Sbjct  11   SLMGSVCSCKRDHYADENITRRGFSGRYFKFGSSKWLESSLFLPATCCQFQQSRCPSLME  70

Query  340  LCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPC  519
            LCI +IC+DIDKY +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ + E+  
Sbjct  71   LCICKICKDIDKYRSFSMLPRDISQLIFNHLVDSCSLSDSRIEAFRDCALHDMCMREHTR  130

Query  520  LDDTWMDVISS  552
            +++ WMDVISS
Sbjct  131  VNNKWMDVISS  141



>ref|XP_009762906.1| PREDICTED: toll-like receptor 13 isoform X3 [Nicotiana sylvestris]
Length=543

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (61%), Gaps = 17/137 (12%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPR--------HGNGN  321
            MG VCS K D  A++++  RG S RY             S   I+P             +
Sbjct  14   MGSVCSCKSDHYADENATRRGFSSRY---------FKFGSSKWIEPYLFLPAGCCQFRSS  64

Query  322  CPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLN  501
            CPSLMELCI++IC+DIDKY +FSMLP D+SQ IF+ LV S  L+   +EAFRDCAL D+ 
Sbjct  65   CPSLMELCIHKICEDIDKYHSFSMLPSDVSQLIFNHLVDSCSLSDNCIEAFRDCALHDMC  124

Query  502  LGEYPCLDDTWMDVISS  552
            +GEY  + D WMDVISS
Sbjct  125  MGEYTRVKDNWMDVISS  141



>ref|XP_003580088.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
 ref|XP_010240087.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
 ref|XP_010240088.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
 ref|XP_010240089.1| PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 
4 [Brachypodium distachyon]
Length=580

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 96/134 (72%), Gaps = 8/134 (6%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssID-----PRHGNGNCPS  330
            MG  CSRKR QL  +D ++   S R+ KSGS KWL  +LSRSS D      R G G+CPS
Sbjct  1    MGSACSRKRGQLVHEDELY---SVRFSKSGSFKWLLHTLSRSSSDVLRKAQRPGPGHCPS  57

Query  331  LMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGE  510
            L+ELC+ ++ +DI +YS FSMLPRD+SQQIF+ELV    LT+  LEAFRDCALQD+ L E
Sbjct  58   LVELCVARVREDISRYSDFSMLPRDLSQQIFNELVEWSYLTEESLEAFRDCALQDICLEE  117

Query  511  YPCLDDTWMDVISS  552
            YP + D WM+V++S
Sbjct  118  YPGVKDAWMEVVAS  131



>ref|XP_009762905.1| PREDICTED: toll-like receptor 13 isoform X2 [Nicotiana sylvestris]
Length=591

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (61%), Gaps = 17/137 (12%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPR--------HGNGN  321
            MG VCS K D  A++++  RG S RY             S   I+P             +
Sbjct  14   MGSVCSCKSDHYADENATRRGFSSRY---------FKFGSSKWIEPYLFLPAGCCQFRSS  64

Query  322  CPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLN  501
            CPSLMELCI++IC+DIDKY +FSMLP D+SQ IF+ LV S  L+   +EAFRDCAL D+ 
Sbjct  65   CPSLMELCIHKICEDIDKYHSFSMLPSDVSQLIFNHLVDSCSLSDNCIEAFRDCALHDMC  124

Query  502  LGEYPCLDDTWMDVISS  552
            +GEY  + D WMDVISS
Sbjct  125  MGEYTRVKDNWMDVISS  141



>ref|XP_009762904.1| PREDICTED: toll-like receptor 13 isoform X1 [Nicotiana sylvestris]
Length=592

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (61%), Gaps = 17/137 (12%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPR--------HGNGN  321
            MG VCS K D  A++++  RG S RY             S   I+P             +
Sbjct  14   MGSVCSCKSDHYADENATRRGFSSRY---------FKFGSSKWIEPYLFLPAGCCQFRSS  64

Query  322  CPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLN  501
            CPSLMELCI++IC+DIDKY +FSMLP D+SQ IF+ LV S  L+   +EAFRDCAL D+ 
Sbjct  65   CPSLMELCIHKICEDIDKYHSFSMLPSDVSQLIFNHLVDSCSLSDNCIEAFRDCALHDMC  124

