BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015H04

Length=241
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606258.1|  PREDICTED: polygalacturonase QRT2-like           73.9    2e-13   
ref|XP_009767751.1|  PREDICTED: polygalacturonase QRT2-like           69.7    6e-12   Nicotiana sylvestris
ref|XP_004252072.1|  PREDICTED: polygalacturonase QRT2                68.2    2e-11   Solanum lycopersicum
ref|XP_006345284.1|  PREDICTED: polygalacturonase QRT2-like           63.9    7e-10   Solanum tuberosum [potatoes]
ref|NP_001238514.1|  polygalacturonase gene specific to nodule pr...  58.9    4e-09   
gb|AAY21051.1|  truncated PGN                                         58.5    8e-09   Glycine max [soybeans]
gb|EPS70858.1|  polygalacturonase                                     57.8    2e-08   Genlisea aurea
gb|KGN52445.1|  hypothetical protein Csa_5G635400                     59.3    3e-08   Cucumis sativus [cucumbers]
ref|XP_011078328.1|  PREDICTED: polygalacturonase-like isoform X3     58.2    6e-08   
gb|KHN43850.1|  Putative polygalacturonase                            58.2    7e-08   Glycine soja [wild soybean]
gb|AAY21049.1|  PGN                                                   58.2    7e-08   Glycine max [soybeans]
ref|XP_011078321.1|  PREDICTED: polygalacturonase QRT2-like isofo...  57.8    1e-07   Sesamum indicum [beniseed]
ref|XP_010498061.1|  PREDICTED: exopolygalacturonase-like             57.4    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003597886.1|  Polygalacturonase                                57.4    1e-07   Medicago truncatula
ref|XP_003601689.1|  hypothetical protein MTR_3g084360                57.4    2e-07   
ref|XP_007134083.1|  hypothetical protein PHAVU_010G0180000g          53.9    2e-07   Phaseolus vulgaris [French bean]
ref|XP_003588754.1|  PGN                                              56.6    2e-07   
ref|XP_003607885.1|  hypothetical protein MTR_4g084050                56.2    3e-07   Medicago truncatula
ref|XP_007163810.1|  hypothetical protein PHAVU_001G266200g           56.2    3e-07   Phaseolus vulgaris [French bean]
ref|XP_007134323.1|  hypothetical protein PHAVU_010G037700g           56.2    3e-07   Phaseolus vulgaris [French bean]
ref|XP_010667060.1|  PREDICTED: polygalacturonase-like isoform X2     55.8    4e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004486675.1|  PREDICTED: probable polygalacturonase At3g15...  56.2    4e-07   
ref|XP_010667059.1|  PREDICTED: polygalacturonase-like isoform X1     56.2    4e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative  55.8    4e-07   
gb|KHN27820.1|  Polygalacturonase ADPG2                               52.8    6e-07   Glycine soja [wild soybean]
ref|XP_010445851.1|  PREDICTED: probable polygalacturonase At3g15720  53.1    6e-07   
ref|XP_011015894.1|  PREDICTED: polygalacturonase-like                55.1    6e-07   Populus euphratica
gb|AES71940.2|  polygalacturonase/glycoside hydrolase family protein  55.5    7e-07   Medicago truncatula
ref|XP_004516611.1|  PREDICTED: probable polygalacturonase At3g15...  55.1    7e-07   Cicer arietinum [garbanzo]
gb|KDO45206.1|  hypothetical protein CISIN_1g047411mg                 53.9    8e-07   Citrus sinensis [apfelsine]
gb|AAN60351.1|  unknown                                               53.1    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645549.1|  PREDICTED: polygalacturonase QRT2-like           55.1    9e-07   
emb|CDP14857.1|  unnamed protein product                              55.1    9e-07   Coffea canephora [robusta coffee]
ref|XP_006416734.1|  hypothetical protein EUTSA_v10009641mg           55.1    9e-07   Eutrema salsugineum [saltwater cress]
ref|XP_004146930.1|  PREDICTED: probable polygalacturonase At3g15...  54.7    1e-06   
ref|XP_002881804.1|  hypothetical protein ARALYDRAFT_483267           55.1    1e-06   
ref|XP_003540568.1|  PREDICTED: probable polygalacturonase At3g15...  54.7    1e-06   Glycine max [soybeans]
ref|XP_004172608.1|  PREDICTED: probable polygalacturonase At3g15...  54.7    1e-06   
ref|XP_010324136.1|  PREDICTED: exopolygalacturonase-like             54.7    1e-06   Solanum lycopersicum
ref|XP_011014661.1|  PREDICTED: polygalacturonase-like                54.3    1e-06   Populus euphratica
gb|KGN53196.1|  hypothetical protein Csa_4G025750                     54.3    1e-06   Cucumis sativus [cucumbers]
ref|XP_004306136.2|  PREDICTED: exopolygalacturonase-like             54.3    1e-06   Fragaria vesca subsp. vesca
gb|EYU23048.1|  hypothetical protein MIMGU_mgv1a026845mg              54.3    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_010508675.1|  PREDICTED: polygalacturonase ADPG2-like          54.3    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009758043.1|  PREDICTED: polygalacturonase-like                54.3    2e-06   Nicotiana sylvestris
emb|CDY69377.1|  BnaCnng63250D                                        53.9    2e-06   Brassica napus [oilseed rape]
ref|XP_010254486.1|  PREDICTED: polygalacturonase ADPG1-like          54.3    2e-06   Nelumbo nucifera [Indian lotus]
gb|KGN43436.1|  Polygalacturonase                                     53.9    2e-06   Cucumis sativus [cucumbers]
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483    53.9    2e-06   Cucumis melo [Oriental melon]
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...  53.9    2e-06   Cucumis sativus [cucumbers]
ref|XP_008443755.1|  PREDICTED: polygalacturonase-like                53.9    2e-06   Cucumis melo [Oriental melon]
ref|XP_010318778.1|  PREDICTED: probable polygalacturonase At3g15720  53.9    2e-06   Solanum lycopersicum
ref|XP_007150743.1|  hypothetical protein PHAVU_005G177000g           53.9    2e-06   Phaseolus vulgaris [French bean]
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430        53.9    2e-06   Amborella trichopoda
ref|NP_001233795.1|  polygalacturonase precursor                      53.9    2e-06   
ref|XP_006465356.1|  PREDICTED: probable polygalacturonase At1g80...  53.9    3e-06   Citrus sinensis [apfelsine]
ref|XP_004497875.1|  PREDICTED: probable polygalacturonase At3g15...  53.5    3e-06   Cicer arietinum [garbanzo]
gb|KEH18863.1|  polygalacturonase/glycoside hydrolase family protein  53.5    3e-06   Medicago truncatula
emb|CDX73440.1|  BnaC08g25630D                                        53.5    3e-06   
ref|XP_010494537.1|  PREDICTED: probable polygalacturonase At3g15720  53.5    3e-06   
ref|XP_006304614.1|  hypothetical protein CARUB_v10011686mg           53.1    3e-06   
ref|XP_010090713.1|  hypothetical protein L484_013735                 52.4    3e-06   
ref|XP_006465486.1|  PREDICTED: probable polygalacturonase At3g15...  53.9    3e-06   
ref|XP_010459287.1|  PREDICTED: exopolygalacturonase                  53.5    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like             53.5    3e-06   Phoenix dactylifera
ref|XP_007018009.1|  Pectin lyase-like superfamily protein, putative  53.5    3e-06   
ref|XP_004498018.1|  PREDICTED: probable polygalacturonase At3g15...  53.5    3e-06   Cicer arietinum [garbanzo]
gb|KHG17941.1|  hypothetical protein F383_07844                       53.5    3e-06   Gossypium arboreum [tree cotton]
ref|XP_006398123.1|  hypothetical protein EUTSA_v10001153mg           53.5    3e-06   
ref|XP_004498026.1|  PREDICTED: probable polygalacturonase At3g15...  53.5    3e-06   Cicer arietinum [garbanzo]
ref|XP_003545181.1|  PREDICTED: probable polygalacturonase At3g15...  53.5    3e-06   
emb|CDP06168.1|  unnamed protein product                              53.5    3e-06   Coffea canephora [robusta coffee]
gb|AAC28903.1|  polygalacturonase 1                                   53.1    4e-06   Solanum lycopersicum
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like             53.1    4e-06   Elaeis guineensis
gb|KDP29569.1|  hypothetical protein JCGZ_19282                       53.1    4e-06   Jatropha curcas
ref|XP_011074245.1|  PREDICTED: polygalacturonase-like                53.1    4e-06   Sesamum indicum [beniseed]
ref|XP_010092712.1|  hypothetical protein L484_024607                 53.1    4e-06   
ref|XP_010551910.1|  PREDICTED: polygalacturonase At1g48100 isofo...  53.1    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_007212964.1|  hypothetical protein PRUPE_ppa021095mg           53.5    4e-06   
ref|XP_010551909.1|  PREDICTED: polygalacturonase At1g48100 isofo...  53.1    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_008454473.1|  PREDICTED: probable polygalacturonase At3g15720  53.1    4e-06   Cucumis melo [Oriental melon]
gb|KJB70601.1|  hypothetical protein B456_011G082400                  53.1    4e-06   Gossypium raimondii
ref|XP_009367790.1|  PREDICTED: exopolygalacturonase-like             53.1    4e-06   Pyrus x bretschneideri [bai li]
emb|CDY14791.1|  BnaC04g47880D                                        53.1    4e-06   Brassica napus [oilseed rape]
gb|AAL84942.1|  At2g41850/T11A7.5                                     53.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02763.1|  putative polygalacturonase                            53.1    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850359.1|  polygalacturonase ADPG2                             53.1    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357140.1|  PREDICTED: polygalacturonase-like                52.8    5e-06   Solanum tuberosum [potatoes]
ref|XP_002985472.1|  hypothetical protein SELMODRAFT_122081           52.8    5e-06   
ref|XP_008383110.1|  PREDICTED: exopolygalacturonase-like             52.8    5e-06   
ref|XP_002979824.1|  hypothetical protein SELMODRAFT_111266           52.8    5e-06   
ref|XP_010527121.1|  PREDICTED: probable polygalacturonase At3g15720  52.8    5e-06   Tarenaya hassleriana [spider flower]
ref|XP_010254483.1|  PREDICTED: probable polygalacturonase At3g15720  52.8    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006583490.1|  PREDICTED: probable polygalacturonase At3g15...  52.8    5e-06   Glycine max [soybeans]
ref|XP_010069207.1|  PREDICTED: polygalacturonase-like                52.8    6e-06   Eucalyptus grandis [rose gum]
ref|XP_006845770.1|  hypothetical protein AMTR_s00019p00250890        52.8    6e-06   
ref|XP_010507688.1|  PREDICTED: polygalacturonase ADPG2               52.8    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004305261.1|  PREDICTED: probable polygalacturonase At3g15720  52.8    6e-06   Fragaria vesca subsp. vesca
gb|ACV85697.1|  ripening-induced polygalacturonase 4                  52.8    6e-06   Carica papaya [mamon]
ref|XP_006583489.1|  PREDICTED: probable polygalacturonase At3g15...  52.4    6e-06   Glycine max [soybeans]
emb|CBI28392.3|  unnamed protein product                              50.4    6e-06   Vitis vinifera
emb|CDP18456.1|  unnamed protein product                              52.4    7e-06   Coffea canephora [robusta coffee]
ref|XP_002529089.1|  Polygalacturonase precursor, putative            52.4    7e-06   Ricinus communis
ref|XP_002529088.1|  conserved hypothetical protein                   52.0    7e-06   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...  52.4    7e-06   Gossypium hirsutum [American cotton]
gb|KHN22975.1|  Polygalacturonase                                     52.4    7e-06   Glycine soja [wild soybean]
ref|XP_003534763.2|  PREDICTED: polygalacturonase-like                52.4    7e-06   Glycine max [soybeans]
ref|XP_003547316.1|  PREDICTED: polygalacturonase-like                52.4    7e-06   Glycine max [soybeans]
ref|XP_002321662.2|  hypothetical protein POPTR_0015s10000g           52.0    8e-06   
ref|XP_006595163.1|  PREDICTED: probable polygalacturonase At3g15...  52.4    8e-06   Glycine max [soybeans]
ref|XP_010431134.1|  PREDICTED: probable polygalacturonase At3g15720  52.4    8e-06   
gb|KHN44172.1|  Putative polygalacturonase                            52.4    8e-06   Glycine soja [wild soybean]
gb|KEH33414.1|  polygalacturonase/glycoside hydrolase family protein  52.4    8e-06   Medicago truncatula
ref|XP_010445667.1|  PREDICTED: probable polygalacturonase At1g80170  52.4    9e-06   
ref|XP_006427258.1|  hypothetical protein CICLE_v10026919mg           52.4    9e-06   
gb|KHN08870.1|  Polygalacturonase                                     52.0    9e-06   Glycine soja [wild soybean]
ref|XP_011078892.1|  PREDICTED: polygalacturonase                     52.4    9e-06   Sesamum indicum [beniseed]
ref|XP_002890206.1|  glycoside hydrolase family 28 protein            52.0    9e-06   
emb|CAC05657.1|  endopolygalacturonase                                52.4    9e-06   Brassica napus [oilseed rape]
ref|XP_009142016.1|  PREDICTED: polygalacturonase ADPG2-like          52.0    9e-06   Brassica rapa
emb|CDY06902.1|  BnaA04g24130D                                        52.0    9e-06   
ref|XP_010476858.1|  PREDICTED: exopolygalacturonase-like isoform X2  52.0    9e-06   
ref|XP_006838303.1|  hypothetical protein AMTR_s00103p00121270        52.4    1e-05   Amborella trichopoda
emb|CDP16134.1|  unnamed protein product                              52.0    1e-05   Coffea canephora [robusta coffee]
ref|XP_010476857.1|  PREDICTED: exopolygalacturonase-like isoform X1  52.0    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_003537285.1|  PREDICTED: polygalacturonase-like                52.0    1e-05   Glycine max [soybeans]
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...  52.0    1e-05   Gossypium barbadense [Egyptian cotton]
ref|XP_003518118.1|  PREDICTED: polygalacturonase-like                52.0    1e-05   
ref|XP_002315106.2|  polygalacturonase family protein                 52.0    1e-05   Populus trichocarpa [western balsam poplar]
gb|EYU20740.1|  hypothetical protein MIMGU_mgv1a007521mg              52.0    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_002526714.1|  Polygalacturonase precursor, putative            50.4    1e-05   
ref|XP_006296029.1|  hypothetical protein CARUB_v10025174mg           52.0    1e-05   Capsella rubella
ref|XP_006378626.1|  hypothetical protein POPTR_0010s18510g           51.6    1e-05   
gb|KHM99814.1|  Polygalacturonase                                     52.0    1e-05   Glycine soja [wild soybean]
ref|XP_006845769.1|  hypothetical protein AMTR_s00019p00250720        48.9    1e-05   
ref|XP_010435969.1|  PREDICTED: probable polygalacturonase At1g80170  51.6    1e-05   
ref|XP_004489698.1|  PREDICTED: probable polygalacturonase At3g15...  51.6    1e-05   Cicer arietinum [garbanzo]
gb|KEH18028.1|  pectin lyase superfamily protein                      51.6    1e-05   Medicago truncatula
ref|XP_006392146.1|  hypothetical protein EUTSA_v10023404mg           52.0    1e-05   Eutrema salsugineum [saltwater cress]
ref|XP_002529090.1|  Polygalacturonase precursor, putative            51.6    1e-05   Ricinus communis
ref|XP_006351095.1|  PREDICTED: polygalacturonase-like                52.0    1e-05   Solanum tuberosum [potatoes]
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like             51.6    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010413001.1|  PREDICTED: polygalacturonase ADPG2-like          51.6    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002868688.1|  predicted protein                                51.6    2e-05   
ref|XP_002968845.1|  hypothetical protein SELMODRAFT_12909            51.2    2e-05   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  51.2    2e-05   
ref|XP_002974127.1|  hypothetical protein SELMODRAFT_12908            51.2    2e-05   
ref|XP_010436249.1|  PREDICTED: probable polygalacturonase At3g15720  51.2    2e-05   Camelina sativa [gold-of-pleasure]
ref|NP_173158.1|  pectin lyase-like protein                           51.2    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142600.1|  PREDICTED: polygalacturonase-like                51.2    2e-05   Cucumis sativus [cucumbers]
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like             51.2    2e-05   Nicotiana tomentosiformis
ref|XP_010554840.1|  PREDICTED: polygalacturonase ADPG2-like          51.2    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_006364236.1|  PREDICTED: probable polygalacturonase At3g15...  51.2    2e-05   
ref|XP_009139940.1|  PREDICTED: polygalacturonase QRT2                51.2    2e-05   
ref|XP_006281692.1|  hypothetical protein CARUB_v10027840mg           50.8    2e-05   
ref|XP_006351096.1|  PREDICTED: polygalacturonase-like                51.2    2e-05   Solanum tuberosum [potatoes]
ref|XP_009146202.1|  PREDICTED: probable polygalacturonase At3g15...  51.2    2e-05   Brassica rapa
ref|XP_009146201.1|  PREDICTED: probable polygalacturonase At3g15...  51.2    2e-05   Brassica rapa
ref|XP_007134324.1|  hypothetical protein PHAVU_010G037800g           50.8    2e-05   Phaseolus vulgaris [French bean]
gb|KFK35000.1|  hypothetical protein AALP_AA5G221100                  51.2    2e-05   Arabis alpina [alpine rockcress]
ref|XP_006353088.1|  PREDICTED: exopolygalacturonase-like             50.8    2e-05   
gb|KFK42900.1|  hypothetical protein AALP_AA1G053200                  51.6    2e-05   Arabis alpina [alpine rockcress]
ref|XP_010254485.1|  PREDICTED: probable polygalacturonase At3g15720  49.3    2e-05   
ref|XP_008394259.1|  PREDICTED: polygalacturonase                     50.8    2e-05   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like             50.8    2e-05   Eucalyptus grandis [rose gum]
ref|XP_009355877.1|  PREDICTED: probable polygalacturonase At3g15720  50.8    2e-05   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like             51.2    2e-05   
emb|CBI36306.3|  unnamed protein product                              51.2    2e-05   Vitis vinifera
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like             50.8    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010654935.1|  PREDICTED: probable polygalacturonase At3g15720  51.2    2e-05   
gb|KFK40772.1|  hypothetical protein AALP_AA2G039100                  51.2    2e-05   Arabis alpina [alpine rockcress]
emb|CDY39404.1|  BnaAnng05350D                                        50.8    2e-05   Brassica napus [oilseed rape]
ref|XP_006353138.1|  PREDICTED: polygalacturonase-like                50.8    3e-05   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like             50.8    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010450754.1|  PREDICTED: probable polygalacturonase At1g80170  50.8    3e-05   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like             50.8    3e-05   Eucalyptus grandis [rose gum]
gb|ABD28723.1|  Glycoside hydrolase, family 28                        50.8    3e-05   Medicago truncatula
gb|AAL30418.1|AF434714_1  dehiscence-related endopolygalaturonase     50.8    3e-05   Glycine max [soybeans]
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like             50.8    3e-05   Eucalyptus grandis [rose gum]
emb|CDY17906.1|  BnaC04g03130D                                        50.8    3e-05   Brassica napus [oilseed rape]
gb|KFK42901.1|  hypothetical protein AALP_AA1G053200                  51.2    3e-05   Arabis alpina [alpine rockcress]
gb|KDP29312.1|  hypothetical protein JCGZ_19407                       50.8    3e-05   Jatropha curcas
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  50.4    3e-05   
gb|KHN22454.1|  Putative polygalacturonase                            50.8    3e-05   Glycine soja [wild soybean]
ref|XP_003546050.2|  PREDICTED: probable polygalacturonase At1g80...  50.8    3e-05   
gb|AFW83378.1|  hypothetical protein ZEAMMB73_073291                  50.1    3e-05   
ref|XP_003528555.2|  PREDICTED: polygalacturonase-like                50.8    3e-05   
emb|CDY65225.1|  BnaCnng46160D                                        48.5    3e-05   Brassica napus [oilseed rape]
gb|AFW83380.1|  hypothetical protein ZEAMMB73_073291                  50.1    3e-05   
gb|KDO45234.1|  hypothetical protein CISIN_1g013309mg                 50.4    3e-05   Citrus sinensis [apfelsine]
ref|XP_010937534.1|  PREDICTED: polygalacturonase-like                50.8    3e-05   
ref|XP_010025868.1|  PREDICTED: polygalacturonase-like                50.4    3e-05   Eucalyptus grandis [rose gum]
emb|CAN62658.1|  hypothetical protein VITISV_039094                   50.4    3e-05   Vitis vinifera
ref|XP_009766215.1|  PREDICTED: polygalacturonase-like                50.4    3e-05   Nicotiana sylvestris
ref|XP_006418000.1|  hypothetical protein EUTSA_v10007830mg           50.4    3e-05   Eutrema salsugineum [saltwater cress]
gb|KHN42968.1|  Polygalacturonase                                     50.4    3e-05   Glycine soja [wild soybean]
gb|KEH23656.1|  endo polygalacturonase                                50.4    3e-05   Medicago truncatula
ref|NP_001275837.1|  polygalacturonase precursor                      50.4    4e-05   Citrus sinensis [apfelsine]
ref|XP_009605359.1|  PREDICTED: polygalacturonase-like                50.4    4e-05   Nicotiana tomentosiformis
gb|KDO45233.1|  hypothetical protein CISIN_1g013309mg                 50.4    4e-05   Citrus sinensis [apfelsine]
ref|XP_010485180.1|  PREDICTED: polygalacturonase-like isoform X2     50.1    4e-05   
ref|XP_009135455.1|  PREDICTED: probable polygalacturonase At3g15720  50.4    4e-05   Brassica rapa
ref|XP_006411455.1|  hypothetical protein EUTSA_v10016680mg           50.4    4e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010324757.1|  PREDICTED: polygalacturonase-like                50.4    4e-05   
ref|XP_010533165.1|  PREDICTED: probable polygalacturonase At3g15...  50.1    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_002863541.1|  glycoside hydrolase family 28 protein            50.1    4e-05   
ref|XP_009142785.1|  PREDICTED: polygalacturonase ADPG2-like          50.4    4e-05   Brassica rapa
ref|XP_010248280.1|  PREDICTED: polygalacturonase-like                48.1    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...  50.1    4e-05   Prunus mume [ume]
ref|XP_006342403.1|  PREDICTED: exopolygalacturonase-like             50.1    4e-05   
ref|XP_010457659.1|  PREDICTED: polygalacturonase-like isoform X1     50.1    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006302097.1|  hypothetical protein CARUB_v10020088mg           50.4    5e-05   
ref|XP_010533164.1|  PREDICTED: probable polygalacturonase At3g15...  50.1    5e-05   Tarenaya hassleriana [spider flower]
gb|EEC70025.1|  hypothetical protein OsI_00592                        49.3    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010457660.1|  PREDICTED: polygalacturonase-like isoform X2     49.7    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010485172.1|  PREDICTED: polygalacturonase-like isoform X1     50.1    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006372694.1|  polygalacturonase family protein                 50.1    5e-05   Populus trichocarpa [western balsam poplar]
emb|CDY47808.1|  BnaC07g07010D                                        50.1    5e-05   Brassica napus [oilseed rape]
ref|XP_009360500.1|  PREDICTED: probable polygalacturonase At3g15720  50.1    5e-05   
emb|CDY47212.1|  BnaC09g14610D                                        50.4    5e-05   Brassica napus [oilseed rape]
ref|XP_006306433.1|  hypothetical protein CARUB_v10012375mg           50.1    5e-05   Capsella rubella
ref|XP_004169597.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  50.1    5e-05   
ref|XP_004289976.1|  PREDICTED: polygalacturonase-like isoform X1     50.1    5e-05   Fragaria vesca subsp. vesca
ref|XP_011458024.1|  PREDICTED: polygalacturonase-like isoform X2     50.1    5e-05   Fragaria vesca subsp. vesca
ref|XP_010526688.1|  PREDICTED: polygalacturonase                     49.7    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like             50.1    5e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002524365.1|  Polygalacturonase precursor, putative            49.7    6e-05   
emb|CDY50367.1|  BnaA09g13160D                                        50.1    6e-05   Brassica napus [oilseed rape]
ref|XP_009781155.1|  PREDICTED: probable polygalacturonase At1g80170  49.7    6e-05   Nicotiana sylvestris
ref|XP_004498711.1|  PREDICTED: probable polygalacturonase At3g15...  49.7    6e-05   
