BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015G07

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  75.9    5e-14   Solanum tuberosum [potatoes]
ref|XP_010244354.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1  74.7    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009786385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  74.7    1e-13   Nicotiana sylvestris
gb|AFR58665.1|  jasmonoyl-L-isoleucine hydrolase 1                    73.6    4e-13   Nicotiana attenuata
ref|XP_004235624.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  71.6    1e-12   Solanum lycopersicum
ref|XP_007012936.1|  Peptidase M20/M25/M40 family protein isoform 2   69.7    4e-12   
gb|EYU21408.1|  hypothetical protein MIMGU_mgv1a006385mg              70.1    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_009630468.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  70.1    6e-12   Nicotiana tomentosiformis
ref|XP_007012935.1|  Peptidase M20/M25/M40 family protein isoform 1   69.7    7e-12   
ref|XP_007012939.1|  Peptidase M20/M25/M40 family protein isoform 5   69.7    7e-12   
gb|KJB65087.1|  hypothetical protein B456_010G080300                  67.8    1e-11   Gossypium raimondii
gb|KJB54327.1|  hypothetical protein B456_009G029600                  67.4    4e-11   Gossypium raimondii
gb|KJB54330.1|  hypothetical protein B456_009G029600                  67.4    4e-11   Gossypium raimondii
gb|KJB54329.1|  hypothetical protein B456_009G029600                  67.4    5e-11   Gossypium raimondii
gb|KJB65086.1|  hypothetical protein B456_010G080300                  67.4    5e-11   Gossypium raimondii
gb|KHG25042.1|  IAA-amino acid hydrolase ILR1-like 4                  66.2    1e-10   Gossypium arboreum [tree cotton]
ref|XP_006392996.1|  hypothetical protein EUTSA_v10011481mg           64.7    2e-10   
gb|KDO58673.1|  hypothetical protein CISIN_1g013076mg                 64.3    3e-10   Citrus sinensis [apfelsine]
ref|XP_010088385.1|  IAA-amino acid hydrolase ILR1-like 4             64.7    4e-10   Morus notabilis
ref|XP_006426465.1|  hypothetical protein CICLE_v10025591mg           64.3    5e-10   Citrus clementina [clementine]
ref|XP_006392998.1|  hypothetical protein EUTSA_v10011481mg           64.3    5e-10   Eutrema salsugineum [saltwater cress]
ref|XP_006466100.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  64.3    6e-10   Citrus sinensis [apfelsine]
gb|KDO58672.1|  hypothetical protein CISIN_1g013076mg                 64.3    6e-10   Citrus sinensis [apfelsine]
ref|XP_008242448.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  64.3    6e-10   Prunus mume [ume]
emb|CAA73905.1|  JR3 protein                                          63.9    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175587.1|  IAA-amino acid hydrolase IAR3                       63.9    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288913.1|  IAA-amino acid hydrolase ILR1-like 4 precursor   63.9    8e-10   Brassica rapa
ref|XP_007202052.1|  hypothetical protein PRUPE_ppa005751mg           63.9    8e-10   Prunus persica
ref|XP_006307542.1|  hypothetical protein CARUB_v10009165mg           63.5    1e-09   
ref|XP_010049762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  63.2    1e-09   Eucalyptus grandis [rose gum]
emb|CDX87841.1|  BnaC06g09030D                                        63.2    1e-09   
ref|XP_010528938.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  63.2    2e-09   Tarenaya hassleriana [spider flower]
gb|KCW82520.1|  hypothetical protein EUGRSUZ_C03922                   63.2    2e-09   Eucalyptus grandis [rose gum]
emb|CAN70580.1|  hypothetical protein VITISV_033718                   62.8    2e-09   Vitis vinifera
ref|XP_002281321.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  62.8    2e-09   Vitis vinifera
ref|XP_002303219.1|  putative auxin-amidohydrolase precursor fami...  62.4    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004146834.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  62.4    2e-09   Cucumis sativus [cucumbers]
ref|XP_003597384.1|  IAA-amino acid hydrolase ILR1-like protein       62.4    3e-09   Medicago truncatula
gb|KCW82521.1|  hypothetical protein EUGRSUZ_C03922                   62.4    3e-09   Eucalyptus grandis [rose gum]
ref|XP_011013030.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  62.0    3e-09   Populus euphratica
emb|CDY43926.1|  BnaA05g15360D                                        62.0    3e-09   Brassica napus [oilseed rape]
gb|ACZ56438.1|  IAA-amino acid hydrolase                              62.0    4e-09   Populus tomentosa [Chinese white poplar]
ref|XP_004287508.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  62.0    4e-09   Fragaria vesca subsp. vesca
ref|XP_003531635.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  61.6    4e-09   Glycine max [soybeans]
emb|CAG32961.1|  putative auxin-amidohydrolase precursor              61.6    5e-09   Populus tremula x Populus alba [gray poplar]
ref|XP_011072466.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  60.5    1e-08   Sesamum indicum [beniseed]
ref|XP_010535205.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  60.5    1e-08   Tarenaya hassleriana [spider flower]
ref|NP_001242296.1|  uncharacterized protein LOC100789607 precursor   60.5    1e-08   Glycine max [soybeans]
ref|XP_010049575.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  60.1    2e-08   Eucalyptus grandis [rose gum]
gb|AES67899.2|  tyrosine kinase family protein                        60.5    2e-08   Medicago truncatula