Query  502  LGEYPCLDDTWMDVISS  552
            +GEY  + D WMDVISS
Sbjct  125  MGEYTRVKDNWMDVISS  141



>ref|XP_002448130.1| hypothetical protein SORBIDRAFT_06g021780 [Sorghum bicolor]
 gb|EES12458.1| hypothetical protein SORBIDRAFT_06g021780 [Sorghum bicolor]
Length=581

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 84/132 (64%), Gaps = 3/132 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH---GNGNCPSLM  336
            MG  CSRKR QL ++D ++     +              + + +  R      G CPSL+
Sbjct  1    MGSACSRKRGQLVQEDDLYSARFSKSGSFKWLLHTLPRSNSADVQRRTQGPAPGRCPSLV  60

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            ELC+ ++C+DI++YS FS+LPRD+SQQIF+ELV    LT+  L AFRDCALQD+ LG+YP
Sbjct  61   ELCVAKVCEDINRYSDFSLLPRDLSQQIFNELVECGCLTEASLGAFRDCALQDVCLGDYP  120

Query  517  CLDDTWMDVISS  552
             + D WM+V++S
Sbjct  121  GVTDAWMEVVAS  132



>ref|XP_006359507.1| PREDICTED: F-box/LRR-repeat protein 14-like [Solanum tuberosum]
Length=578

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 87/129 (67%), Gaps = 1/129 (1%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG VCS KRD  A+++   RG SGRY K GS     S    ++   +    +CPSLME+C
Sbjct  1    MGSVCSCKRDHYADENITRRGFSGRYFKFGSKWLESSLFLPAAC-CQFQQSHCPSLMEVC  59

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I +IC+DIDKY +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ + E+  ++
Sbjct  60   ICKICEDIDKYRSFSMLPRDISQLIFNHLVDSCSLSDSCIEAFRDCALHDMCMREHMRVN  119

Query  526  DTWMDVISS  552
            + WMDVISS
Sbjct  120  NKWMDVISS  128



>ref|XP_008372697.1| PREDICTED: toll-like receptor 13 [Malus domestica]
Length=578

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 89/127 (70%), Gaps = 2/127 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD   + D   RG S RY KSGSSKWL +S +R  +D +    N PSLM+  
Sbjct  1    MGGACSRKRDHQDDVDDFQRGFSRRYSKSGSSKWLATSFTRPVMDIQPDTRNGPSLMD--  58

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
              +  +DI+K++TFSMLPRDISQQI +ELV S  LT V  E FRDCALQDL LGE P ++
Sbjct  59   SKKRLRDINKFNTFSMLPRDISQQIINELVYSGCLTDVSFEGFRDCALQDLYLGECPGVN  118

Query  526  DTWMDVI  546
            D+WMDVI
Sbjct  119  DSWMDVI  125



>ref|XP_009796749.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X2 [Nicotiana 
sylvestris]
Length=561

 Score = 89.4 bits (220),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  394  LPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
              RDISQQIFDELV +QRLT V LEAFRDCALQDL++GEYP L+D WMDVISS
Sbjct  60   FTRDISQQIFDELVGTQRLTDVSLEAFRDCALQDLDMGEYPGLNDQWMDVISS  112


 Score = 54.3 bits (129),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +2

Query  209  MTAYIEEFQDDIARVVVQNG*EVHFRGHL*ILGMEMEIALLSWNCASIKFVKTLTNIAPS  388
            M  YIEEF DDI +V VQNG E HF     +L  EME   LSWNC    FVK++  + P 
Sbjct  2    MKVYIEEFLDDIPKVQVQNGWEHHFLEEQ-MLNREMENTHLSWNCV---FVKSVKYVLPL  57

Query  389  LC  394
             C
Sbjct  58   EC  59



>ref|XP_009621392.1| PREDICTED: F-box/LRR-repeat protein 2-like isoform X3 [Nicotiana 
tomentosiformis]
Length=475

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG VCS K D  A++++  RG S RY K GSSKWL SS    S   +    +CPSLMELC
Sbjct  14   MGSVCSCKSDHYADENTTRRGFSSRYFKFGSSKWLESSPFLPSGCCQFRRRSCPSLMELC  73