ref|XP_010451040.1|  PREDICTED: probable polygalacturonase At3g15720  49.7    6e-05   Camelina sativa [gold-of-pleasure]
emb|CDX97704.1|  BnaA05g23750D                                        49.7    6e-05   
ref|NP_564758.2|  pectin lyase-like protein                           50.1    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009775639.1|  PREDICTED: polygalacturonase-like                49.7    6e-05   Nicotiana sylvestris
ref|XP_008802072.1|  PREDICTED: polygalacturonase-like                49.7    6e-05   Phoenix dactylifera
ref|XP_004502362.1|  PREDICTED: probable polygalacturonase At3g15...  49.7    6e-05   Cicer arietinum [garbanzo]
ref|XP_010475274.1|  PREDICTED: polygalacturonase-like isoform X2     49.7    6e-05   
ref|XP_007157814.1|  hypothetical protein PHAVU_002G100400g           49.7    6e-05   Phaseolus vulgaris [French bean]
ref|XP_008394260.1|  PREDICTED: polygalacturonase                     49.7    6e-05   Malus domestica [apple tree]
ref|XP_009416672.1|  PREDICTED: polygalacturonase-like                49.3    7e-05   
ref|XP_006353136.1|  PREDICTED: polygalacturonase-like                49.7    7e-05   Solanum tuberosum [potatoes]
ref|XP_010417992.1|  PREDICTED: polygalacturonase At1g48100-like      49.7    7e-05   Camelina sativa [gold-of-pleasure]
emb|CDY30107.1|  BnaC05g37550D                                        49.7    7e-05   Brassica napus [oilseed rape]
ref|XP_004150164.1|  PREDICTED: sister chromatid cohesion 1 prote...  50.1    7e-05   
ref|XP_010473235.1|  PREDICTED: polygalacturonase At1g48100-like      49.7    7e-05   Camelina sativa [gold-of-pleasure]
gb|AAL31197.1|  At1g60590/F8A5_12                                     49.7    7e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004251989.1|  PREDICTED: polygalacturonase-like                49.7    7e-05   Solanum lycopersicum
ref|XP_009121649.1|  PREDICTED: polygalacturonase At1g48100 isofo...  49.7    7e-05   Brassica rapa
emb|CDY39291.1|  BnaC06g27000D                                        49.7    7e-05   Brassica napus [oilseed rape]
ref|XP_010510936.1|  PREDICTED: polygalacturonase At1g48100-like      49.7    7e-05   Camelina sativa [gold-of-pleasure]
gb|KEH18027.1|  polygalacturonase                                     49.7    7e-05   Medicago truncatula
ref|XP_008460791.1|  PREDICTED: polygalacturonase-like                49.7    7e-05   Cucumis melo [Oriental melon]
emb|CDX69569.1|  BnaA10g19180D                                        49.7    7e-05   
ref|XP_008390405.1|  PREDICTED: polygalacturonase At1g48100           49.7    7e-05   
gb|EEE68484.1|  hypothetical protein OsJ_26895                        49.3    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241947.1|  PREDICTED: polygalacturonase ADPG1-like          49.7    7e-05   
ref|XP_009121648.1|  PREDICTED: polygalacturonase At1g48100 isofo...  49.7    7e-05   Brassica rapa
ref|NP_001061556.1|  Os08g0327200                                     49.7    7e-05   
ref|XP_004244826.1|  PREDICTED: polygalacturonase-like                49.3    7e-05   Solanum lycopersicum
ref|XP_010475273.1|  PREDICTED: polygalacturonase-like isoform X1     49.3    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009592870.1|  PREDICTED: polygalacturonase-like                49.3    7e-05   Nicotiana tomentosiformis
emb|CDY56952.1|  BnaC04g56090D                                        49.3    8e-05   Brassica napus [oilseed rape]
ref|XP_008452143.1|  PREDICTED: exopolygalacturonase                  49.3    8e-05   
gb|KFK37027.1|  hypothetical protein AALP_AA4G202700                  49.3    8e-05   Arabis alpina [alpine rockcress]
emb|CDY07444.1|  BnaA07g25230D                                        49.3    8e-05   Brassica napus [oilseed rape]
emb|CDY09873.1|  BnaC09g42880D                                        49.7    8e-05   Brassica napus [oilseed rape]
emb|CDX74418.1|  BnaA04g09710D                                        49.3    8e-05   
ref|XP_010659392.1|  PREDICTED: polygalacturonase-like                49.7    8e-05   Vitis vinifera
ref|XP_010654779.1|  PREDICTED: probable polygalacturonase At3g15720  49.3    8e-05   Vitis vinifera
ref|XP_010101340.1|  hypothetical protein L484_020355                 47.4    8e-05   
ref|NP_191310.1|  polygalacturonase ADPG1                             49.3    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003632896.1|  PREDICTED: probable polygalacturonase At3g15720  49.3    8e-05   Vitis vinifera
gb|KFK33181.1|  hypothetical protein AALP_AA6G340800                  50.1    8e-05   Arabis alpina [alpine rockcress]
ref|XP_008337131.1|  PREDICTED: probable polygalacturonase At3g15720  49.3    8e-05   
ref|XP_006399978.1|  hypothetical protein EUTSA_v10013501mg           49.3    8e-05   
ref|XP_007134317.1|  hypothetical protein PHAVU_010G037100g           49.3    8e-05   Phaseolus vulgaris [French bean]
ref|XP_008243063.1|  PREDICTED: polygalacturonase                     49.3    9e-05   Prunus mume [ume]
ref|XP_008779497.1|  PREDICTED: polygalacturonase ADPG1-like          48.1    9e-05   Phoenix dactylifera
ref|XP_009766217.1|  PREDICTED: polygalacturonase-like                49.3    9e-05   Nicotiana sylvestris
gb|KHG01626.1|  hypothetical protein F383_22075                       49.3    9e-05   
ref|XP_011093565.1|  PREDICTED: probable polygalacturonase At1g80170  49.3    9e-05   
ref|XP_010695816.1|  PREDICTED: polygalacturonase At1g48100           49.3    9e-05   
ref|XP_009602195.1|  PREDICTED: polygalacturonase-like                49.3    9e-05   
ref|XP_010914021.1|  PREDICTED: polygalacturonase ADPG1-like          49.3    9e-05   
gb|KJB65353.1|  hypothetical protein B456_010G091200                  49.3    9e-05   
ref|XP_004510272.1|  PREDICTED: probable polygalacturonase At3g15...  48.9    9e-05   
emb|CDY44257.1|  BnaC03g24490D                                        49.3    9e-05   
gb|KGN58367.1|  hypothetical protein Csa_3G629740                     48.5    9e-05   
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg           49.3    9e-05   
emb|CBI24904.3|  unnamed protein product                              49.3    1e-04   
ref|XP_008787364.1|  PREDICTED: probable polygalacturonase At3g15720  48.9    1e-04   
gb|ABV25004.1|  polygalacturonase 7                                   48.9    1e-04   
ref|NP_001284447.1|  polygalacturonase QRT2 precursor                 49.3    1e-04   
gb|EEE64806.1|  hypothetical protein OsJ_19662                        49.3    1e-04   
gb|EEC79746.1|  hypothetical protein OsI_21117                        49.3    1e-04   
ref|XP_006285343.1|  hypothetical protein CARUB_v10006733mg           48.9    1e-04   
ref|XP_004510830.1|  PREDICTED: exopolygalacturonase-like             48.9    1e-04   
emb|CDY23407.1|  BnaC04g49350D                                        48.9    1e-04   
emb|CDP19166.1|  unnamed protein product                              48.9    1e-04   
ref|XP_004969270.1|  PREDICTED: polygalacturonase At1g48100-like      49.3    1e-04   
ref|XP_002456022.1|  hypothetical protein SORBIDRAFT_03g029030        49.3    1e-04   
ref|XP_009116452.1|  PREDICTED: polygalacturonase ADPG1 isoform X2    48.9    1e-04   
ref|XP_011014846.1|  PREDICTED: probable polygalacturonase At1g80...  49.3    1e-04   
ref|XP_009116451.1|  PREDICTED: polygalacturonase ADPG1 isoform X1    48.9    1e-04   
emb|CBI15274.3|  unnamed protein product                              48.9    1e-04   
ref|XP_010494002.1|  PREDICTED: probable polygalacturonase At3g15720  48.9    1e-04   
ref|XP_011014845.1|  PREDICTED: probable polygalacturonase At1g80...  48.9    1e-04   
emb|CDY38146.1|  BnaA07g02370D                                        48.9    1e-04   
ref|XP_002529093.1|  Polygalacturonase precursor, putative            48.5    1e-04   
ref|XP_011011219.1|  PREDICTED: polygalacturonase At1g48100-like      48.9    1e-04   
ref|XP_004172796.1|  PREDICTED: polygalacturonase At1g48100-like      47.0    1e-04   
ref|XP_006378559.1|  hypothetical protein POPTR_0010s16180g           48.9    1e-04   
gb|KEH23657.1|  endo polygalacturonase                                48.9    1e-04   
gb|AAT39158.1|  putative polygalacturonase                            49.3    1e-04   
ref|XP_010270548.1|  PREDICTED: exopolygalacturonase-like             48.9    1e-04   
ref|XP_006405582.1|  hypothetical protein EUTSA_v10028331mg           48.9    1e-04   
ref|XP_010024123.1|  PREDICTED: polygalacturonase                     48.9    1e-04   
emb|CDY30105.1|  BnaC05g37570D                                        48.9    1e-04   
ref|XP_011462050.1|  PREDICTED: exopolygalacturonase-like             48.9    1e-04   
gb|KGN53827.1|  hypothetical protein Csa_4G153300                     47.0    1e-04   
emb|CAD21651.2|  endo polygalacturonase                               48.9    1e-04   
ref|XP_007022170.1|  Pectin lyase-like superfamily protein, putative  48.9    1e-04   
gb|ABV25000.1|  polygalacturonase 3                                   48.9    1e-04   
ref|XP_004251990.1|  PREDICTED: polygalacturonase-like                48.9    1e-04   
ref|NP_001148771.1|  polygalacturonase precursor                      48.9    1e-04   
ref|XP_007203325.1|  hypothetical protein PRUPE_ppa020072mg           48.9    1e-04   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...  48.9    1e-04   
ref|XP_003629422.1|  Polygalacturonase                                48.5    1e-04   
emb|CAA65072.1|  polygalacturonase                                    48.9    1e-04   
gb|ACN35722.1|  unknown                                               48.9    1e-04   
ref|XP_009142975.1|  PREDICTED: polygalacturonase-like                48.9    1e-04   
emb|CDY61868.1|  BnaCnng38530D                                        48.9    1e-04   
ref|XP_009343654.1|  PREDICTED: polygalacturonase                     48.9    1e-04   
emb|CDY67726.1|  BnaAnng25080D                                        48.9    1e-04   
ref|XP_009104062.1|  PREDICTED: polygalacturonase ADPG1               48.9    1e-04   
ref|XP_006364199.1|  PREDICTED: probable polygalacturonase At1g80...  48.9    1e-04   
gb|KGN45123.1|  hypothetical protein Csa_7G427620                     48.9    1e-04   
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like             48.9    1e-04   
gb|EEE53960.1|  hypothetical protein OsJ_00563                        48.9    1e-04   
gb|KHN20494.1|  Polygalacturonase                                     48.5    1e-04   
ref|XP_004504535.1|  PREDICTED: probable polygalacturonase At3g15...  48.5    1e-04   
gb|KHN27445.1|  Polygalacturonase                                     48.9    1e-04   
emb|CDP21874.1|  unnamed protein product                              48.9    1e-04   
gb|AET03898.2|  pectin lyase superfamily protein                      48.5    1e-04   
gb|KJB70598.1|  hypothetical protein B456_011G082200                  48.5    1e-04   
ref|XP_003615080.1|  Polygalacturonase                                48.5    1e-04   
ref|XP_004502365.1|  PREDICTED: probable polygalacturonase At3g15...  48.5    1e-04   
ref|XP_010672497.1|  PREDICTED: polygalacturonase-like                48.5    1e-04   
gb|KJB11522.1|  hypothetical protein B456_001G263400                  48.9    1e-04   
ref|NP_001280857.1|  polygalacturonase precursor                      48.9    1e-04   
ref|XP_006296610.1|  hypothetical protein CARUB_v10013685mg           48.9    1e-04   
gb|KHN23520.1|  Polygalacturonase                                     48.5    1e-04   
ref|XP_009142232.1|  PREDICTED: polygalacturonase-like                48.5    1e-04   
ref|NP_001238091.1|  polygalacturonase PG1 precursor                  48.5    1e-04   
gb|ACU24545.1|  unknown                                               48.5    1e-04   
ref|XP_007151017.1|  hypothetical protein PHAVU_004G011800g           48.5    2e-04   
ref|XP_004144456.1|  PREDICTED: polygalacturonase-like                48.5    2e-04   
ref|XP_003613981.1|  Polygalacturonase                                48.5    2e-04   
gb|KJB70599.1|  hypothetical protein B456_011G082200                  48.5    2e-04   
gb|KDP29562.1|  hypothetical protein JCGZ_19275                       48.5    2e-04   
ref|XP_004135935.1|  PREDICTED: polygalacturonase QRT2-like           48.5    2e-04   
ref|XP_004489256.1|  PREDICTED: polygalacturonase At1g48100-like      48.5    2e-04   
ref|XP_009113198.1|  PREDICTED: polygalacturonase At1g48100           48.9    2e-04   
ref|XP_004144459.1|  PREDICTED: polygalacturonase-like                48.5    2e-04   
ref|XP_003549272.1|  PREDICTED: probable polygalacturonase At3g15...  48.5    2e-04   
ref|XP_004162654.1|  PREDICTED: polygalacturonase-like                48.5    2e-04   
ref|XP_003626752.1|  Polygalacturonase                                48.1    2e-04   
ref|XP_009146203.1|  PREDICTED: probable polygalacturonase At3g15720  48.5    2e-04   
gb|KEH18030.1|  polygalacturonase                                     48.1    2e-04   
ref|XP_007134319.1|  hypothetical protein PHAVU_010G037300g           48.1    2e-04   
gb|KDO72475.1|  hypothetical protein CISIN_1g041470mg                 48.1    2e-04   
ref|XP_004510273.1|  PREDICTED: probable polygalacturonase At3g15...  48.1    2e-04   
ref|XP_002529095.1|  Polygalacturonase precursor, putative            48.1    2e-04   
ref|XP_010319103.1|  PREDICTED: probable polygalacturonase At3g15720  48.1    2e-04   
ref|XP_009149158.1|  PREDICTED: exopolygalacturonase isoform X1       48.1    2e-04   
ref|XP_002312305.1|  hypothetical protein POPTR_0008s09990g           48.5    2e-04   
tpg|DAA58413.1|  TPA: polygalacturonase                               48.5    2e-04   
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like             48.1    2e-04   
gb|KEH17966.1|  polygalacturonase                                     48.1    2e-04   
ref|XP_007034396.1|  Pectin lyase superfamily protein, putative i...  48.1    2e-04   
ref|XP_002886607.1|  hypothetical protein ARALYDRAFT_893483           48.5    2e-04   
gb|KCW56166.1|  hypothetical protein EUGRSUZ_I01918                   48.1    2e-04   
emb|CDY06100.1|  BnaA09g36800D                                        48.5    2e-04   
gb|AER27666.1|  polygalacturonase                                     48.5    2e-04   
ref|XP_009418868.1|  PREDICTED: polygalacturonase ADPG1-like          48.1    2e-04   
dbj|BAD68111.1|  putative polygalacturonase                           48.5    2e-04   
ref|XP_007214724.1|  hypothetical protein PRUPE_ppa026186mg           48.1    2e-04   
gb|KHN45274.1|  Putative polygalacturonase                            47.4    2e-04   
gb|EPS62761.1|  hypothetical protein M569_12028                       47.4    2e-04   
gb|KDP33149.1|  hypothetical protein JCGZ_13541                       48.1    2e-04   
emb|CAH18929.1|  polygalacturonase                                    48.5    2e-04   
ref|XP_009802084.1|  PREDICTED: probable polygalacturonase At1g80170  48.1    2e-04   
ref|XP_009336112.1|  PREDICTED: polygalacturonase-like                48.1    2e-04   
ref|XP_011013806.1|  PREDICTED: polygalacturonase At1g48100-like      48.5    2e-04   
ref|XP_010030771.1|  PREDICTED: probable polygalacturonase At1g80170  48.1    2e-04   
ref|XP_011019224.1|  PREDICTED: polygalacturonase At1g48100           48.1    2e-04   
gb|AHG12641.1|  polygalacturonase                                     48.1    2e-04   
gb|KEH25592.1|  polygalacturonase                                     48.1    2e-04   
gb|KDO74905.1|  hypothetical protein CISIN_1g043588mg                 48.1    2e-04   
ref|XP_009133429.1|  PREDICTED: exopolygalacturonase-like             48.1    2e-04   
ref|XP_002529092.1|  Polygalacturonase precursor, putative            48.1    2e-04   
ref|XP_007134337.1|  hypothetical protein PHAVU_010G039000g           47.8    2e-04   
ref|XP_009607379.1|  PREDICTED: polygalacturonase-like                48.1    2e-04   
gb|AFK43754.1|  unknown                                               48.1    2e-04   
ref|XP_009594191.1|  PREDICTED: probable polygalacturonase At1g80170  48.1    2e-04   
ref|XP_010530306.1|  PREDICTED: polygalacturonase-like                48.1    2e-04   
ref|XP_008443532.1|  PREDICTED: polygalacturonase At1g48100           48.1    2e-04   
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like             48.1    2e-04   
ref|XP_008343885.1|  PREDICTED: polygalacturonase-like                48.1    2e-04   
ref|XP_004141101.1|  PREDICTED: polygalacturonase At1g48100-like      48.1    2e-04   
gb|KJB78532.1|  hypothetical protein B456_013G003900                  48.1    2e-04   
ref|XP_007034395.1|  Pectin lyase superfamily protein, putative i...  48.1    2e-04   
gb|KDP29564.1|  hypothetical protein JCGZ_19277                       48.1    2e-04   
ref|XP_008365049.1|  PREDICTED: probable polygalacturonase At1g80170  48.1    2e-04   
ref|XP_004500601.1|  PREDICTED: probable polygalacturonase At3g15...  48.1    2e-04   
ref|XP_009343655.1|  PREDICTED: polygalacturonase-like                48.1    2e-04   
ref|XP_004499458.1|  PREDICTED: exopolygalacturonase-like             48.1    2e-04   
emb|CDY58462.1|  BnaA03g57500D                                        48.1    2e-04   
ref|XP_006577602.1|  PREDICTED: probable polygalacturonase At3g15...  48.1    2e-04   
ref|XP_011098761.1|  PREDICTED: polygalacturonase At1g48100           48.1    2e-04   
ref|XP_009758144.1|  PREDICTED: polygalacturonase-like                47.8    2e-04   
ref|XP_006493145.1|  PREDICTED: polygalacturonase-like                47.8    2e-04   
ref|XP_007153746.1|  hypothetical protein PHAVU_003G061600g           48.1    2e-04   
emb|CDY07609.1|  BnaA03g19020D                                        47.8    2e-04   
ref|NP_001152243.1|  polygalacturonase precursor                      47.8    2e-04   
ref|XP_008444050.1|  PREDICTED: polygalacturonase-like                47.4    3e-04   
gb|ACR38466.1|  unknown                                               47.8    3e-04   
ref|XP_008226319.1|  PREDICTED: exopolygalacturonase                  47.8    3e-04   
emb|CDY39399.1|  BnaAnng05300D                                        47.8    3e-04   
ref|XP_008243707.1|  PREDICTED: probable polygalacturonase At1g80170  48.1    3e-04   
ref|XP_010061913.1|  PREDICTED: probable polygalacturonase At3g15720  47.8    3e-04   
ref|XP_010251524.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
gb|KJB78529.1|  hypothetical protein B456_013G004900                  47.8    3e-04   
ref|XP_006483708.1|  PREDICTED: probable polygalacturonase At3g15...  48.1    3e-04   
gb|AFW76314.1|  hypothetical protein ZEAMMB73_313945                  47.8    3e-04   
ref|XP_003552026.1|  PREDICTED: polygalacturonase At1g48100-like ...  48.1    3e-04   
gb|KDO51599.1|  hypothetical protein CISIN_1g037377mg                 47.8    3e-04   
ref|XP_004502247.1|  PREDICTED: probable polygalacturonase At3g15...  47.8    3e-04   
ref|XP_010654934.1|  PREDICTED: probable polygalacturonase At3g15720  47.8    3e-04   
emb|CBI36303.3|  unnamed protein product                              47.8    3e-04   
ref|XP_008226539.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
gb|KDP33604.1|  hypothetical protein JCGZ_07175                       45.4    3e-04   
ref|XP_006427234.1|  hypothetical protein CICLE_v10027523mg           47.8    3e-04   
ref|XP_006397560.1|  hypothetical protein EUTSA_v10001483mg           47.8    3e-04   
ref|NP_001289214.1|  polygalacturonase precursor                      47.8    3e-04   
gb|KDO61713.1|  hypothetical protein CISIN_1g037736mg                 47.8    3e-04   
gb|KDO51591.1|  hypothetical protein CISIN_1g041993mg                 47.8    3e-04   
dbj|BAB10216.1|  polygalacturonase-like protein                       47.8    3e-04   
gb|KEH18031.1|  polygalacturonase                                     47.8    3e-04   
ref|XP_010475275.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
ref|XP_006450449.1|  hypothetical protein CICLE_v10010440mg           47.8    3e-04   
ref|XP_006493140.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
gb|KJB78533.1|  hypothetical protein B456_013G004000                  47.4    3e-04   
ref|XP_009413595.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
gb|KEH41561.1|  endo polygalacturonase                                47.8    3e-04   
ref|XP_002892306.1|  hypothetical protein ARALYDRAFT_887757           47.8    3e-04   
ref|XP_007023162.1|  JHL06P13.4 protein, putative                     47.8    3e-04   
ref|XP_007026504.1|  Polygalacturonase                                47.8    3e-04   
dbj|BAK07253.1|  predicted protein                                    47.8    3e-04   
ref|XP_004502364.1|  PREDICTED: probable polygalacturonase At3g15...  47.8    3e-04   
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710        47.8    3e-04   
ref|NP_001234533.1|  abscission polygalacturonase precursor           47.8    3e-04   
gb|KJB61027.1|  hypothetical protein B456_009G336100                  47.8    3e-04   
gb|KHN27443.1|  Polygalacturonase                                     47.4    3e-04   
gb|ADN33764.1|  polygalacturonase                                     47.4    3e-04   
ref|NP_181915.1|  putative polygalacturonase /pectinase               47.8    3e-04   
ref|XP_010468193.1|  PREDICTED: probable polygalacturonase At3g15720  46.6    3e-04   
emb|CDX95574.1|  BnaC03g24550D                                        47.8    3e-04   
gb|ABK28534.1|  unknown                                               47.8    3e-04   
ref|XP_006493150.1|  PREDICTED: putative disease resistance prote...  48.1    3e-04   
ref|XP_009416030.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
gb|EYU35886.1|  hypothetical protein MIMGU_mgv1a018285mg              47.8    3e-04   
dbj|BAC22688.1|  polygalacturonase                                    47.8    3e-04   
ref|XP_009757689.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
ref|XP_006357141.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
gb|ABV25002.1|  polygalacturonase 5                                   47.8    3e-04   
gb|KJB78534.1|  hypothetical protein B456_013G004100                  47.8    3e-04   
sp|P48978.1|PGLR_MALDO  RecName: Full=Polygalacturonase; Short=PG...  47.8    3e-04   
ref|XP_002878158.1|  endo-polygalacturonase 1                         47.8    3e-04   
ref|XP_004517040.1|  PREDICTED: probable polygalacturonase At3g15...  47.4    3e-04   
ref|XP_010646901.1|  PREDICTED: polygalacturonase-like                47.4    3e-04   
ref|XP_006353137.1|  PREDICTED: polygalacturonase-like                47.8    3e-04   
ref|XP_006406925.1|  hypothetical protein EUTSA_v10020740mg           47.8    3e-04   
ref|XP_007216032.1|  hypothetical protein PRUPE_ppa014982mg           47.8    3e-04   
ref|XP_006493146.1|  PREDICTED: polygalacturonase-like                47.4    3e-04   
emb|CBI24903.3|  unnamed protein product                              47.8    3e-04   
gb|KDO51598.1|  hypothetical protein CISIN_1g041973mg                 47.4    3e-04   
ref|XP_004515677.1|  PREDICTED: probable polygalacturonase At3g15...  47.4    3e-04   
gb|EPS67779.1|  polygalacturonase                                     47.8    3e-04   
gb|KJB78513.1|  hypothetical protein B456_013G004800                  47.4    3e-04   
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg           47.4    3e-04   
ref|XP_007134318.1|  hypothetical protein PHAVU_010G037200g           47.4    3e-04   
ref|XP_009619865.1|  PREDICTED: probable polygalacturonase At3g15720  47.4    3e-04   
ref|XP_009133644.1|  PREDICTED: polygalacturonase-like                47.4    3e-04   
ref|XP_007134325.1|  hypothetical protein PHAVU_010G037900g           47.4    3e-04   
ref|NP_199297.1|  glycoside hydrolase family 28 protein / polygal...  47.4    3e-04   
emb|CAI64503.1|  endopolygalacturonase                                47.4    4e-04   
ref|NP_198807.1|  pectin lyase-like superfamily protein               47.4    4e-04   
gb|ABV25001.1|  polygalacturonase 4                                   47.8    4e-04   
ref|XP_011073040.1|  PREDICTED: exopolygalacturonase-like             47.8    4e-04   



>ref|XP_009606258.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
 ref|XP_009606259.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
Length=420

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 8/61 (13%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVS-------CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            Y+M+  V LFILGL ++SR+S         SFNV+DYGA  DG+TDDSQAFLNAW DACS
Sbjct  8    YTMKTLVLLFILGL-TNSRISYASIIGYAGSFNVLDYGAAADGITDDSQAFLNAWNDACS  66

Query  225  S  227
            S
Sbjct  67   S  67



>ref|XP_009767751.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
 ref|XP_009767752.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
Length=418

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 6/60 (10%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISS--SRVS----CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            Y+M+  V LFILGL +S  S  S      SFNV+DYGA  DG+TDDSQAFLNAW DACSS
Sbjct  8    YTMKTLVILFILGLRNSGISYASIIGYAGSFNVLDYGAAADGITDDSQAFLNAWNDACSS  67



>ref|XP_004252072.1| PREDICTED: polygalacturonase QRT2 [Solanum lycopersicum]
Length=416

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            Y+M+  VFLFIL  +S+SR+   S       FNV+DYGA  DG+TDDSQA LN W DACS
Sbjct  8    YTMKNLVFLFILIGLSNSRIYSASIYGYPGSFNVLDYGAAADGITDDSQALLNTWNDACS  67

Query  225  ST  230
            S+
Sbjct  68   SS  69



>ref|XP_006345284.1| PREDICTED: polygalacturonase QRT2-like [Solanum tuberosum]
Length=439

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 7/61 (11%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ++++ V LFIL  +++SR+   S       FNV+DYGA  DG+TDDSQA LN W DACSS
Sbjct  32   ALKILVLLFILIGLTNSRIYSASIFGYPGSFNVLDYGAAADGITDDSQALLNTWNDACSS  91

Query  228  T  230
            +
Sbjct  92   S  92



>ref|NP_001238514.1| polygalacturonase gene specific to nodule precursor [Glycine 
max]
 gb|AAY21050.1| truncated PGN [Glycine max]
Length=119

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            SFNVIDYGA G+G TDDSQAFL AWKDAC+++
Sbjct  29   SFNVIDYGATGNGQTDDSQAFLKAWKDACNAS  60