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++ C+DIDKY +FS+LP D+SQ IF+ LV S  L+   +EAFRDCAL+D+ +GE   + 
Sbjct  74   IHKTCEDIDKYHSFSILPSDVSQLIFNHLVDSCSLSDNCIEAFRDCALRDMCMGECTQVK  133

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  134  DNWMDVISS  142



>ref|XP_006652480.1| PREDICTED: F-box/LRR-repeat protein 14-like [Oryza brachyantha]
Length=581

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 7/134 (5%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH-----GNGNCPS  330
            MG  CSRKR QL  D+      S R+ KS S KWL  +L RS  D        G G CPS
Sbjct  1    MGSACSRKRGQLLVDE--EDLYSARFSKSSSFKWLLHTLPRSGSDVHRQVQGPGPGRCPS  58

Query  331  LMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGE  510
            LMELC+ ++ +DI +YS FS+LPRD+SQQ+F+ELV    LT+ +L AFRDCALQD+ LG+
Sbjct  59   LMELCVAKVREDIGRYSDFSLLPRDLSQQVFNELVEWNILTEELLGAFRDCALQDICLGD  118

Query  511  YPCLDDTWMDVISS  552
            YP + D WM+V++S
Sbjct  119  YPEVRDAWMEVVAS  132



>gb|EPS71509.1| hypothetical protein M569_03250, partial [Genlisea aurea]
Length=335

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG V SRKRD+   +++++RG  GR+ KSGSSKWLG+SL RSS     G    P L++LC
Sbjct  1    MGSVWSRKRDRQLNEENVNRGFFGRFQKSGSSKWLGASLPRSSSKVGQGIQKVPLLIDLC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + +IC+DIDKY + SMLPRD+ Q IFD+LV S  LT    EAFRDC+LQDLNLG    ++
Sbjct  61   VQRICKDIDKYDSLSMLPRDMIQLIFDDLVSSLCLTDSRFEAFRDCSLQDLNLGNCIGVN  120

Query  526  DTWMDVISS  552
            D+W+DV+ S
Sbjct  121  DSWIDVVVS  129



>ref|XP_009621391.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=591

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG VCS K D  A++++  RG S RY K GSSKWL SS    S   +    +CPSLMELC
Sbjct  14   MGSVCSCKSDHYADENTTRRGFSSRYFKFGSSKWLESSPFLPSGCCQFRRRSCPSLMELC  73

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++ C+DIDKY +FS+LP D+SQ IF+ LV S  L+   +EAFRDCAL+D+ +GE   + 
Sbjct  74   IHKTCEDIDKYHSFSILPSDVSQLIFNHLVDSCSLSDNCIEAFRDCALRDMCMGECTQVK  133

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  134  DNWMDVISS  142



>ref|XP_009621390.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MG VCS K D  A++++  RG S RY K GSSKWL SS    S   +    +CPSLMELC
Sbjct  14   MGSVCSCKSDHYADENTTRRGFSSRYFKFGSSKWLESSPFLPSGCCQFRRRSCPSLMELC  73

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            I++ C+DIDKY +FS+LP D+SQ IF+ LV S  L+   +EAFRDCAL+D+ +GE   + 
Sbjct  74   IHKTCEDIDKYHSFSILPSDVSQLIFNHLVDSCSLSDNCIEAFRDCALRDMCMGECTQVK  133

Query  526  DTWMDVISS  552
            D WMDVISS
Sbjct  134  DNWMDVISS  142



>tpg|DAA37063.1| TPA: hypothetical protein ZEAMMB73_067914 [Zea mays]
Length=356

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH---GNGNCPSLM  336
            MG  CSRKR QL ++D ++     +              + + +  R        CPSL+
Sbjct  1    MGSACSRKRGQLVQEDDLYSARFSKSGSFKWLLHTLPRSNFADVQRRAQGPAPNRCPSLV  60

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            ELC+ ++C+DI+ YS  S+LPRD+SQQIF+ELV    LT+  L AFRDC LQD+ LG+YP
Sbjct  61   ELCVAKVCKDINMYSDLSLLPRDLSQQIFNELVECGCLTEASLGAFRDCDLQDICLGDYP  120

Query  517  CLDDTWMDVISS  552
             + D WM+V++S
Sbjct  121  GVTDAWMEVVAS  132



>emb|CAN67937.1| hypothetical protein VITISV_014237 [Vitis vinifera]
Length=216

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 73/138 (53%), Gaps = 46/138 (33%)
 Frame = +1