>gb|AAY21051.1| truncated PGN [Glycine max]
Length=161

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            SFNVIDYGA G+G TDDSQAFL AWKDAC+++
Sbjct  29   SFNVIDYGATGNGQTDDSQAFLKAWKDACNAS  60



>gb|EPS70858.1| polygalacturonase, partial [Genlisea aurea]
Length=170

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 2/39 (5%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            SSR+  +S NV+D+GAKGDG+TDDS+A LNAWK+ACSS+
Sbjct  51   SSRI--RSINVLDFGAKGDGVTDDSKALLNAWKEACSSS  87



>gb|KGN52445.1| hypothetical protein Csa_5G635400 [Cucumis sativus]
Length=412

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 7/57 (12%)
 Frame = +3

Query  72   MEVFVFLFILGL----ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            ME+F  + I+ L    I+SS    K+FNV+DYGA GDG T+D+QAFL+AWK AC S+
Sbjct  1    MELFFLILIISLQFLQINSSS---KTFNVLDYGAVGDGNTEDTQAFLDAWKAACKSS  54



>ref|XP_011078328.1| PREDICTED: polygalacturonase-like isoform X3 [Sesamum indicum]
Length=349

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +F+F     L+++  +   +FNV+DYGA  D +TDDSQAFL AW DACS++
Sbjct  10   IFLFTSATSLLNAHEIDEDNFNVMDYGATSDDLTDDSQAFLEAWDDACSAS  60



>gb|KHN43850.1| Putative polygalacturonase [Glycine soja]
Length=402

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            SFNVIDYGA G+G TDDSQAFL AWKDAC+++
Sbjct  29   SFNVIDYGATGNGQTDDSQAFLKAWKDACNAS  60



>gb|AAY21049.1| PGN [Glycine max]
Length=402

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            SFNVIDYGA G+G TDDSQAFL AWKDAC+++
Sbjct  29   SFNVIDYGATGNGQTDDSQAFLKAWKDACNAS  60



>ref|XP_011078321.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078322.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078324.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078325.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
Length=408

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +F+F     L+++  +   +FNV+DYGA  D +TDDSQAFL AW DACS++
Sbjct  10   IFLFTSATSLLNAHEIDEDNFNVMDYGATSDDLTDDSQAFLEAWDDACSAS  60



>ref|XP_010498061.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=401

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +      FI+G  S      K FNV  YGAKGDG TD+++AF N WKDAC+
Sbjct  8    FKVSSLTLFFIIGTTSRPTTVPKVFNVRRYGAKGDGKTDNTKAFTNTWKDACT  60



>ref|XP_003597886.1| Polygalacturonase [Medicago truncatula]
 gb|AES68137.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=404

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  63   FYSME-VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            F++ME  F  L IL +         +FNV+ YGA GDG T+DS AFL AWKD C+S
Sbjct  2    FHTMEYFFTLLMILSMFKLGLSITTTFNVLQYGAVGDGKTNDSPAFLKAWKDVCNS  57



>ref|XP_003601689.1| hypothetical protein MTR_3g084360 [Medicago truncatula]
Length=400

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  63   FYSMEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
             Y M +FV  +    L++   ++ KSFNV++YGAKGD  TDDS AFL AW++ C ST
Sbjct  7    LYLMSLFVSPISCFRLVNRKPLAQKSFNVVNYGAKGDSNTDDSNAFLKAWQEVCGST  63



>ref|XP_007134083.1| hypothetical protein PHAVU_010G0180000g, partial [Phaseolus vulgaris]
 gb|ESW06077.1| hypothetical protein PHAVU_010G0180000g, partial [Phaseolus vulgaris]
Length=92

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            S  ++NVIDYGA GDG TDDSQAFL+AW+  CS+
Sbjct  25   SANTYNVIDYGAHGDGKTDDSQAFLSAWQKTCST  58



>ref|XP_003588754.1| PGN [Medicago truncatula]
 gb|AES59005.1| polygalacturonase [Medicago truncatula]
Length=397

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 36/55 (65%), Gaps = 8/55 (15%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSF--------NVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            LFI GL+  S VSC SF        NV+ YGAKGDG +DD+QAFL AWK  C++ 
Sbjct  4    LFISGLLIFSIVSCNSFVGFSQNTFNVLQYGAKGDGTSDDTQAFLEAWKALCAAN  58



>ref|XP_003607885.1| hypothetical protein MTR_4g084050 [Medicago truncatula]
 gb|ABC75354.1| Glycoside hydrolase, family 28 [Medicago truncatula]
 gb|AES90082.1| polygalacturonase [Medicago truncatula]
Length=394

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +F+  L  + +S   C++ FNV+ YGAKGDG TDDS AF NAW+D C ST
Sbjct  4    LFVLCLIFVIASPCLCQNYFNVVKYGAKGDGHTDDSNAFTNAWQDVCGST  53



>ref|XP_007163810.1| hypothetical protein PHAVU_001G266200g [Phaseolus vulgaris]
 gb|ESW35804.1| hypothetical protein PHAVU_001G266200g [Phaseolus vulgaris]
Length=392

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = +3

Query  81   FVFLFILGLISSSR--VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            FV L  + +I+SS    S  +FNV+ YGA G+G TDD+QAFL AWKD C +T
Sbjct  6    FVLLIFVRVIASSTFCPSSLTFNVLSYGATGNGHTDDTQAFLKAWKDVCGAT  57



>ref|XP_007134323.1| hypothetical protein PHAVU_010G037700g [Phaseolus vulgaris]
 gb|ESW06317.1| hypothetical protein PHAVU_010G037700g [Phaseolus vulgaris]
Length=408

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 8/58 (14%)
 Frame = +3

Query  78   VFVFLFILGLIS--------SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +  FL ILG +S        ++R   K++NV DYGA GDG  DDS AFL AWKD C S
Sbjct  4    LITFLLILGFVSPCLCVRWNNARTQNKTYNVKDYGAYGDGKYDDSGAFLRAWKDICGS  61



>ref|XP_010667060.1| PREDICTED: polygalacturonase-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=370

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLN  203
            +I+  S  +L CC  ++  +    I+       V+ K+FNV DYGA+GDG  DD++AF  
Sbjct  13   IIVGLSYSSLLCCGRNIHGYTDDPIIIRRGLRAVNQKTFNVDDYGAQGDGSADDTKAFEK  72

Query  204  AWKDACSST  230
            AWK+ACSS+
Sbjct  73   AWKEACSSS  81



>ref|XP_004486675.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=404

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  63   FYSMEVF-VFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            F +ME+F   L I+ +I     S  +FNV+ YGA GDG  +DS AF+ AWKD C S
Sbjct  2    FDTMELFFTVLMIMSMIKPGLSSTTTFNVLQYGAIGDGKNNDSPAFVKAWKDVCQS  57



>ref|XP_010667059.1| PREDICTED: polygalacturonase-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLN  203
            +I+  S  +L CC  ++  +    I+       V+ K+FNV DYGA+GDG  DD++AF  
Sbjct  13   IIVGLSYSSLLCCGRNIHGYTDDPIIIRRGLRAVNQKTFNVDDYGAQGDGSADDTKAFEK  72

Query  204  AWKDACSST  230
            AWK+ACSS+
Sbjct  73   AWKEACSSS  81



>ref|XP_007020651.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY12176.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=416

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +3

Query  30   LSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAW  209
            + +S  +++ CF  M   +F+F+ G       +   FNV+ YGA GDG TD+S+AF NAW
Sbjct  1    MGSSSNSVFQCFLFM---MFMFLYGNQQVQAAAANLFNVLQYGASGDGKTDNSKAFTNAW  57

Query  210  KDACSS  227
            K AC S
Sbjct  58   KQACQS  63



>gb|KHN27820.1| Polygalacturonase ADPG2 [Glycine soja]
Length=96

 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            VF+  FI+       V   + +NVI+YGAKGDG +DDSQAFL AW+  C +
Sbjct  8    VFILAFIISPYLCHSVGTNTIYNVINYGAKGDGRSDDSQAFLRAWQSTCGA  58



>ref|XP_010445851.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=134

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ME+ +  +F L L++S  V+ + ++V+ +GAKGDG+TD+S+AF+ AWK  C S
Sbjct  1    MEIIIRVVFFLTLLNSVLVNGQIYDVLKFGAKGDGLTDESKAFVEAWKAMCGS  53



>ref|XP_011015894.1| PREDICTED: polygalacturonase-like [Populus euphratica]
Length=343

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = +3

Query  60   CFYSMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            C  S+ +F+FL  L + ISS++ S   +NV+ YGA+ +G TD +QAFL+AW  AC ST
Sbjct  6    CIPSLLLFIFLVSLNVNISSAKTS---YNVLTYGARPNGKTDSTQAFLHAWTAACGST  60



>gb|AES71940.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=391

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  105  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            L++   ++ KSFNV++YGAKGD  TDDS AFL AW++ C ST
Sbjct  13   LVNRKPLAQKSFNVVNYGAKGDSNTDDSNAFLKAWQEVCGST  54



>ref|XP_004516611.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=399

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 9/55 (16%)
 Frame = +3

Query  90   LFILGLISSSRVSCKS---------FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            L I+GL+    VSC S         FNV+ YGAKGDG++DD+QAF  AWKD C +
Sbjct  6    LLIIGLLMFCIVSCNSWVGFCQQNTFNVLQYGAKGDGISDDTQAFEKAWKDLCGA  60



>gb|KDO45206.1| hypothetical protein CISIN_1g047411mg [Citrus sinensis]
Length=226

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +3

Query  75   EVFVFLFILGLISSS--RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            ++   L+ L LIS++  R++   FNV+D+GA GDG  DDS AF+ AW + CS+T
Sbjct  4    DLCAILYFLYLISTASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCSAT  57



>gb|AAN60351.1| unknown [Arabidopsis thaliana]
Length=185

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            I GL S  R S ++    +V D+GAKGDG TDD+QAF+NAWK ACSS
Sbjct  51   ITGLRSFVRASLRTPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSS  97



>ref|XP_006645549.1| PREDICTED: polygalacturonase QRT2-like [Oryza brachyantha]
Length=456

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 9/74 (12%)
 Frame = +3

Query  9    TIHP*LILSASIFALYCCFYSMEVFVFLFILGL--ISSSRVSCKSFNVIDYGAKGDGMTD  182
            T HP L  S  I + Y        FVFL +L L  + S  +   S NV+D+ A GDG +D
Sbjct  53   TSHPQLFNSTWIVSKY-------TFVFLLVLALRSVRSEALKRPSHNVLDFNAAGDGKSD  105

Query  183  DSQAFLNAWKDACS  224
            D+QAFL AW+  C+
Sbjct  106  DTQAFLAAWEQTCN  119



>emb|CDP14857.1| unnamed protein product [Coffea canephora]
Length=394

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSSTP  233
            M VF+ +     +  S V  +SF  NV+DYGA GDG  DD+ AF +AW+ AC+STP
Sbjct  1    MGVFIPILFAAFVLPSSVVAQSFVYNVLDYGAVGDGYNDDTNAFKHAWEAACTSTP  56



>ref|XP_006416734.1| hypothetical protein EUTSA_v10009641mg [Eutrema salsugineum]
 gb|ESQ35087.1| hypothetical protein EUTSA_v10009641mg [Eutrema salsugineum]
Length=401

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +3

Query  60   CFYSMEVFVFLFILGLISSSRV-SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            C  ++   + LFIL ++ +SR  + K+F+V  YGAKGDG+TD + AF+ AWKDAC+ +
Sbjct  3    CVTNVIEILCLFILFVVVASRPDTGKNFDVRTYGAKGDGITDSANAFMKAWKDACAQS  60



>ref|XP_004146930.1| PREDICTED: probable polygalacturonase At3g15720-like [Cucumis 
sativus]
Length=330

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +FL+ + ++SS  V   S FNV+DYGA G+G TDDS+AFL AW D C +T
Sbjct  8    IFLYSIAILSSWTVLGSSDFNVLDYGAIGNGKTDDSKAFLKAWNDVCGAT  57



>ref|XP_002881804.1| hypothetical protein ARALYDRAFT_483267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58063.1| hypothetical protein ARALYDRAFT_483267 [Arabidopsis lyrata subsp. 
lyrata]
Length=433

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            I GL S  R S ++    +V DYGAKGDG TDD+QAF+NAWK ACSS
Sbjct  51   ITGLRSFVRASLRTPTTVSVSDYGAKGDGKTDDTQAFVNAWKKACSS  97



>ref|XP_003540568.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=402

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSR-----VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +F  L+++   S SR     ++  +FNV+DYGA GDG+TDDSQAFL AW   C+
Sbjct  5    IAIFFLLYLVSHCSCSRLREAAINLNTFNVMDYGAIGDGLTDDSQAFLKAWSMVCA  60



>ref|XP_004172608.1| PREDICTED: probable polygalacturonase At3g15720-like, partial 
[Cucumis sativus]
Length=374

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +FL+ + ++SS  V   S FNV+DYGA G+G TDDS+AFL AW D C +T
Sbjct  8    IFLYSIAILSSWTVLGSSDFNVLDYGAIGNGKTDDSKAFLKAWNDVCGAT  57



>ref|XP_010324136.1| PREDICTED: exopolygalacturonase-like [Solanum lycopersicum]
Length=389

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +3

Query  93   FILGLI-SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            FI GL+   +    K FNV+ YGAK DG+TD+S+AFLNAW DAC
Sbjct  11   FIFGLVLVCTNAEEKVFNVLSYGAKADGVTDNSKAFLNAWADAC  54



>ref|XP_011014661.1| PREDICTED: polygalacturonase-like [Populus euphratica]
Length=395

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +3

Query  45   FALYCCFYSMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
             A   C  S+ +F+FL  L + ISS++ S   +NV+ YGA+ +G TD +QAFL+AW  AC
Sbjct  1    MAKLSCIPSLLLFIFLVSLNVNISSAKTS---YNVLTYGARPNGKTDSTQAFLHAWTAAC  57

Query  222  SST  230
             ST
Sbjct  58   GST  60



>gb|KGN53196.1| hypothetical protein Csa_4G025750 [Cucumis sativus]
Length=393

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +FL+ + ++SS  V   S FNV+DYGA G+G TDDS+AFL AW D C +T
Sbjct  8    IFLYSIAILSSWTVLGSSDFNVLDYGAIGNGKTDDSKAFLKAWNDVCGAT  57



>ref|XP_004306136.2| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=409

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 11/69 (16%)
 Frame = +3

Query  48   ALYCCFYSMEVFVFLFILGLISSSRV-----------SCKSFNVIDYGAKGDGMTDDSQA  194
            +L   F    VF+F+F+L  +++ +              K FNV+DYGA   G+TD+SQA
Sbjct  2    SLISSFLGFRVFLFMFLLVWVTNGQNVNLFRQTEQLGRRKFFNVMDYGAVEGGVTDNSQA  61

Query  195  FLNAWKDAC  221
            FL AWKDAC
Sbjct  62   FLKAWKDAC  70



>gb|EYU23048.1| hypothetical protein MIMGU_mgv1a026845mg, partial [Erythranthe 
guttata]
Length=383

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            FNV+DYGA GDG+TDDSQAFL AW+ AC++
Sbjct  6    FNVMDYGATGDGLTDDSQAFLEAWEAACNA  35



>ref|XP_010508675.1| PREDICTED: polygalacturonase ADPG2-like [Camelina sativa]
Length=429

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            I GL S  R S ++    +V D+GAKGDG+TDD+QAF+NAWK ACSS+
Sbjct  47   ITGLKSFVRASLRTPTTVSVSDFGAKGDGITDDTQAFVNAWKKACSSS  94



>ref|XP_009758043.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=392

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  93   FILGLISSSRVS-----CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F+L L+  S +S     C ++NV++YGA+GDG TD + AFL AW  ACSST
Sbjct  7    FLLALVFFSFISLFLPCCSAYNVVNYGARGDGRTDSTTAFLRAWSSACSST  57



>emb|CDY69377.1| BnaCnng63250D [Brassica napus]
Length=400

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  66   YSMEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            + ME+ V  +F+L L++   V+ + ++V+ +GA+GDG TDDS+AF+ AWK  CSS
Sbjct  8    HRMEIIVRVVFVLTLVNFGFVNGQIYDVLKFGAEGDGTTDDSKAFVEAWKAMCSS  62



>ref|XP_010254486.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=466

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = +3

Query  84   VFLFILGLIS-----SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            V LF+LGL S      +     SF+V+DYGA GDG TDDS+AFL AW   CSS
Sbjct  14   VLLFVLGLCSMPVCLDAAGDSTSFSVLDYGAAGDGQTDDSKAFLEAWNAMCSS  66



>gb|KGN43436.1| Polygalacturonase [Cucumis sativus]
Length=340

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F+    +GLI++++ +   F+V  YGA+ +G +DDSQA + AWKDACSST
Sbjct  12   FILFLFIGLITNAQAA--DFHVKRYGARANGNSDDSQAIMKAWKDACSST  59



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F     F+    +GLI++  V    F+V  YGA+ +G +DDSQA + AWKDACSST
Sbjct  7    FSRSTTFILFLFIGLITN--VQAVDFHVKRYGARANGNSDDSQAIMKAWKDACSST  60



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F+    +GLI++++ +   F+V  YGA+ +G +DDSQA + AWKDACSST
Sbjct  12   FILFLFIGLITNAQAA--DFHVKRYGARANGNSDDSQAIMKAWKDACSST  59



>ref|XP_008443755.1| PREDICTED: polygalacturonase-like [Cucumis melo]
Length=399

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +3

Query  78   VFVFLFILGLIS-SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            + +F+F++GL + S  V   S+NV+++G KGDG TD +QAF  AW +AC+ST
Sbjct  12   LLLFIFLVGLSNWSIFVETSSYNVVNFGGKGDGTTDSTQAFQMAWANACAST  63



>ref|XP_010318778.1| PREDICTED: probable polygalacturonase At3g15720 [Solanum lycopersicum]
Length=407

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSR-VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            FY   +  FL +L ++SS R    K+FNVID+GA GDG TDD  AFL AW+  C S
Sbjct  8    FY---LVTFLVLLCIVSSVRSADIKTFNVIDFGAVGDGRTDDLPAFLKAWEAVCQS  60



>ref|XP_007150743.1| hypothetical protein PHAVU_005G177000g [Phaseolus vulgaris]
 gb|ESW22737.1| hypothetical protein PHAVU_005G177000g [Phaseolus vulgaris]
Length=401

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            F  L IL +I+    S  + FNV+ YGA GDG T+DS AFL AWKD C S
Sbjct  5    FTVLIILSVIAPGLSSTTTTFNVLQYGAVGDGQTNDSPAFLKAWKDVCQS  54



>ref|XP_006856225.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
 gb|ERN17692.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
Length=403

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 13/64 (20%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKS------------FNVIDYGAKGDGMTDDSQAFLNAWKD  215
            ME+ V L +L L+    V C S            FNV DYGAKGDG TDD++AF++AWK+
Sbjct  1    MEIKVVL-LLCLLGIQAVECGSSSSSSLSSNYGFFNVKDYGAKGDGKTDDTKAFMDAWKE  59

Query  216  ACSS  227
            AC S
Sbjct  60   ACGS  63



>ref|NP_001233795.1| polygalacturonase precursor [Solanum lycopersicum]
 gb|AAA80489.1| polygalacturonase precursor [Solanum lycopersicum]
Length=392

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            M  F   F+L + SS   +   +NV +YGAK DG TD S+AFLNAW  AC+S
Sbjct  1    MSPFAIFFLLLIYSSLAANTNIYNVQNYGAKSDGKTDSSKAFLNAWAAACAS  52



>ref|XP_006465356.1| PREDICTED: probable polygalacturonase At1g80170 isoform X2 [Citrus 
sinensis]
Length=445

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQA  194
            ++L   +  L     S E F  L  L    S+R   KS  VI   D+GAKGDG  DD++A
Sbjct  14   IVLIHVLVCLSASLVSTEGFDSLLELPHSGSNRTRSKSKRVIFVGDFGAKGDGFNDDTEA  73

Query  195  FLNAWKDACS  224
            F NAWK ACS
Sbjct  74   FANAWKKACS  83



>ref|XP_004497875.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=403

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            FNV++YGAKGDG TDDS AFL AW+D CS+
Sbjct  35   FNVLNYGAKGDGQTDDSNAFLRAWQDVCST  64



>gb|KEH18863.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=399

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +3

Query  87   FLFILGLI-----SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            FLF+L L+     +  ++  K FNVI+YGA+ DG TD+S AFL AW DAC
Sbjct  5    FLFVLSLLVCIAEAHRQIQNKLFNVINYGARSDGNTDNSAAFLKAWSDAC  54



>emb|CDX73440.1| BnaC08g25630D [Brassica napus]
Length=400

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ME+ V  +F+L L++   ++ + ++V+ +GAKGDG TDDS+AF+ AWK  CSS
Sbjct  10   MEIIVRVVFVLTLVNFGILNGQVYDVLKFGAKGDGTTDDSEAFVEAWKAMCSS  62



>ref|XP_010494537.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=391

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ME+ +  +F+L L++S  V+ + ++V+ +GAKGDG+TD+S+AF+ AWK  C S
Sbjct  1    MEIIIRVVFLLTLLNSVLVNGQIYDVLKFGAKGDGLTDESKAFVEAWKAMCGS  53



>ref|XP_006304614.1| hypothetical protein CARUB_v10011686mg, partial [Capsella rubella]
 gb|EOA37512.1| hypothetical protein CARUB_v10011686mg, partial [Capsella rubella]
Length=293

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +     LFI+G  S      K F+V  YGAKGDG TD++ AF N W+DAC+
Sbjct  8    FKVSGLTMLFIVGTTSLPTTVPKVFDVQRYGAKGDGKTDNTNAFTNTWEDACT  60



>ref|XP_010090713.1| hypothetical protein L484_013735 [Morus notabilis]
 gb|EXB40432.1| hypothetical protein L484_013735 [Morus notabilis]
Length=230

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S  +FNV  +GA+ DG TDDSQAF+ AWK+AC ST
Sbjct  159  SFNAFNVRSFGAQADGRTDDSQAFIEAWKEACEST  193



>ref|XP_006465486.1| PREDICTED: probable polygalacturonase At3g15720-like [Citrus 
sinensis]
Length=715

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +3

Query  72   MEVFVFLFILGLISSS--RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
             ++   L+ L LIS++  R++   FNV+D+GA GDG  DDS AF+ AW + CS+T
Sbjct  3    QDLSAILYFLCLISTASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCSAT  57



>ref|XP_010459287.1| PREDICTED: exopolygalacturonase [Camelina sativa]
Length=401

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +     LFI+G  S      K F+V  YGAKGDG T +++AF N WKDAC+
Sbjct  8    FKVSSLTLLFIIGTTSRPTTVPKVFDVRRYGAKGDGKTVNTKAFTNTWKDACT  60



>ref|XP_008805455.1| PREDICTED: exopolygalacturonase-like [Phoenix dactylifera]
Length=404

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  123  VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            V   +FNV+++GA+G+G+TDDSQAFL AWK AC+ST
Sbjct  29   VGLGTFNVMNFGARGNGVTDDSQAFLAAWKAACAST  64



>ref|XP_007018009.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY15234.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=405

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
             +F F LG+      +C+S NV D+GA GDG TDDS AFL AWK  C++T
Sbjct  8    MIFSFALGI-----ANCQSLNVTDFGAVGDGKTDDSLAFLKAWKALCAAT  52



>ref|XP_004498018.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            FNV++YGAKGDG TDDS AFL AW+D CS+
Sbjct  35   FNVLNYGAKGDGQTDDSNAFLKAWQDVCST  64



>gb|KHG17941.1| hypothetical protein F383_07844 [Gossypium arboreum]
Length=402

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            S+ +   + ++ L++ S +S K FNV+ YGA G+G+TDDS AF+ AWKD CS
Sbjct  3    SLSISYAICVVSLLTIS-ISAKEFNVLSYGASGNGITDDSLAFMKAWKDTCS  53



>ref|XP_006398123.1| hypothetical protein EUTSA_v10001153mg, partial [Eutrema salsugineum]
 gb|ESQ39576.1| hypothetical protein EUTSA_v10001153mg, partial [Eutrema salsugineum]
Length=438

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            LF+L LI    V+ + F+V+ YGAKGDG TDDS+AF++AWK  C +
Sbjct  7    LFVLILIHFGLVNGQIFDVLKYGAKGDGTTDDSKAFVDAWKAVCGN  52



>ref|XP_004498026.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            FNV++YGAKGDG TDDS AFL AW+D CS+
Sbjct  35   FNVLNYGAKGDGQTDDSNAFLKAWQDVCST  64



>ref|XP_003545181.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=402

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRV-----SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +F  L+++   S SR+     +  +FNV+DYGA GDG+TDDSQAFL AW   C+
Sbjct  5    IAIFFVLYLVSHCSCSRIREAAINLYTFNVMDYGAIGDGLTDDSQAFLKAWSMVCA  60



>emb|CDP06168.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
             +FLFI    +S+ +  K FNV +YGA+ DG TDDSQAFL AW DAC
Sbjct  13   IIFLFITA-DASTILPHKIFNVDNYGARADGSTDDSQAFLRAWNDAC  58



>gb|AAC28903.1| polygalacturonase 1 [Solanum lycopersicum]
Length=392

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            M  F   F+L + SS   +   +NV +YGAK DG TD S+AFLNAW  AC+S
Sbjct  1    MSPFAIFFLLLINSSLAANTNIYNVQNYGAKSDGKTDSSKAFLNAWAAACAS  52



>ref|XP_010913888.1| PREDICTED: exopolygalacturonase-like [Elaeis guineensis]
Length=404

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            ++FNVI++GA+ DG+TD+SQAFL AWK AC+ST
Sbjct  32   ETFNVINFGARADGVTDNSQAFLAAWKAACTST  64



>gb|KDP29569.1| hypothetical protein JCGZ_19282 [Jatropha curcas]
Length=393

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
             + LF++   SS  ++   +NV+ YGAK DG TD S+AFL AW  AC+ST
Sbjct  9    MLVLFLISFTSSIAMAALQYNVVSYGAKPDGQTDSSKAFLAAWTQACAST  58



>ref|XP_011074245.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=392

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS-TP  233
            +  F +  +L LI++      ++NV+++GA+GDG TD + AFL AWK ACSS TP
Sbjct  4    LATFSWAILLVLIAAVLSPAAAYNVVNFGARGDGRTDSTAAFLRAWKAACSSATP  58



>ref|XP_010092712.1| hypothetical protein L484_024607 [Morus notabilis]
 gb|EXB52057.1| hypothetical protein L484_024607 [Morus notabilis]
Length=407

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  78   VFVFL-FILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + +FL +++  I+ SR   K FNV+DYGA  +G TD+S+AFL AW++AC
Sbjct  16   LIIFLSYMVCSIAESRAKPKVFNVMDYGAIANGKTDNSKAFLRAWREAC  64



>ref|XP_010551910.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Tarenaya hassleriana]
Length=458

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  105  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            L+++   + K+FNV+DYGAKGDG+TDD++AF  AW+ AC
Sbjct  42   LVTTQGENSKTFNVLDYGAKGDGITDDTKAFEAAWEAAC  80



>ref|XP_007212964.1| hypothetical protein PRUPE_ppa021095mg [Prunus persica]
 gb|EMJ14163.1| hypothetical protein PRUPE_ppa021095mg [Prunus persica]
Length=621

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 4/50 (8%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            V + +F +G     R    +FNV+DYGA GDG TDDS+AFL AW + C +
Sbjct  6    VLILIFWIGFGHGQR----TFNVLDYGATGDGKTDDSKAFLKAWGELCGA  51



>ref|XP_010551909.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Tarenaya hassleriana]
Length=460

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  105  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            L+++   + K+FNV+DYGAKGDG+TDD++AF  AW+ AC
Sbjct  42   LVTTQGENSKTFNVLDYGAKGDGITDDTKAFEAAWEAAC  80



>ref|XP_008454473.1| PREDICTED: probable polygalacturonase At3g15720 [Cucumis melo]
Length=386

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  84   VFLFILGLISSSRV-SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +  + + ++SS  V S   FNV+DYGA G+G TDDS+AFL AW D C +T
Sbjct  8    ILTYSIAILSSRTVLSSSDFNVLDYGAIGNGKTDDSKAFLKAWNDVCGAT  57



>gb|KJB70601.1| hypothetical protein B456_011G082400 [Gossypium raimondii]
Length=402

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            S+ +    +++ L++   +S K FNV+ YGA G+G+TDDS AF+ AWKD CS
Sbjct  3    SLSISYAFYVVSLLTIC-ISAKEFNVLSYGASGNGITDDSLAFMKAWKDTCS  53



>ref|XP_009367790.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=402

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +3

Query  63   FYSM-EVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
             YS+  VF+  F+L   +  R   K F+V  YGA  DG TD+SQAFL+AWK+AC
Sbjct  9    IYSLGRVFLLFFLLVWETEGRDQAKYFDVRKYGAVDDGKTDNSQAFLDAWKEAC  62



>emb|CDY14791.1| BnaC04g47880D [Brassica napus]
Length=433

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = +3

Query  96   ILGLISSSRVSCK---SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST-PVH  239
            I  L S +R S +   + +V D+GAKGDG TDD+QAF+NAWK ACSS+ PV+
Sbjct  51   ITRLKSVARASLRLPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSSSGPVN  102



>gb|AAL84942.1| At2g41850/T11A7.5 [Arabidopsis thaliana]
Length=433

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            I GL S  R S ++    +V D+GAKGDG TDD+QAF+NAWK ACSS
Sbjct  51   ITGLRSFVRASLRTPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSS  97



>gb|AAC02763.1| putative polygalacturonase [Arabidopsis thaliana]
Length=426

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            I GL S  R S ++    +V D+GAKGDG TDD+QAF+NAWK ACSS
Sbjct  51   ITGLRSFVRASLRTPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSS  97



>ref|NP_850359.1| polygalacturonase ADPG2 [Arabidopsis thaliana]
 sp|Q8RY29.2|ADPG2_ARATH RecName: Full=Polygalacturonase ADPG2; Short=AtADPG2; Short=PG 
ADPG2; AltName: Full=Pectinase ADPG2; AltName: Full=Protein 
ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC10040.1| polygalacturonase ADPG2 [Arabidopsis thaliana]
Length=433

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            I GL S  R S ++    +V D+GAKGDG TDD+QAF+NAWK ACSS
Sbjct  51   ITGLRSFVRASLRTPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSS  97



>ref|XP_006357140.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=393

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            M    F F+  + SS   +   +NV +YGAK DG TD S+AFLNAW  AC+ST
Sbjct  1    MSPLAFFFLFLINSSLAANTNIYNVQNYGAKSDGKTDSSKAFLNAWAAACAST  53



>ref|XP_002985472.1| hypothetical protein SELMODRAFT_122081 [Selaginella moellendorffii]
 gb|EFJ13602.1| hypothetical protein SELMODRAFT_122081 [Selaginella moellendorffii]
Length=410

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+++GA+GDG++DDSQAFL AWK AC
Sbjct  26   REFNVVEFGARGDGLSDDSQAFLAAWKRAC  55



>ref|XP_008383110.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  75   EVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
             VF+  F+L   +  R   K F+V  YGA  DG TD+SQAFL+AWK+AC
Sbjct  12   RVFLLFFLLVWETEGRDQAKYFDVRKYGAVDDGKTDNSQAFLDAWKEAC  60



>ref|XP_002979824.1| hypothetical protein SELMODRAFT_111266 [Selaginella moellendorffii]
 gb|EFJ19226.1| hypothetical protein SELMODRAFT_111266 [Selaginella moellendorffii]
Length=410

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+++GA+GDG++DDSQAFL AWK AC
Sbjct  26   REFNVVEFGARGDGLSDDSQAFLAAWKRAC  55



>ref|XP_010527121.1| PREDICTED: probable polygalacturonase At3g15720 [Tarenaya hassleriana]
Length=402

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            +C++FNV+ +GAKGDG+TDDS+AFL AW  AC
Sbjct  21   NCQNFNVLSFGAKGDGVTDDSEAFLKAWNAAC  52



>ref|XP_010254483.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=425

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVS--CKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            F++  +     IL ++SS   +    SF+V++YGA GDG TDDS+AFLNAW+ AC
Sbjct  25   FFTTLLITLCAILPVLSSRLAAGASNSFDVVNYGAVGDGRTDDSKAFLNAWEAAC  79



>ref|XP_006583490.1| PREDICTED: probable polygalacturonase At3g15720-like isoform 
X2 [Glycine max]
Length=362

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            VF+  FI+       V   + +NVI+YGAKGDG +DDSQAFL AW+  C +
Sbjct  8    VFILAFIISPYLCHSVGTNTIYNVINYGAKGDGRSDDSQAFLRAWQSTCGA  58



>ref|XP_010069207.1| PREDICTED: polygalacturonase-like [Eucalyptus grandis]
Length=401

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  42   IFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            IF     F ++ + +F+ +  L S +  +   +NV+  GAK DG TD S+AFL+AW  AC
Sbjct  5    IFNTCLSFLALALSIFMLLSELPSPANAASVQYNVVSLGAKADGKTDSSKAFLSAWASAC  64

Query  222  SST  230
             ST
Sbjct  65   KST  67



>ref|XP_006845770.1| hypothetical protein AMTR_s00019p00250890 [Amborella trichopoda]
 gb|ERN07445.1| hypothetical protein AMTR_s00019p00250890 [Amborella trichopoda]
Length=396

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  108  ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +S S  + KSF+V+DYGAKGDGM DD+ AF  AW  ACS+
Sbjct  16   LSDSTSTSKSFDVMDYGAKGDGMKDDTDAFAKAWNAACSA  55



>ref|XP_010507688.1| PREDICTED: polygalacturonase ADPG2, partial [Camelina sativa]
Length=390

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +3

Query  102  GLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            GL S  R S ++     V D+GAKGDG+TDD+QAF+NAWK ACSS
Sbjct  10   GLKSFVRASLRTPTTVTVSDFGAKGDGITDDTQAFVNAWKKACSS  54



>ref|XP_004305261.1| PREDICTED: probable polygalacturonase At3g15720 [Fragaria vesca 
subsp. vesca]
Length=405

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVS----CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            M   + L IL  I+SS  S      +FNV+DYGA GDG  DDS+AFL AW  +CS+
Sbjct  1    MRNALVLLILHTIASSNFSFGHGQTTFNVLDYGAAGDGERDDSKAFLEAWNASCST  56



>gb|ACV85697.1| ripening-induced polygalacturonase 4 [Carica papaya]
Length=389

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            S+S  S ++FNV+ YGAK DG+TD ++AF+ AW +ACSS
Sbjct  30   SASPTSTRTFNVVHYGAKPDGLTDSTKAFIAAWHEACSS  68