Query  142  CEST-TVSQMGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNG  318
            CE+  T   MGGVCSRKRDQ  ++D +                                 
Sbjct  8    CETVPTHRSMGGVCSRKRDQQVDEDGVQ--------------------------------  35

Query  319  NCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDL  498
                          QDID+Y+ FSMLPRDISQQIFD  V S  LT   LEAFRDCA+QD+
Sbjct  36   -------------IQDIDRYTKFSMLPRDISQQIFDNFVDSHCLTSASLEAFRDCAIQDV  82

Query  499  NLGEYPCLDDTWMDVISS  552
            NLGEYP ++D+WMD+ISS
Sbjct  83   NLGEYPEVNDSWMDIISS  100



>tpg|DAA37065.1| TPA: hypothetical protein ZEAMMB73_067914 [Zea mays]
Length=400

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH---GNGNCPSLM  336
            MG  CSRKR QL ++D ++     +              + + +  R        CPSL+
Sbjct  1    MGSACSRKRGQLVQEDDLYSARFSKSGSFKWLLHTLPRSNFADVQRRAQGPAPNRCPSLV  60

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            ELC+ ++C+DI+ YS  S+LPRD+SQQIF+ELV    LT+  L AFRDC LQD+ LG+YP
Sbjct  61   ELCVAKVCKDINMYSDLSLLPRDLSQQIFNELVECGCLTEASLGAFRDCDLQDICLGDYP  120

Query  517  CLDDTWMDVISS  552
             + D WM+V++S
Sbjct  121  GVTDAWMEVVAS  132



>ref|NP_001141453.1| uncharacterized protein LOC100273563 [Zea mays]
 ref|XP_008667527.1| PREDICTED: uncharacterized protein LOC100273563 isoform X1 [Zea 
mays]
 ref|XP_008667528.1| PREDICTED: uncharacterized protein LOC100273563 isoform X1 [Zea 
mays]
 gb|ACF86403.1| unknown [Zea mays]
 tpg|DAA37064.1| TPA: regulatory subunit [Zea mays]
Length=581

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH---GNGNCPSLM  336
            MG  CSRKR QL ++D ++     +              + + +  R        CPSL+
Sbjct  1    MGSACSRKRGQLVQEDDLYSARFSKSGSFKWLLHTLPRSNFADVQRRAQGPAPNRCPSLV  60

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            ELC+ ++C+DI+ YS  S+LPRD+SQQIF+ELV    LT+  L AFRDC LQD+ LG+YP
Sbjct  61   ELCVAKVCKDINMYSDLSLLPRDLSQQIFNELVECGCLTEASLGAFRDCDLQDICLGDYP  120

Query  517  CLDDTWMDVISS  552
             + D WM+V++S
Sbjct  121  GVTDAWMEVVAS  132



>gb|ACG43200.1| regulatory subunit [Zea mays]
Length=581

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRH---GNGNCPSLM  336
            MG  CSRKR QL ++D ++     +              + + +  R        CPSL+
Sbjct  1    MGSACSRKRGQLVQEDDLYSARFSKSGSFKWLLHTLPRSNFADVQRRAQGPAPNRCPSLV  60

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            ELC+ ++C+DI+ YS  S+LPRD+SQQIF+ELV    LT+  L AFRDC LQD+ LG+YP
Sbjct  61   ELCVAKVCKDINMYSDLSLLPRDLSQQIFNELVECGCLTEASLGAFRDCDLQDICLGDYP  120

Query  517  CLDDTWMDVISS  552
             + D WM+V++S
Sbjct  121  GVTDAWMEVVAS  132



>ref|XP_004978117.1| PREDICTED: F-box/LRR-repeat protein 13-like [Setaria italica]
Length=591

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = +1

Query  175  VCSRKRDQLAEDDSIHRG---VSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
             CSRKR QL  +D ++      SG +     +    +S            G CPSLMELC
Sbjct  14   ACSRKRGQLVHEDDLYSARFSKSGSFKWLLHTLPRSNSADVHRRGQGPAPGRCPSLMELC  73

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + ++ +D+++YS FS LPRD+SQQIF+ELV S  LT+  L AF DC LQD+ LGEYP + 
Sbjct  74   VAKVREDMNRYSDFSQLPRDLSQQIFNELVESGYLTEASLGAFHDCDLQDICLGEYPGVT  133