>ref|XP_006583489.1| PREDICTED: probable polygalacturonase At3g15720-like isoform 
X1 [Glycine max]
Length=388

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            VF+  FI+       V   + +NVI+YGAKGDG +DDSQAFL AW+  C +
Sbjct  8    VFILAFIISPYLCHSVGTNTIYNVINYGAKGDGRSDDSQAFLRAWQSTCGA  58



>emb|CBI28392.3| unnamed protein product [Vitis vinifera]
Length=147

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +3

Query  93   FILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
             +L L S++ VSC + F+V  YGA+ DG TD SQA L AW DACSS PV
Sbjct  35   LMLLLASAAEVSCDTIFDVTKYGARADGNTDISQALLKAWGDACSS-PV  82



>emb|CDP18456.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            K FNV++YGA+ DG TDDSQAFL AW DAC
Sbjct  29   KIFNVVNYGARADGNTDDSQAFLRAWSDAC  58



>ref|XP_002529089.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF33273.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=393

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 5/58 (9%)
 Frame = +3

Query  54   YCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            + C   +   +FLF   L +++R     FNV++YGAK DG TD ++AFL +WK AC S
Sbjct  6    FSCSLLIAFLIFLFTSSLATAAR-----FNVLNYGAKPDGRTDSTKAFLASWKQACGS  58



>ref|XP_002529088.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33272.1| conserved hypothetical protein [Ricinus communis]
Length=307

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F+ +F    I+S  V+   FNV+ YGA  DG TD ++AFL AW  AC+ST
Sbjct  5    FILVFYFIFITSPLVTSAQFNVLSYGANPDGRTDCTKAFLTAWTQACAST  54



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKSFNVI-DYGAKGDGMTDDSQAFLNAWKDACSS-TP  233
            +F+ +L  IS+S+V   +F+V+  +GAK DG TD S+ FL+AWK+AC+S TP
Sbjct  11   MFVLLLLFISASKVQSDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTP  62



>gb|KHN22975.1| Polygalacturonase [Glycine soja]
Length=410

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +S+     L +    ++S     S+NV+D+GAK DG TD + AFL AW  ACSS
Sbjct  15   LFSLHTLHLLVLCSWFTTSSAKATSYNVVDFGAKPDGTTDATSAFLGAWNKACSS  69



>ref|XP_003534763.2| PREDICTED: polygalacturonase-like [Glycine max]
Length=410

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +S+     L +    ++S     S+NV+D+GAK DG TD + AFL AW  ACSS
Sbjct  15   LFSLHTLHLLVLCSWFTTSSAKATSYNVVDFGAKPDGTTDATSAFLGAWNKACSS  69



>ref|XP_003547316.1| PREDICTED: polygalacturonase-like [Glycine max]
 gb|KHN14358.1| Polygalacturonase [Glycine soja]
Length=408

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
              ++    FL +    S+S     S+NV+D+GAK DG TD + AFL+AW  ACSS
Sbjct  16   LLALHTLHFLVLCTWFSTSSAKATSYNVVDFGAKPDGATDATAAFLSAWNKACSS  70



>ref|XP_002321662.2| hypothetical protein POPTR_0015s10000g [Populus trichocarpa]
 gb|EEF05789.2| hypothetical protein POPTR_0015s10000g [Populus trichocarpa]
Length=358

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query  111  SSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S S  SC   +NVIDYGA GDG TDD+QAF +AWKD C S+
Sbjct  21   SRSLRSCNQVYNVIDYGAVGDGDTDDTQAFKDAWKDVCKSS  61



>ref|XP_006595163.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=401

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            F  L IL +I+    S   SFNV+ YGA G+G T+DS AFL AWK AC S
Sbjct  5    FTVLIILSVITPGLSSTTTSFNVLQYGAVGNGQTNDSPAFLKAWKAACQS  54



>ref|XP_010431134.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=381

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ME+ +  +F+L L++S  V+ + ++V+ +GAKG+G+TD+S+AF+ AWK  C S
Sbjct  1    MEIIIRVVFLLTLLNSVLVNGQIYDVLKFGAKGNGLTDESKAFVEAWKAMCGS  53



>gb|KHN44172.1| Putative polygalacturonase [Glycine soja]
Length=412

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 4/68 (6%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLN  203
            L+ S + F +   F+++ + + +   GL S++     SFNV+ YGA G+G T+DS AFL 
Sbjct  2    LLKSTAKFDIMEFFFTVLIILSVITPGLSSTT----TSFNVLQYGAVGNGQTNDSPAFLK  57

Query  204  AWKDACSS  227
            AWK AC S
Sbjct  58   AWKAACQS  65



>gb|KEH33414.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=395

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 7/54 (13%)
 Frame = +3

Query  87   FLFILGLI------SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
             LF+LGL+      S +RV+   FNV++YGA  DG TD+ +AFL AW DAC+S 
Sbjct  5    ILFVLGLLAVCISESQARVT-NVFNVLNYGAIADGKTDNKEAFLKAWSDACNSN  57



>ref|XP_010445667.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=427

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 4/58 (7%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            F+S  + + LF    ++ SR +     K+FNV+DYGA GDG  DDS+AF +AW+D C+
Sbjct  7    FFSFLLSLTLFHTFQLAQSRSTLYHDNKNFNVLDYGAIGDGFFDDSKAFKDAWEDTCN  64



>ref|XP_006427258.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
 gb|ESR40498.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
Length=406

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 5/62 (8%)
 Frame = +3

Query  60   CFYS-----MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            CF S     + VF F       +S R++   FNV+D+GA GDG  DDS AF+ AW + CS
Sbjct  1    CFNSKLSGLISVFAFCMSSMCYASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCS  60

Query  225  ST  230
            +T
Sbjct  61   AT  62



>gb|KHN08870.1| Polygalacturonase [Glycine soja]
Length=385

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = +3

Query  99   LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            LG ISSS    K+ NV DYGA+GDG TDD+QAF  AW+ ACSS
Sbjct  9    LGDISSS---LKTVNVNDYGARGDGKTDDTQAFKEAWEVACSS  48



>ref|XP_011078892.1| PREDICTED: polygalacturonase [Sesamum indicum]
Length=457

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S K+ NV+ +GAKGDG TDD++AF NAW++ACSS+
Sbjct  83   SIKTINVLSFGAKGDGSTDDTKAFENAWEEACSSS  117



>ref|XP_002890206.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66465.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +3

Query  51   LYCCFYSMEVFVFLFILGLISSSR--VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + C  +    F    +   +++SR     K F+V  YGAKGDG TD++ AF NAWKDAC+
Sbjct  1    MECIDFVFMAFCLPLLFNAVTTSRPITGPKVFDVRRYGAKGDGKTDNTNAFTNAWKDACT  60



>emb|CAC05657.1| endopolygalacturonase [Brassica napus]
 emb|CAC05658.1| endopolygalacturonase [Brassica napus]
Length=434

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCK---SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            I  L S +R S +   + +V D+GAKGDG TDD+QAF+NAWK ACSS+
Sbjct  51   ITRLKSVARASLRLPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSSS  98



>ref|XP_009142016.1| PREDICTED: polygalacturonase ADPG2-like [Brassica rapa]
 ref|XP_009142019.1| PREDICTED: polygalacturonase ADPG2-like [Brassica rapa]
Length=433

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCK---SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            I  L S +R S +   + +V D+GAKGDG TDD+QAF+NAWK ACSS+
Sbjct  51   ITRLKSVARASLRLPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSSS  98



>emb|CDY06902.1| BnaA04g24130D [Brassica napus]
Length=433

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCK---SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            I  L S +R S +   + +V D+GAKGDG TDD+QAF+NAWK ACSS+
Sbjct  51   ITRLKSVARASLRLPTTVSVSDFGAKGDGKTDDTQAFVNAWKKACSSS  98



>ref|XP_010476858.1| PREDICTED: exopolygalacturonase-like isoform X2 [Camelina sativa]
Length=402

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +      FI+G  S      K F+V  YGAKG+G TD+++AF N WK+AC+
Sbjct  8    FKVSSLALFFIIGTTSRPTTVPKVFDVRRYGAKGNGKTDNTKAFTNTWKNACT  60



>ref|XP_006838303.1| hypothetical protein AMTR_s00103p00121270 [Amborella trichopoda]
 gb|ERN00872.1| hypothetical protein AMTR_s00103p00121270 [Amborella trichopoda]
Length=463

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query  108  ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTP  233
            + S   S K  +V D+GAKGDG TDD+QAF  AWK+ACSS P
Sbjct  85   VGSPEASLKVVSVDDFGAKGDG-TDDTQAFAEAWKEACSSAP  125



>emb|CDP16134.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            F  + VF+FL+     +S+ +  K FNV++YGA+ DG TD+SQAFL AW DAC
Sbjct  7    FGILIVFIFLWTAA-DASAFLPPKIFNVLNYGARADGNTDNSQAFLRAWIDAC  58



>ref|XP_010476857.1| PREDICTED: exopolygalacturonase-like isoform X1 [Camelina sativa]
 ref|XP_010476859.1| PREDICTED: exopolygalacturonase-like isoform X3 [Camelina sativa]
Length=402

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +      FI+G  S      K F+V  YGAKG+G TD+++AF N WK+AC+
Sbjct  8    FKVSSLALFFIIGTTSRPTTVPKVFDVRRYGAKGNGKTDNTKAFTNTWKNACT  60



>ref|XP_003537285.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=428

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = +3

Query  99   LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            LG ISSS    K+ NV DYGA+GDG TDD+QAF  AW+ ACSS
Sbjct  52   LGDISSS---LKTVNVNDYGARGDGKTDDTQAFKEAWEVACSS  91



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 2/52 (4%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKSFNVI-DYGAKGDGMTDDSQAFLNAWKDACSS-TP  233
            +F+ +L  IS+S+V   +F+V+  +GAK DG TD S+ FL+AWK+AC+S TP
Sbjct  11   MFVLLLLFISASKVQPDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTP  62



>ref|XP_003518118.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=481

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = +3

Query  99   LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            LG ISSS    K+ NV DYGA+GDG TDD+QAF +AW+ ACSS
Sbjct  105  LGDISSS---LKTVNVNDYGARGDGKTDDTQAFNDAWEVACSS  144



>ref|XP_002315106.2| polygalacturonase family protein [Populus trichocarpa]
 gb|EEF01277.2| polygalacturonase family protein [Populus trichocarpa]
Length=397

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  51   LYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            L  C +S+  F+FL  L  I+ S      +NV  YGAK +G TD +QAFL+AW  AC ST
Sbjct  4    LMLCLHSILFFIFLVSLNNINISSAE-TIYNVQTYGAKPNGKTDSTQAFLDAWAAACGST  62



>gb|EYU20740.1| hypothetical protein MIMGU_mgv1a007521mg [Erythranthe guttata]
Length=404

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S K+ +V+ +GAKGDG TDDS+AF NAWK+ACSS+
Sbjct  32   SVKTVDVLSFGAKGDGSTDDSKAFGNAWKEACSSS  66



>ref|XP_002526714.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF35628.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=226

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 2/54 (4%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
            +F F      I S+R S    NV+D+GA GDG TDDS AFL AWK  C + P  
Sbjct  10   LFCFAVFSIFIGSARSSV--LNVVDFGATGDGQTDDSMAFLQAWKVLCGAAPAQ  61



>ref|XP_006296029.1| hypothetical protein CARUB_v10025174mg [Capsella rubella]
 gb|EOA28927.1| hypothetical protein CARUB_v10025174mg [Capsella rubella]
Length=430

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  96   ILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            I GL S  R S ++    +V ++GAKGDG TDD+QAF+NAWK ACSS
Sbjct  48   ITGLKSFVRASLRTPTTVSVSEFGAKGDGETDDTQAFVNAWKKACSS  94



>ref|XP_006378626.1| hypothetical protein POPTR_0010s18510g [Populus trichocarpa]
 gb|ERP56423.1| hypothetical protein POPTR_0010s18510g [Populus trichocarpa]
Length=395

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 4/58 (7%)
 Frame = +3

Query  60   CFYSMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            C  S+ +F+FL  L + ISS++     +NV+ YGA+ +G TD +QAFL+AW  AC ST
Sbjct  6    CIPSLLLFIFLVSLNINISSAKTV---YNVLTYGARPNGKTDSTQAFLHAWTAACGST  60



>gb|KHM99814.1| Polygalacturonase [Glycine soja]
Length=428

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = +3

Query  99   LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            LG ISSS    K+ NV DYGA+GDG TDD+QAF +AW+ ACSS
Sbjct  52   LGDISSS---LKTVNVNDYGARGDGKTDDTQAFNDAWEVACSS  91



>ref|XP_006845769.1| hypothetical protein AMTR_s00019p00250720 [Amborella trichopoda]
 gb|ERN07444.1| hypothetical protein AMTR_s00019p00250720 [Amborella trichopoda]
Length=95

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +3

Query  39   SIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDA  218
            +IF L+ C + +       IL L S S  + +SF+V+DYGAKGDGM DD+ AF  AW   
Sbjct  5    TIFYLFIC-WGLAGLCGASILPL-SDSNSTSQSFDVMDYGAKGDGMEDDTAAFAKAWGAT  62

Query  219  CSS  227
            C +
Sbjct  63   CHT  65



>ref|XP_010435969.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            K+FNV+DYGA GDG +DDS+AF +AW+D C+
Sbjct  34   KNFNVLDYGAIGDGFSDDSKAFKDAWEDTCN  64



>ref|XP_004489698.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=398

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            SFNV+DYGA G+G  D++QAF++AWKD CS+
Sbjct  29   SFNVLDYGAVGNGKNDETQAFVDAWKDTCSA  59



>gb|KEH18028.1| pectin lyase superfamily protein [Medicago truncatula]
Length=356

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  81   FVFLFILGLISSS-RVSCKS--FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F FIL  +S+   V  K+  +NV+ YGA+GDG TDDSQAF++AW  AC +
Sbjct  9    LIFGFILPCLSTRLNVGTKNAIYNVMQYGARGDGKTDDSQAFVSAWSSACKA  60



>ref|XP_006392146.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum]
 gb|ESQ29432.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum]
Length=538

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGMTDD++AF +AW  AC
Sbjct  119  QEFNVLDFGAKGDGMTDDTEAFESAWASAC  148



>ref|XP_002529090.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF33274.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=393

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F+ L IL L +SS  +   +NV+ YGAK DG TD ++AFL AW  AC ST
Sbjct  11   FLALLIL-LFTSSLATAAQYNVLSYGAKPDGRTDSTKAFLAAWTQACGST  59



>ref|XP_006351095.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=603

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 7/66 (11%)
 Frame = +3

Query  30   LSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAW  209
            +S  +   +CC +    F+FL       +S  S  +F+V+++GAK DG +D +Q FL AW
Sbjct  1    MSKVLVTFWCCVFFSFRFIFL-------NSNASSVTFSVLNFGAKSDGKSDATQPFLKAW  53

Query  210  KDACSS  227
              ACSS
Sbjct  54   VAACSS  59



>ref|XP_010266273.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=428

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  108  ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            ++++  S  +FNVI YGAKGDG  DDSQAF  AWK AC ++
Sbjct  47   LTANESSSGTFNVISYGAKGDGKHDDSQAFAEAWKAACGAS  87



>ref|XP_010413001.1| PREDICTED: polygalacturonase ADPG2-like, partial [Camelina sativa]
Length=394

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +3

Query  102  GLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            GL S  R S ++    +V D+GAKGDG TDD+QAF+NAWK ACSS
Sbjct  14   GLKSFVRASLRTPTTVSVSDFGAKGDGNTDDTQAFVNAWKKACSS  58



>ref|XP_002868688.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            KSFNV++YGA GDG +DDS+AF +AW+D C+
Sbjct  34   KSFNVLNYGAIGDGFSDDSKAFKDAWEDTCN  64



>ref|XP_002968845.1| hypothetical protein SELMODRAFT_12909, partial [Selaginella moellendorffii]
 gb|EFJ29961.1| hypothetical protein SELMODRAFT_12909, partial [Selaginella moellendorffii]
Length=376

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +FN+ DYGAKGDG+TDD+QA   AW+DAC S
Sbjct  2    TFNLQDYGAKGDGVTDDTQALERAWQDACKS  32



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +M+ +V   +L L  SS ++ +S NV  YGAKGDG +D SQA L+AWK+AC+ST
Sbjct  2    AMKSYVGALLLLLSFSSSITPRSLNVASYGAKGDGSSDISQALLSAWKEACAST  55



>ref|XP_002974127.1| hypothetical protein SELMODRAFT_12908, partial [Selaginella moellendorffii]
 gb|EFJ25082.1| hypothetical protein SELMODRAFT_12908, partial [Selaginella moellendorffii]
Length=376

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +FN+ DYGAKGDG+TDD+QA   AW+DAC S
Sbjct  2    TFNLQDYGAKGDGVTDDTQALERAWQDACKS  32



>ref|XP_010436249.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=406

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +3

Query  66   YSMEVFVFLFI-LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            ++ME  + ++I +  + S  V+ +++NV++YGAKGDG TDDS+ F  AW D C
Sbjct  8    FTMETTLRVWIWINFLCSVLVNGQNYNVLNYGAKGDGQTDDSEGFEQAWNDTC  60



>ref|NP_173158.1| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AEE29551.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=402