Query  526  DTWMDVISS  552
            D WM+V++S
Sbjct  134  DAWMEVVAS  142



>gb|EMS49495.1| hypothetical protein TRIUR3_13085 [Triticum urartu]
Length=499

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDD---SIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLM  336
            MG  CSR R Q+  +D   S+    SG +     +    SS          G G  PSL+
Sbjct  1    MGSACSRNRGQVVHEDQLYSVKFSKSGSFKWLLHTLSRSSSDVLRKAQG-PGPGRRPSLV  59

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            ELC+ ++ +DI +YS FSMLPRD+SQQIF+ELV    + + +L AFRDCALQD+ L EYP
Sbjct  60   ELCVARVREDISRYSDFSMLPRDLSQQIFNELVRCSYINEELLGAFRDCALQDICLDEYP  119

Query  517  CLDDTWMDVISS  552
             + D WM+VI+S
Sbjct  120  GVKDAWMEVIAS  131



>emb|CAE02935.3| OSJNBa0014K14.7 [Oryza sativa Japonica Group]
Length=557

 Score =   103 bits (258),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 68/140 (49%), Positives = 87/140 (62%), Gaps = 19/140 (14%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNG---------  318
            MG  CSRKR QL  D+      S R+ KS S KWL  +L      PR G+          
Sbjct  1    MGSACSRKRGQLLVDE--EDLYSARFSKSSSFKWLLHTL------PRSGSDVHRKVQGPV  52

Query  319  --NCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQ  492
               CPSLMELC+ ++ +DI KYS FS+LPRD+SQQ+F+ELV    LT+ +L AFRDCALQ
Sbjct  53   PVRCPSLMELCVAKVREDIGKYSDFSLLPRDLSQQVFNELVEWNILTEELLGAFRDCALQ  112

Query  493  DLNLGEYPCLDDTWMDVISS  552
            D+ L +YP + D WM+V +S
Sbjct  113  DICLADYPGVRDAWMEVAAS  132



>emb|CAH67587.1| OSIGBa0112M24.4 [Oryza sativa Indica Group]
 gb|EEC77586.1| hypothetical protein OsI_16540 [Oryza sativa Indica Group]
Length=581

 Score =   103 bits (258),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 68/140 (49%), Positives = 87/140 (62%), Gaps = 19/140 (14%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGN----------  315
            MG  CSRKR QL  D+      S R+ KS S KWL  +L      PR G+          
Sbjct  1    MGSACSRKRGQLLVDE--EDLYSARFSKSSSFKWLLHTL------PRSGSDVHRKVQGPV  52

Query  316  -GNCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQ  492
               CPSLMELC+ ++ +DI KYS FS+LPRD+SQQ+F+ELV    LT+ +L AFRDCALQ
Sbjct  53   PARCPSLMELCVAKVREDIGKYSDFSLLPRDLSQQVFNELVEWNILTEELLGAFRDCALQ  112

Query  493  DLNLGEYPCLDDTWMDVISS  552
            D+ L +YP + D WM+V +S
Sbjct  113  DICLADYPGVRDAWMEVAAS  132



>gb|EMT00676.1| hypothetical protein F775_32177 [Aegilops tauschii]
Length=587

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDD---SIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLM  336
            MG  CSR R Q+  +D   S+    SG +     +    SS          G G  PSL+
Sbjct  1    MGSACSRNRGQVVHEDQLYSVKFSKSGSFKWLLHTLSRSSSDVLRKAQG-PGPGRRPSLV  59

Query  337  ELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYP  516
            ELC+ ++ +DI +YS FSMLPRD+SQQIF+ELV    + + +L AFRDCALQD+ L EYP
Sbjct  60   ELCVARVREDISRYSDFSMLPRDLSQQIFNELVRCSYINEELLGAFRDCALQDICLDEYP  119

Query  517  CLDDTWMDVISS  552
             + D WM+VI+S
Sbjct  120  GVKDAWMEVIAS  131



>ref|XP_010654848.1| PREDICTED: F-box/LRR-repeat protein 14 isoform X2 [Vitis vinifera]
Length=551

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 82/129 (64%), Gaps = 27/129 (21%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRD    +DS+ RGVSG+YC+ GSSKWLG+S+SR ++D   G G CPSLMELC
Sbjct  1    MGGACSRKRDPQVNEDSLQRGVSGKYCRIGSSKWLGTSISRPALDILQGRGQCPSLMELC  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            IY+I                            + LT V L+AF+DCALQD+ LGEYP + 
Sbjct  61   IYKI---------------------------RECLTDVSLKAFQDCALQDIYLGEYPGVS  93

Query  526  DTWMDVISS  552
            D+WMDVISS
Sbjct  94   DSWMDVISS  102



>ref|NP_001053240.1| Os04g0503500 [Oryza sativa Japonica Group]
 dbj|BAF15154.1| Os04g0503500 [Oryza sativa Japonica Group]
 dbj|BAG95192.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94111.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61282.1| hypothetical protein OsJ_15365 [Oryza sativa Japonica Group]
Length=581

 Score =   103 bits (256),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 68/140 (49%), Positives = 87/140 (62%), Gaps = 19/140 (14%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNG---------  318
            MG  CSRKR QL  D+      S R+ KS S KWL  +L      PR G+          
Sbjct  1    MGSACSRKRGQLLVDE--EDLYSARFSKSSSFKWLLHTL------PRSGSDVHRKVQGPV  52

Query  319  --NCPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQ  492
               CPSLMELC+ ++ +DI KYS FS+LPRD+SQQ+F+ELV    LT+ +L AFRDCALQ
Sbjct  53   PVRCPSLMELCVAKVREDIGKYSDFSLLPRDLSQQVFNELVEWNILTEELLGAFRDCALQ  112

Query  493  DLNLGEYPCLDDTWMDVISS  552
            D+ L +YP + D WM+V +S
Sbjct  113  DICLADYPGVRDAWMEVAAS  132



>ref|XP_002980094.1| hypothetical protein SELMODRAFT_419616 [Selaginella moellendorffii]
 ref|XP_002992678.1| hypothetical protein SELMODRAFT_162512 [Selaginella moellendorffii]
 gb|EFJ06263.1| hypothetical protein SELMODRAFT_162512 [Selaginella moellendorffii]
 gb|EFJ18964.1| hypothetical protein SELMODRAFT_419616 [Selaginella moellendorffii]
Length=578

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ   D     G S R+ +S   +W   +  R   D +      PSL+EL 
Sbjct  1    MGGACSRKRDQREGDLDDGYGGSARFSRSFYFRWPSRNFERDISDEQDNANKAPSLLELA  60

Query  346  IYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLD  525
            + + C++     +F  LPRD++Q+I +ELV +Q L++ + +AF DCA+QD+ LG YP +D
Sbjct  61   VRETCKNTQGIKSFEKLPRDLTQKILNELVQTQALSRELFQAFEDCAIQDIYLGYYPGVD  120

Query  526  DTWMDVISS  552
            D+WM+VI S
Sbjct  121  DSWMEVIGS  129



>gb|KJB23678.1| hypothetical protein B456_004G109300 [Gossypium raimondii]
Length=518

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  364  DIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDV  543
            DI++YS+F+MLP+DISQQIF++LV S  LT V L+ FRDCAL+D+ LGEYP + D+WMDV
Sbjct  7    DINQYSSFTMLPKDISQQIFNKLVLSHLLTDVFLQKFRDCALEDVWLGEYPGVQDSWMDV  66

Query  544  ISS  552
            IS+
Sbjct  67   IST  69



>ref|XP_001780819.1| predicted protein [Physcomitrella patens]
 gb|EDQ54376.1| predicted protein [Physcomitrella patens]
Length=564

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  325  PSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNL  504
            PSL+E+C+  I ++IDKY +FS +PRD+ QQ+ ++LV  Q L+ V LE F DCALQD+ L
Sbjct  39   PSLLEICVQNIVKNIDKYKSFSGVPRDLIQQVLNDLVRKQLLSPVTLELFSDCALQDVLL  98

Query  505  GEYPCLDDTWMDVISS  552
             +YP ++D W+D+I S
Sbjct  99   ADYPGVEDFWLDIIGS  114



>ref|XP_006474376.1| PREDICTED: uncharacterized protein LOC102609559 [Citrus sinensis]
 ref|XP_006474377.1| PREDICTED: uncharacterized protein LOC102609851 [Citrus sinensis]
Length=131