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 2/57 (4%)
 Frame = +3

Query  57   CCFYSMEVFVFLFILGLISSSR--VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            C  +    F  L +L  +++SR     K F+V  YGAKGDG  D++ AF NAWKDAC
Sbjct  4    CIDFVFMAFGLLLLLIAVTTSRPITRPKVFDVRSYGAKGDGKMDNTNAFTNAWKDAC  60



>ref|XP_004142600.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 gb|KGN66713.1| hypothetical protein Csa_1G662770 [Cucumis sativus]
Length=399

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S+ V   S+NV+D+G KGDG TD +QAF  AW +AC+ST
Sbjct  25   STFVDASSYNVVDFGGKGDGTTDSTQAFQTAWTNACAST  63



>ref|XP_009596400.1| PREDICTED: exopolygalacturonase-like [Nicotiana tomentosiformis]
Length=398

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  69   SMEVFVFLFILGLI-SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            S+  F   F+L LI   S    K FNV  YGAK DG TD+S+AFL+ WKDAC
Sbjct  3    SISSFGIAFVLCLILRYSSAEEKLFNVQSYGAKADGKTDNSKAFLSTWKDAC  54



>ref|XP_010554840.1| PREDICTED: polygalacturonase ADPG2-like [Tarenaya hassleriana]
Length=405

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +  V D+GA+GDG TDD+QAF+NAWK ACS++
Sbjct  39   TVTVSDFGARGDGKTDDTQAFVNAWKKACSTS  70



>ref|XP_006364236.1| PREDICTED: probable polygalacturonase At3g15720-like [Solanum 
tuberosum]
Length=407

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            FY +   V L ++  + S+ +  K+FNVID+GA GDG TDD  AFL AW+  C S
Sbjct  8    FYLVTFLVLLCMVSSVWSADI--KTFNVIDFGAVGDGRTDDLPAFLKAWEAVCQS  60



>ref|XP_009139940.1| PREDICTED: polygalacturonase QRT2 [Brassica rapa]
Length=421

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            SS  V+ K FNV DYGA G+G  DD++AF++AW+D C+
Sbjct  24   SSPDVNSKIFNVFDYGAIGNGYADDTKAFMDAWEDTCN  61



>ref|XP_006281692.1| hypothetical protein CARUB_v10027840mg, partial [Capsella rubella]
 gb|EOA14590.1| hypothetical protein CARUB_v10027840mg, partial [Capsella rubella]
Length=366

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            +F +  +    V+CK +NV+D+G +GDG  DDS+AF+ AWK  C
Sbjct  7    MFFVNFLYFGIVNCKIYNVLDFGVEGDGQIDDSKAFIEAWKTMC  50



>ref|XP_006351096.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=396

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 6/56 (11%)
 Frame = +3

Query  69   SMEVFVF--LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S++ F F  + +L LI S    C ++NV+++GAKGDG TD +  FL AW  ACSST
Sbjct  9    SLQFFFFSSISLLLLIPS----CLAYNVVNFGAKGDGKTDSTAPFLRAWMSACSST  60



>ref|XP_009146202.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Brassica 
rapa]
Length=455

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +3

Query  78   VFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +F +FIL + + S    K+ +V  YGA GDG+TDDSQAFL AW+D CS
Sbjct  6    ILIFSVFILQIFTYS----KALDVTQYGAVGDGVTDDSQAFLKAWEDVCS  51



>ref|XP_009146201.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Brassica 
rapa]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +3

Query  78   VFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +F +FIL + + S    K+ +V  YGA GDG+TDDSQAFL AW+D CS
Sbjct  9    ILIFSVFILQIFTYS----KALDVTQYGAVGDGVTDDSQAFLKAWEDVCS  54



>ref|XP_007134324.1| hypothetical protein PHAVU_010G037800g, partial [Phaseolus vulgaris]
 gb|ESW06318.1| hypothetical protein PHAVU_010G037800g, partial [Phaseolus vulgaris]
Length=338

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            S R   K++NVIDYGA GDG  +DS AF++AWKD C +
Sbjct  2    SVRTQNKTYNVIDYGAHGDGKLNDSGAFVSAWKDTCGT  39



>gb|KFK35000.1| hypothetical protein AALP_AA5G221100 [Arabis alpina]
Length=428

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +3

Query  96   ILGLISSSRVSCKS--FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            +L L SS + + +S   +V ++GAKGDG TDD+QAF NAWK ACS+  V
Sbjct  50   VLTLKSSDKTTSQSSTVSVANFGAKGDGKTDDTQAFKNAWKKACSTNGV  98



>ref|XP_006353088.1| PREDICTED: exopolygalacturonase-like [Solanum tuberosum]
Length=393

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F+S+ +FV   I+  +S        FNV D+GA  DG TD SQAFL AW   C + 
Sbjct  8    FHSLSLFVIFLIIIKVSQVHAIGSVFNVQDFGASPDGKTDSSQAFLKAWNQTCQNN  63



>gb|KFK42900.1| hypothetical protein AALP_AA1G053200 [Arabis alpina]
Length=1008

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  I  S  S   FNV+ +GAK DG+TD + AFL AW+ ACSS
Sbjct  10   LIFTLLIIFIDVSTGSSNIFNVVSFGAKPDGVTDSTAAFLKAWQGACSS  58



>ref|XP_010254485.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=200

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 6/56 (11%)
 Frame = +3

Query  72   MEVFVFLFILGLIS---SSR---VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            M +F    ILG+ S   S R   +   +FNV D+GA GDG TDDSQAF+ AW+  C
Sbjct  104  MGLFTVFLILGMASFGLSGRFDVMKSSTFNVEDFGAVGDGKTDDSQAFMRAWEAVC  159



>ref|XP_008394259.1| PREDICTED: polygalacturonase [Malus domestica]
Length=397

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 3/54 (6%)
 Frame = +3

Query  78   VFVFLFILGLISSSR---VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            V + +F++ L  SS        S+NV  YGA+GDG TD ++AFL AW  ACSST
Sbjct  6    VVILVFLISLFESSSNYYAVGASYNVARYGARGDGRTDSTKAFLRAWSLACSST  59



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +M+ +V   +L L  SS ++ + FNV  YGAKGDG +D SQA L+AWK+AC+ST
Sbjct  2    AMKSYVGALLLLLSFSSSINAQVFNVASYGAKGDGSSDISQALLSAWKEACAST  55



>ref|XP_009355877.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=418

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 4/55 (7%)
 Frame = +3

Query  69   SMEVFVFL--FILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            S+ +++ L  F+LG +  +R +   FNV+DYGA  DG  DDS+AFL AWK+ C +
Sbjct  9    SLMLYIALTSFVLGAVDETRSNI--FNVLDYGAFADGQHDDSEAFLKAWKELCEA  61



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +M+ +V   +L L  SS ++ + FNV  YGAKGDG +D SQA L+AWK+AC+ST
Sbjct  2    AMKSYVGALLLLLSFSSSINAQVFNVASYGAKGDGSSDISQALLSAWKEACAST  55



>emb|CBI36306.3| unnamed protein product [Vitis vinifera]
Length=495

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 8/62 (13%)
 Frame = +3

Query  66   YSMEVFVFL--FILGLISS--SRVSCK----SFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            Y+M+ F  L   IL + SS  S V+      +FNV+D+GA GDG+TDDSQAFL AW   C
Sbjct  92   YAMQDFSILICLILSMASSGSSNVALNGRTTTFNVLDFGAIGDGVTDDSQAFLKAWNAVC  151

Query  222  SS  227
            ++
Sbjct  152  TA  153



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +M+ +V   +L L  SS ++ + FNV  YGAKGDG +D SQA L+AWK+AC+ST
Sbjct  2    AMKSYVGALLLLLSFSSSINAQVFNVASYGAKGDGSSDISQALLSAWKEACAST  55



>ref|XP_010654935.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=684

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  105  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            L SS+  +   F+V+DYGA GDG TDDSQAFL AW + C +
Sbjct  383  LSSSTNATSPYFDVMDYGAVGDGKTDDSQAFLKAWNETCKA  423


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            +S+ +   + +  L S++      F+V++YGA GDG TDDSQAFL AW + C
Sbjct  52   FSIFILCMVTLSSLSSTTNADSPCFDVMNYGALGDGKTDDSQAFLKAWNETC  103



>gb|KFK40772.1| hypothetical protein AALP_AA2G039100 [Arabis alpina]
Length=520

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGMTDD++AF  AW  AC
Sbjct  101  QEFNVLDFGAKGDGMTDDTKAFEAAWASAC  130



>emb|CDY39404.1| BnaAnng05350D [Brassica napus]
Length=399

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +E+ V  +F+L L++   V+ + ++V+ +GA+GDG TDDS+AF+ AWK  CSS
Sbjct  9    IEIIVRVVFVLTLLNFGFVNSQIYDVLKFGAEGDGTTDDSKAFVAAWKAMCSS  61



>ref|XP_006353138.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=389

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            + S+   +F ++  LI S    C ++NV+ +GA+GDG TD + AFL AW  AC ST
Sbjct  3    YTSVSCVLFFYLNILIPS----CLAYNVVSFGARGDGRTDSTSAFLRAWSSACHST  54



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +M+ +V   +L L  SS ++ + FNV  YGAKGDG +D SQA L+AWK+AC+ST
Sbjct  2    AMKSYVGALLLLLSFSSSINAQVFNVATYGAKGDGSSDISQALLSAWKEACAST  55



>ref|XP_010450754.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 9/61 (15%)
 Frame = +3

Query  69   SMEVFVFLFILGLISS-----SRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            S+  F FL  L L  +     SR +     K FNV+DYGA GDG +DDS+AF +AW+D C
Sbjct  4    SVMFFTFLLSLTLFHTFQFAHSRSTLYNENKIFNVLDYGAIGDGFSDDSKAFKDAWEDTC  63

Query  222  S  224
            +
Sbjct  64   N  64



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +M+ +V   +L L  SS ++ + FNV  YGAKGDG +D SQA L+AWK+AC+ST
Sbjct  2    AMKSYVGALLLLLSFSSSINAQVFNVATYGAKGDGSSDISQALLSAWKEACAST  55



>gb|ABD28723.1| Glycoside hydrolase, family 28 [Medicago truncatula]
Length=392

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 5/46 (11%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +F LGL  ++     +FNV+ YGA GDG T+DS AFL AWKD C+S
Sbjct  5    MFKLGLSITT-----TFNVLQYGAVGDGKTNDSPAFLKAWKDVCNS  45



>gb|AAL30418.1|AF434714_1 dehiscence-related endopolygalaturonase [Glycine max]
Length=428

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 3/43 (7%)
 Frame = +3

Query  99   LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            LG ISSS    K+ NV DYGA GDG TDD+QAF  AW+ ACSS
Sbjct  52   LGDISSS---LKTVNVNDYGAPGDGKTDDTQAFKEAWEVACSS  91



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +M+ +V   +L L  SS ++ + FNV  YGAKGDG +D SQA L+AWK+AC+ST
Sbjct  2    AMKSYVGALLLLLSFSSSINAQVFNVATYGAKGDGSSDISQALLSAWKEACAST  55



>emb|CDY17906.1| BnaC04g03130D [Brassica napus]
Length=393

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            Y   + +F  +  LI+SS  +  SFNV  YGA+GDG TD ++ FL AW  AC S
Sbjct  7    YPCTIMLFFIVFYLINSSN-AMPSFNVQRYGARGDGRTDATEPFLTAWSLACES  59



>gb|KFK42901.1| hypothetical protein AALP_AA1G053200 [Arabis alpina]
Length=975

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  I  S  S   FNV+ +GAK DG+TD + AFL AW+ ACSS
Sbjct  10   LIFTLLIIFIDVSTGSSNIFNVVSFGAKPDGVTDSTAAFLKAWQGACSS  58



>gb|KDP29312.1| hypothetical protein JCGZ_19407 [Jatropha curcas]
Length=398

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            SFNV+DYGA GDG TD+SQA L AW+D C +T
Sbjct  21   SFNVLDYGAIGDGKTDNSQAVLRAWEDLCGAT  52



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +3

Query  93   FILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
             +L L S++ VSC + F+V  YGA+ DG TD SQA L AW DACSS PV
Sbjct  12   LMLLLASAAEVSCDTIFDVTKYGARADGNTDISQALLKAWGDACSS-PV  59



>gb|KHN22454.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            F+ L IL +++    S   +FNV+ YGA G+G T+DS AFL AWK AC S
Sbjct  29   FIVLMILSVLTPGLSSTIITFNVLQYGAVGNGQTNDSPAFLKAWKAACQS  78



>ref|XP_003546050.2| PREDICTED: probable polygalacturonase At1g80170-like [Glycine 
max]
Length=412

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            F+ L IL +++    S   +FNV+ YGA G+G T+DS AFL AWK AC S
Sbjct  16   FIVLMILSVLTPGLSSTIITFNVLQYGAVGNGQTNDSPAFLKAWKAACQS  65



>gb|AFW83378.1| hypothetical protein ZEAMMB73_073291 [Zea mays]
Length=284

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            FNV+D+GAKGDG+TDD++AF  AW  AC
Sbjct  143  FNVVDFGAKGDGVTDDTKAFEGAWAAAC  170



>ref|XP_003528555.2| PREDICTED: polygalacturonase-like [Glycine max]
Length=461

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  69   SMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S  + +   ILG  + SS     ++NV+++GAK DG TD ++AFLNAW  AC+ST
Sbjct  72   SPSLIILRVILGCWLCSSVALGATYNVVNFGAKSDGKTDSTKAFLNAWAKACAST  126



>emb|CDY65225.1| BnaCnng46160D [Brassica napus]
Length=153

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (52%), Gaps = 7/64 (11%)
 Frame = +3

Query  36   ASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKD  215
            AS F + C          LF+  + S      K FNV  YGAK +G TD+++AF N WK 
Sbjct  5    ASAFKVLC-------LSLLFVAAVASRPTNRPKVFNVQRYGAKANGKTDNAKAFTNIWKS  57

Query  216  ACSS  227
            AC+ 
Sbjct  58   ACTR  61



>gb|AFW83380.1| hypothetical protein ZEAMMB73_073291 [Zea mays]
Length=291

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            FNV+D+GAKGDG+TDD++AF  AW  AC
Sbjct  143  FNVVDFGAKGDGVTDDTKAFEGAWAAAC  170



>gb|KDO45234.1| hypothetical protein CISIN_1g013309mg [Citrus sinensis]
Length=362

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 37/70 (53%), Gaps = 3/70 (4%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQA  194
            ++L   +  L     S E F  L  L    S+    KS  VI   D+GAKGDG  DD++A
Sbjct  14   IVLIHVLVCLSASLVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFNDDTEA  73

Query  195  FLNAWKDACS  224
            F NAWK ACS
Sbjct  74   FANAWKKACS  83



>ref|XP_010937534.1| PREDICTED: polygalacturonase-like [Elaeis guineensis]
Length=650

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S K  NV D+GAKGDG TDD++AF  AWK+ACSS+
Sbjct  79   SQKVVNVEDHGAKGDGTTDDTEAFEMAWKEACSSS  113



>ref|XP_010025868.1| PREDICTED: polygalacturonase-like [Eucalyptus grandis]
 gb|KCW57480.1| hypothetical protein EUGRSUZ_H00250 [Eucalyptus grandis]
Length=386

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +F+ L  L LIS +      +NV+ YGAK DG TD ++AFL AWK AC S
Sbjct  6    IFLMLTCLVLISPTEAD---YNVVRYGAKPDGATDATEAFLRAWKAACGS  52



>emb|CAN62658.1| hypothetical protein VITISV_039094 [Vitis vinifera]
Length=435

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 8/62 (13%)
 Frame = +3

Query  66   YSMEVFVFL--FILGLISSSRVS------CKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            Y+M+ F  L   IL + SS   +        +FNV+D+GA GDG+TDDSQAFL AW   C
Sbjct  23   YAMQDFSILICLILSMASSGSSNVALNGRTTTFNVLDFGAIGDGVTDDSQAFLKAWNAVC  82

Query  222  SS  227
            ++
Sbjct  83   TA  84



>ref|XP_009766215.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=394

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            SC S+NV+++GA+GDG TD ++AFL AW  AC+S
Sbjct  24   SCLSYNVVNFGARGDGRTDSTRAFLRAWSAACNS  57



>ref|XP_006418000.1| hypothetical protein EUTSA_v10007830mg [Eutrema salsugineum]
 gb|ESQ36353.1| hypothetical protein EUTSA_v10007830mg [Eutrema salsugineum]
Length=395

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  I +S  + K FNV+++GAK DG+TD + AFL AW+ AC S
Sbjct  10   LLFTLLITFIDASTGASKVFNVLNFGAKPDGVTDSTAAFLEAWQAACGS  58



>gb|KHN42968.1| Polygalacturonase [Glycine soja]
Length=395

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  69   SMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S  + +   ILG  + SS     ++NV+++GAK DG TD ++AFLNAW  AC+ST
Sbjct  9    SPSLIILRVILGCWLCSSVALGATYNVVNFGAKSDGKTDSTKAFLNAWAKACAST  63



>gb|KEH23656.1| endo polygalacturonase [Medicago truncatula]
Length=384

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            S + FNV DYGAKGDG TDD+QAF  AW+  CSS
Sbjct  61   SLQIFNVSDYGAKGDGKTDDTQAFEKAWEAVCSS  94



>ref|NP_001275837.1| polygalacturonase precursor [Citrus sinensis]
 gb|ABM67700.1| polygalacturonase [Citrus sinensis]
Length=445

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 37/70 (53%), Gaps = 3/70 (4%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQA  194
            ++L   +  L     S E F  L  L    S+    KS  VI   D+GAKGDG  DD++A
Sbjct  14   IVLIHVLVCLSASLVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFNDDTEA  73

Query  195  FLNAWKDACS  224
            F NAWK ACS
Sbjct  74   FANAWKKACS  83



>ref|XP_009605359.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=392

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 11/61 (18%)
 Frame = +3

Query  45   FALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            F L   F+S   F+ LF+         SC ++NV+ YGA+GDG TD + AFL AW  ACS
Sbjct  7    FLLALVFFS---FISLFL--------PSCLAYNVVSYGARGDGGTDSTTAFLRAWSAACS  55

Query  225  S  227
            S
Sbjct  56   S  56



>gb|KDO45233.1| hypothetical protein CISIN_1g013309mg [Citrus sinensis]
Length=445

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 37/70 (53%), Gaps = 3/70 (4%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQA  194
            ++L   +  L     S E F  L  L    S+    KS  VI   D+GAKGDG  DD++A
Sbjct  14   IVLIHVLVCLSASLVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFNDDTEA  73

Query  195  FLNAWKDACS  224
            F NAWK ACS
Sbjct  74   FANAWKKACS  83



>ref|XP_010485180.1| PREDICTED: polygalacturonase-like isoform X2 [Camelina sativa]
Length=362

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  I+ SR +   FNV+ +GAK +G+TD + AFL AW+ AC S
Sbjct  10   LLFTLVITFINISRSASNVFNVVSFGAKPEGVTDSTAAFLKAWQGACGS  58



>ref|XP_009135455.1| PREDICTED: probable polygalacturonase At3g15720 [Brassica rapa]
Length=453

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 4/47 (9%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            +F L + +SS    K+ +V  YGA GDG+TDDSQAFL AW+  CS T
Sbjct  12   VFFLHIFTSS----KALDVTQYGANGDGVTDDSQAFLKAWEAVCSGT  54



>ref|XP_006411455.1| hypothetical protein EUTSA_v10016680mg [Eutrema salsugineum]
 gb|ESQ52908.1| hypothetical protein EUTSA_v10016680mg [Eutrema salsugineum]
Length=434

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            + +V D+GA+GDG TDD+QAF+NAWK ACSS
Sbjct  67   TVSVSDFGARGDGKTDDTQAFVNAWKKACSS  97



>ref|XP_010324757.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=440

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/66 (35%), Positives = 38/66 (58%), Gaps = 7/66 (11%)
 Frame = +3

Query  30   LSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAW  209
            +  ++   +CC +    F+FL       +S  S  ++NV+++GAK DG +D +Q FL AW
Sbjct  1    MPKALVTFWCCVFFSFRFIFL-------NSNASSITYNVLNFGAKSDGKSDATQPFLKAW  53

Query  210  KDACSS  227
              AC+S
Sbjct  54   VAACTS  59



>ref|XP_010533165.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ++ F+  F+L  I SS  S   F  +V+D+GA GDG T+D+QAFL+AW +AC S
Sbjct  15   LQEFLAFFVL-FIGSSHFSSAEFYLDVLDFGAVGDGHTNDTQAFLDAWDEACGS  67



>ref|XP_002863541.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39800.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +3

Query  72   MEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ME+ +  +F L L+ S  V+ + ++V+ +GAKG+G+TDDS+AF+ AWK  C S
Sbjct  1    MEIILRGVFFLTLLHSVLVNGQIYDVLKFGAKGNGITDDSKAFVTAWKAMCGS  53



>ref|XP_009142785.1| PREDICTED: polygalacturonase ADPG2-like [Brassica rapa]
 emb|CDX79907.1| BnaA05g02490D [Brassica napus]
Length=435

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 3/44 (7%)
 Frame = +3

Query  105  LISSSRVSCK---SFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            L S +RVS +   + +V D+GAKGDG TDD+QAF+NAW  ACSS
Sbjct  56   LKSFARVSSRPPTTVSVSDFGAKGDGKTDDTQAFVNAWNKACSS  99



>ref|XP_010248280.1| PREDICTED: polygalacturonase-like, partial [Nelumbo nucifera]
Length=163

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 2/52 (4%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC-SSTP  233
            F+F  +   +S + V   S+NV D+GAKGDG TD + AFL+AW  AC SS+P
Sbjct  7    FLFSLVFIFLSPTTVGA-SYNVDDFGAKGDGKTDSTHAFLDAWTGACGSSSP  57



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +3

Query  87   FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            FLF++     +R +   F++  YGAK DG TDDSQA   AWK+AC+ST
Sbjct  12   FLFLISFSIKARAA--DFDIKKYGAKADGKTDDSQAINRAWKEACAST  57



>ref|XP_006342403.1| PREDICTED: exopolygalacturonase-like [Solanum tuberosum]
Length=323

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +3

Query  93   FILGLI-SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            FI GL+   +    K FNV+ YGAK DG+TD+S+AFL AW  AC
Sbjct  11   FIFGLVLVCTNAEGKVFNVLSYGAKADGVTDNSKAFLKAWAAAC  54



>ref|XP_010457659.1| PREDICTED: polygalacturonase-like isoform X1 [Camelina sativa]
Length=395

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  I+ SR +   FNV+ +GAK DG+TD +  FL AW+ AC S
Sbjct  10   LLFTLVITFINVSRSASNVFNVVSFGAKPDGVTDSTAGFLKAWQGACGS  58



>ref|XP_006302097.1| hypothetical protein CARUB_v10020088mg, partial [Capsella rubella]
 gb|EOA34995.1| hypothetical protein CARUB_v10020088mg, partial [Capsella rubella]
Length=550

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            ++FNV+D+GAKGDGM+DD+QAF  AW  AC
Sbjct  131  QAFNVLDFGAKGDGMSDDTQAFEAAWASAC  160



>ref|XP_010533164.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Tarenaya 
hassleriana]
Length=424

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ++ F+  F+L  I SS  S   F  +V+D+GA GDG T+D+QAFL+AW +AC S
Sbjct  15   LQEFLAFFVL-FIGSSHFSSAEFYLDVLDFGAVGDGHTNDTQAFLDAWDEACGS  67



>gb|EEC70025.1| hypothetical protein OsI_00592 [Oryza sativa Indica Group]
Length=274

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            + F+ +L L  SS    +  +NV+D+ A GDG TDD++AFL AW++ C++
Sbjct  121  YTFVLLLVLTRSSEAQKRPLYNVLDFNATGDGNTDDTKAFLAAWEETCNN  170



>ref|XP_010457660.1| PREDICTED: polygalacturonase-like isoform X2 [Camelina sativa]
Length=326

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  I+ SR +   FNV+ +GAK DG+TD +  FL AW+ AC S
Sbjct  10   LLFTLVITFINVSRSASNVFNVVSFGAKPDGVTDSTAGFLKAWQGACGS  58



>ref|XP_010485172.1| PREDICTED: polygalacturonase-like isoform X1 [Camelina sativa]
Length=395

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  I+ SR +   FNV+ +GAK +G+TD + AFL AW+ AC S
Sbjct  10   LLFTLVITFINISRSASNVFNVVSFGAKPEGVTDSTAAFLKAWQGACGS  58



>ref|XP_006372694.1| polygalacturonase family protein [Populus trichocarpa]
 gb|ERP50491.1| polygalacturonase family protein [Populus trichocarpa]
Length=390

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +V LF+      S  +  S+NVI +GAK DG TD +Q FL AW  AC S
Sbjct  8    YVVLFLFCTFQQSNAASASYNVIKFGAKPDGKTDSTQPFLKAWSAACGS  56



>emb|CDY47808.1| BnaC07g07010D [Brassica napus]
Length=400

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            L  + + SSS    K F+V  YGAKGDG  D++ AF NAW+DAC+
Sbjct  15   LLFVTVSSSSATEPKVFDVQSYGAKGDGTADNANAFTNAWRDACA  59



>ref|XP_009360500.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=424

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +NV+DYGA GDG TDDS+AF+ AWK AC +
Sbjct  28   YNVLDYGAIGDGQTDDSEAFVKAWKAACRT  57



>emb|CDY47212.1| BnaC09g14610D [Brassica napus]
Length=536

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGM+DD++AF  AW  AC
Sbjct  118  QEFNVLDFGAKGDGMSDDTEAFEAAWASAC  147



>ref|XP_006306433.1| hypothetical protein CARUB_v10012375mg [Capsella rubella]
 gb|EOA39331.1| hypothetical protein CARUB_v10012375mg [Capsella rubella]
Length=395

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  ++  IS S  +  +FNV+ +GAK DG+TD + AFL AW+ AC S
Sbjct  10   LLFTLLITFISVSSSASNAFNVVSFGAKPDGVTDSTAAFLKAWQGACVS  58



>ref|XP_004169597.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=399

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S+ V   S+NV+D G KGDG TD +QAF  AW +AC+ST
Sbjct  25   STFVDASSYNVVDVGGKGDGTTDSTQAFQTAWTNACAST  63



>ref|XP_004289976.1| PREDICTED: polygalacturonase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=449

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S+  S K  +V D+GAKG+G  DD+QAF+ AWK ACSST
Sbjct  78   STSASVKQVSVDDFGAKGNGAADDTQAFVKAWKTACSST  116



>ref|XP_011458024.1| PREDICTED: polygalacturonase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=441

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S+  S K  +V D+GAKG+G  DD+QAF+ AWK ACSST
Sbjct  78   STSASVKQVSVDDFGAKGNGAADDTQAFVKAWKTACSST  116



>ref|XP_010526688.1| PREDICTED: polygalacturonase [Tarenaya hassleriana]
Length=392

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            V ++L ++ +I SS+ +  S+NV  YGA+GDG TD ++AF  AW  AC S
Sbjct  10   VAIYLLLMMIIDSSKAT-PSYNVQRYGARGDGQTDSTKAFHTAWSMACRS  58



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            VF+  ++L  I +S  +  S FNV++YGAK DG TDD +  L AWK AC+S
Sbjct  16   VFLCTYLLTCIKNSESAIISNFNVVNYGAKCDGKTDDGKPILEAWKQACNS  66



>ref|XP_002524365.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF37976.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=387

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            M    FL    L  +S  +  ++NV+ YGAK +G+TD ++AFL+AW  AC ST
Sbjct  1    MASLFFLIFFALYVNSSFATDNYNVLSYGAKPNGITDSTKAFLDAWAAACGST  53



>emb|CDY50367.1| BnaA09g13160D [Brassica napus]
Length=536

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGM+DD++AF  AW  AC
Sbjct  118  QEFNVLDFGAKGDGMSDDTEAFEAAWASAC  147



>ref|XP_009781155.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=391

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            SFNV+DYGA  D +TD+S+AFLN+W  ACSS+
Sbjct  85   SFNVLDYGATADRITDNSKAFLNSWNHACSSS  116



>ref|XP_004498711.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=400

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 9/55 (16%)
 Frame = +3

Query  90   LFILGLISSSRVSCKS---------FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            L I+GL+    VSC S         FNV+ YGAKGDG++DD+ AF   W+D C +
Sbjct  6    LLIIGLLIFCIVSCNSWVGFCQQNTFNVLQYGAKGDGISDDTPAFEKVWEDLCGA  60



>ref|XP_010451040.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=405

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +3

Query  69   SMEVFVFLFI-LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            SME  + ++I +  +    V+ +++NV++YGAKGDG TDDS+ F  AW D C
Sbjct  9    SMETTLRVWIWINFLCFVLVNGQNYNVLNYGAKGDGQTDDSEVFEQAWNDTC  60



>emb|CDX97704.1| BnaA05g23750D [Brassica napus]
Length=456

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 5/49 (10%)
 Frame = +3

Query  78   VFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + +F +FIL + + S    K+ +V  YGA GDG+TDDSQAFL AW+D C
Sbjct  7    ILIFSVFILQIFTYS----KALDVTQYGAVGDGVTDDSQAFLKAWEDVC  51



>ref|NP_564758.2| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AAB71972.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE33700.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=540

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGM+DD+QAF  AW  AC
Sbjct  121  QQFNVLDFGAKGDGMSDDTQAFEAAWASAC  150



>ref|XP_009775639.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=395

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            S+++F+F   + LI  S   C ++NV+ +GA+GDG TD +  FL AW  ACSS
Sbjct  9    SLQLFIFSSSILLIIPS---CLAYNVVSFGARGDGRTDSTAPFLRAWMAACSS  58



>ref|XP_008802072.1| PREDICTED: polygalacturonase-like [Phoenix dactylifera]
Length=387

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  87   FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            FL     ISS  ++  ++N++D+GAK DG TD ++AFL+AW  AC +
Sbjct  8    FLLTFLFISSFTIAMAAYNIVDFGAKSDGRTDSAKAFLSAWSAACEA  54



>ref|XP_004502362.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
 ref|XP_004502363.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=395

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 5/55 (9%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKS-----FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +F  L +  + S S V   +     FNV  YGAKGDG+ DDS AFL AW+D C++
Sbjct  4    LFAILLLFFIASPSLVKINAANDLCFNVFQYGAKGDGVADDSNAFLKAWQDVCAA  58



>ref|XP_010475274.1| PREDICTED: polygalacturonase-like isoform X2 [Camelina sativa]
Length=362

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
             +F  +  LI+ S  +   FNV+ +GAK DG+TD + AFL AW+ AC S
Sbjct  10   LLFTLVTTLINVSSSASNVFNVVSFGAKPDGVTDSTAAFLKAWQGACGS  58



>ref|XP_007157814.1| hypothetical protein PHAVU_002G100400g [Phaseolus vulgaris]
 gb|ESW29808.1| hypothetical protein PHAVU_002G100400g [Phaseolus vulgaris]
Length=397

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  93   FILGLI-----SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            FIL LI      SS V   ++NV+ +GAK DG TD + AFLNAW  AC+ST
Sbjct  12   FILHLILCCCFCSSLVMGATYNVVSFGAKSDGKTDSTTAFLNAWAKACAST  62



>ref|XP_008394260.1| PREDICTED: polygalacturonase [Malus domestica]
Length=405

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  63   FYSMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +Y   V +F  I  L + SS  +  S+NV+ +GA+ DG TD +QAF+ AW  ACSS
Sbjct  14   YYVAAVMLFFTISILFLQSSNAAAVSYNVMKFGARADGKTDSTQAFVKAWASACSS  69



>ref|XP_009416672.1| PREDICTED: polygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=287

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            S+N+ DYGAK DG TD ++ FLNAW  AC+ST
Sbjct  93   SYNISDYGAKPDGRTDSAKPFLNAWAAACNST  124



>ref|XP_006353136.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=396

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            V +F   L S ++++   +NV  YGAK DG TD ++AFLNAW  AC+ST
Sbjct  16   VIMFFFHLSSGTKIT---YNVQSYGAKPDGKTDSTKAFLNAWAAACAST  61



>ref|XP_010417992.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=540

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGM+DD+QAF  AW  AC
Sbjct  121  QQFNVLDFGAKGDGMSDDTQAFEAAWASAC  150



>emb|CDY30107.1| BnaC05g37550D [Brassica napus]
Length=456

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +3

Query  78   VFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            + +F +FIL   + S    K+ +V  YGA GDG+TDDSQAFL AW+D CS
Sbjct  7    ILIFSVFILQTFTYS----KALDVTQYGAVGDGVTDDSQAFLKAWEDVCS  52



>ref|XP_004150164.1| PREDICTED: sister chromatid cohesion 1 protein 3-like [Cucumis 
sativus]
Length=908

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            VFV  F L +  SS     ++NVI +GAK DG TD +Q+FL AW  ACSS
Sbjct  9    VFVLFFHLFIQISS---AGNYNVITFGAKPDGKTDSTQSFLKAWMSACSS  55



>ref|XP_010473235.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=542

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGM+DD+QAF  AW  AC
Sbjct  123  QQFNVLDFGAKGDGMSDDTQAFEAAWASAC  152



>gb|AAL31197.1| At1g60590/F8A5_12 [Arabidopsis thaliana]
 gb|AAN18178.1| At1g60590/F8A5_12 [Arabidopsis thaliana]
Length=474

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGM+DD+QAF  AW  AC
Sbjct  55   QQFNVLDFGAKGDGMSDDTQAFEAAWASAC  84



>ref|XP_004251989.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=395

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            +F+F  IL L   S  +  ++NV+ +GAK +G  D +Q+FLNAW+ AC+S
Sbjct  11   IFLFSSILNLFIKSSNASTTYNVLSFGAKPNGQIDATQSFLNAWRAACTS  60



>ref|XP_009121649.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Brassica rapa]
Length=442

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            S  +FNV+DYGAKGDG +DD++AF +AW +AC
Sbjct  39   SSGTFNVLDYGAKGDGTSDDTKAFEDAWNEAC  70



>emb|CDY39291.1| BnaC06g27000D [Brassica napus]
Length=403

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 7/63 (11%)
 Frame = +3

Query  36   ASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKD  215
            AS F  +C          LF+  + S      K FNV  YGAK DG TD+++AF N WK 
Sbjct  5    ASAFKAFC-------LSLLFVAAIASRQINRPKVFNVQRYGAKADGKTDNTKAFTNIWKS  57

Query  216  ACS  224
            AC+
Sbjct  58   ACT  60



>ref|XP_010510936.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=534

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            + FNV+D+GAKGDGM+DD+QAF  AW  AC
Sbjct  115  QQFNVLDFGAKGDGMSDDTQAFEAAWASAC  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561347857865