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  361  QDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMD  540
            +D+DKY +FSM  RDI+QQIF EL+ S  LTK  L+AFRDCALQD+ LG+YP + D+WMD
Sbjct  6    RDVDKYKSFSMPSRDITQQIFSELLFSHCLTKASLKAFRDCALQDVLLGDYPRVKDSWMD  65

Query  541  VISS  552
            VI+S
Sbjct  66   VIAS  69



>gb|KDO52283.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=396

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>gb|KDO52281.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=469

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>gb|KDO52282.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=448

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>gb|KDO52277.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=472

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>gb|KDO52278.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=479

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>gb|KDO52279.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=479

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>gb|KDO52276.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=503

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>gb|KDO52275.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=529

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQDL LG+YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQDLCLGQYPGVNDKWMDVIAS  54



>ref|XP_006595170.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Glycine 
max]
Length=517

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 15/92 (16%)
 Frame = +1

Query  322  CPSLMELCIYQIC-----QDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCA  486
            CPSL++LCI +I      +DI KY+TFS LP D+SQ+IF+ +V S  LT   L+ FRD A
Sbjct  25   CPSLLDLCIRKITHTLTREDIHKYNTFSALPPDLSQRIFNNMVYSSYLTPASLQPFRDSA  84

Query  487  LQDLNLGEYP----------CLDDTWMDVISS  552
            LQD+ LGEY            +DD WMDVISS
Sbjct  85   LQDICLGEYEYANGGGAAAAIVDDAWMDVISS  116



>gb|KHN44196.1| F-box/LRR-repeat protein 14 [Glycine soja]
Length=592

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 15/92 (16%)
 Frame = +1

Query  322  CPSLMELCIYQIC-----QDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCA  486
            CPSL++LCI +I      +DI KY+TFS LP D+SQ+IF+ +V S  LT   L+ FRD A
Sbjct  52   CPSLLDLCIRKITHTLTREDIHKYNTFSALPPDLSQRIFNNMVYSSYLTPASLQPFRDSA  111

Query  487  LQDLNLGEYP----------CLDDTWMDVISS  552
            LQD+ LGEY            +DD WMDVISS
Sbjct  112  LQDICLGEYEYANGGGAAAAIVDDAWMDVISS  143



>ref|XP_003543689.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Glycine 
max]
Length=565

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 15/92 (16%)
 Frame = +1

Query  322  CPSLMELCIYQIC-----QDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCA  486
            CPSL++LCI +I      +DI KY+TFS LP D+SQ+IF+ +V S  LT   L+ FRD A
Sbjct  25   CPSLLDLCIRKITHTLTREDIHKYNTFSALPPDLSQRIFNNMVYSSYLTPASLQPFRDSA  84

Query  487  LQDLNLGEYP----------CLDDTWMDVISS  552
            LQD+ LGEY            +DD WMDVISS
Sbjct  85   LQDICLGEYEYANGGGAAAAIVDDAWMDVISS  116



>ref|XP_009796214.1| PREDICTED: F-box/LRR-repeat protein 14-like isoform X2 [Nicotiana 
sylvestris]
Length=511

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  364  DIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDV  543
            D+DKY +FSMLPRDISQ IF+ LV S  L+   +EAFRDCAL D+ +GEY  + D WMDV
Sbjct  22   DLDKYQSFSMLPRDISQLIFNYLVYSNCLSDDCIEAFRDCALHDMWMGEYKGVKDNWMDV  81

Query  544  ISS  552
            +SS
Sbjct  82   VSS  84



>ref|XP_001758973.1| predicted protein [Physcomitrella patens]
 gb|EDQ76042.1| predicted protein [Physcomitrella patens]
Length=584

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 45/133 (34%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +1

Query  166  MGGVCSRKRD-QLAEDDSIHRGVSGRYCksgsskw---lgsslsrssIDPRHGNGNCPSL  333
            MGG CSR+RD Q  E D               S            +     H     P+L
Sbjct  1    MGGACSRRRDHQTVEADDRSGSSRSGRLSRSVSLRWPVKPPKALETLASTPHECKTAPTL  60

Query  334  MELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEY  513
            +++C+ +I ++I K+ + + +PRD+ Q + DELV  Q L+   LE F DC+LQD+ L +Y
Sbjct  61   LDICVREIVKNIGKHKSLARVPRDLIQLVLDELVRRQLLSPTTLELFSDCSLQDVLLPDY  120

Query  514  PCLDDTWMDVISS  552
            P ++D+W+ VI S
Sbjct  121  PGVEDSWLQVIGS  133



>gb|KDO52280.1| hypothetical protein CISIN_1g009672mg [Citrus sinensis]
Length=497

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 6/54 (11%)
 Frame = +1

Query  391  MLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
            MLPRDISQQIF+ELV S+ LT+V LEAFRDCALQ      YP ++D WMDVI+S
Sbjct  1    MLPRDISQQIFNELVYSRCLTEVSLEAFRDCALQ------YPGVNDKWMDVIAS  48



>ref|XP_006597112.1| PREDICTED: uncharacterized protein LOC102660607 [Glycine max]
Length=130

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 51/88 (58%), Gaps = 13/88 (15%)
 Frame = +1

Query  322  CPSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLN  501
            CPSL+ L  + +  DI KY+TFS L  D+SQ+IF+ LV S  LT   L+ FRD ALQD  
Sbjct  34   CPSLLNLITHAL--DIHKYNTFSSLSPDLSQRIFNNLVYSSYLTPASLQPFRDSALQDSY  91

Query  502  LGE-----------YPCLDDTWMDVISS  552
            LGE              + D WMDVISS
Sbjct  92   LGEYANAYGGGGAAAAIVVDAWMDVISS  119



>gb|KDO42721.1| hypothetical protein CISIN_1g035038mg [Citrus sinensis]
Length=75

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  166  MGGVCSRKRDQLAEDDSIHRGVSGRYCksgsskwlgsslsrssIDPRHGNGNCPSLMELC  345
            MGG CSRKRDQ+  +D +H GV GRY KS SSKWL +S SR  +D + G G CPSL ELC
Sbjct  1    MGGACSRKRDQVDNEDGLHGGVCGRYQKSCSSKWLMTSFSRPPLDIQRGEGKCPSLRELC  60

Query  346  IYQI  357
             Y+I
Sbjct  61   AYKI  64



>ref|XP_002506103.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67361.1| predicted protein [Micromonas sp. RCC299]
Length=610

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  385  FSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDLNLGEYPCLDDTWMDVISS  552
             S+LP D+SQ++F++LV ++RLT  +   F  C L + NL  YP L D W+ V+++
Sbjct  98   LSVLPSDLSQRVFEDLVQTRRLTARVTGDFIGCHLTEANLRSYPGLTDDWLAVLAT  153



>gb|EWM21918.1| Leucine-rich repeat, cysteine-containing subtype [Nannochloropsis 
gaditana]
Length=559

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = +1

Query  328  SLMELCIYQICQDIDKYS---TFSMLPRDISQQIFDELVCSQRLTKVILEAFRDCALQDL  498
            SL++LCI  ICQ+I  Y    +F +LP D+ ++IFD L   + LTK+ L   R C +  L
Sbjct  2    SLIDLCIDSICQNILCYEVPPSFDVLPPDLVRRIFDSLTSHKALTKLTLLPLRYCDVTRL  61

Query  499  NLGEYPCLDDTWM  537
            +L     + D W+
Sbjct  62   DLSPCKGVTDQWL  74



>ref|XP_005829196.1| hypothetical protein GUITHDRAFT_74106 [Guillardia theta CCMP2712]
 gb|EKX42216.1| hypothetical protein GUITHDRAFT_74106 [Guillardia theta CCMP2712]
Length=527

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 4/75 (5%)
 Frame = +1

Query  325  PSLMELCIYQICQDIDKYSTFSMLPRDISQQIFDELVCSQRLTKVILEAF-RDCALQDLN  501
            PSL E CI  I +++  Y++   +P ++ Q +FD L  S+RL K  L    R C   D +
Sbjct  19   PSLTEWCIRSISENMHCYTSLDGIPNEMVQALFDSLAYSRRLEKSHLPLLSRIC---DAS  75

Query  502  LGEYPCLDDTWMDVI  546
            L  YP + D W++V+
Sbjct  76   LFAYPLIADDWLEVL  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760