ref|XP_003597648.1|  Receptor-like protein kinase                     60.5    2e-08   
ref|XP_003530010.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  60.1    2e-08   
ref|XP_010479682.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  59.3    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003530016.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  59.3    4e-08   
ref|XP_004486800.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  58.9    4e-08   Cicer arietinum [garbanzo]
ref|XP_009794201.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  58.5    5e-08   Nicotiana sylvestris
gb|EPS67015.1|  hypothetical protein M569_07761                       58.5    5e-08   Genlisea aurea
ref|XP_008447583.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  58.5    5e-08   Cucumis melo [Oriental melon]
ref|XP_002891660.1|  IAA-alanine resistant 3                          58.5    6e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_007135596.1|  hypothetical protein PHAVU_010G142700g           58.5    6e-08   Phaseolus vulgaris [French bean]
ref|XP_010462018.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  58.2    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003531633.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  58.2    9e-08   Glycine max [soybeans]
ref|XP_010536843.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2  58.2    9e-08   Tarenaya hassleriana [spider flower]
ref|XP_002891662.1|  hypothetical protein ARALYDRAFT_892161           57.8    1e-07   Arabidopsis lyrata subsp. lyrata
ref|NP_175589.1|  IAA-amino acid hydrolase ILR1-like 5                57.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515893.1|  IAA-amino acid hydrolase ILR1 precursor, put...  57.8    1e-07   Ricinus communis
ref|XP_010500762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  57.4    1e-07   Camelina sativa [gold-of-pleasure]
gb|ABB60090.1|  IAA-amino acid hydrolase 3                            57.4    1e-07   Brassica rapa
ref|XP_007215385.1|  hypothetical protein PRUPE_ppa005752mg           57.0    2e-07   Prunus persica
ref|XP_009624362.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  57.0    2e-07   Nicotiana tomentosiformis
ref|XP_010924947.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1  57.0    2e-07   Elaeis guineensis
ref|XP_010690089.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  57.0    2e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN11323.1|  IAA-amino acid hydrolase ILR1-like 4                  57.0    2e-07   Glycine soja [wild soybean]
ref|NP_001242429.1|  uncharacterized protein LOC100790664 precursor   56.6    2e-07   Glycine max [soybeans]
gb|KJB70348.1|  hypothetical protein B456_011G068400                  55.5    4e-07   Gossypium raimondii
ref|XP_008244751.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  55.8    5e-07   Prunus mume [ume]
gb|KDP40816.1|  hypothetical protein JCGZ_24815                       55.5    7e-07   Jatropha curcas
gb|KJB70347.1|  hypothetical protein B456_011G068400                  55.5    8e-07   Gossypium raimondii
gb|KDP33760.1|  hypothetical protein JCGZ_07331                       55.5    8e-07   Jatropha curcas
ref|XP_003533023.2|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  52.8    8e-07   
gb|KHN11324.1|  IAA-amino acid hydrolase ILR1-like 4                  52.8    9e-07   Glycine soja [wild soybean]
ref|XP_006305862.1|  hypothetical protein CARUB_v10010946mg           55.1    9e-07   Capsella rubella
ref|XP_006585547.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  52.8    1e-06   
gb|KDO55919.1|  hypothetical protein CISIN_1g013332mg                 54.3    1e-06   Citrus sinensis [apfelsine]
ref|XP_006475371.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  54.3    2e-06   Citrus sinensis [apfelsine]
gb|KDO55918.1|  hypothetical protein CISIN_1g013332mg                 53.9    2e-06   Citrus sinensis [apfelsine]
gb|KDO55917.1|  hypothetical protein CISIN_1g013332mg                 54.3    2e-06   Citrus sinensis [apfelsine]
gb|KDO55915.1|  hypothetical protein CISIN_1g013332mg                 54.3    2e-06   Citrus sinensis [apfelsine]
gb|KDO55916.1|  hypothetical protein CISIN_1g013332mg                 54.3    2e-06   Citrus sinensis [apfelsine]
ref|XP_010500767.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5  53.9    2e-06   
ref|XP_007135595.1|  hypothetical protein PHAVU_010G142600g           53.9    2e-06   Phaseolus vulgaris [French bean]
ref|XP_008806725.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1  53.5    3e-06   Phoenix dactylifera
ref|NP_001288981.1|  IAA-amino acid hydrolase ILR1-like 2 precursor   53.5    3e-06   Brassica rapa
emb|CDY32768.1|  BnaA10g10810D                                        53.5    3e-06   Brassica napus [oilseed rape]
ref|XP_009338136.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  53.5    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_004135685.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  53.1    4e-06   Cucumis sativus [cucumbers]
ref|XP_004158429.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...  53.1    4e-06   
emb|CDX88581.1|  BnaA03g10680D                                        53.1    5e-06   
emb|CDY32874.1|  BnaC09g33210D                                        52.8    6e-06   Brassica napus [oilseed rape]
ref|XP_010500765.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5  52.8    6e-06   Camelina sativa [gold-of-pleasure]
gb|KHG30726.1|  IAA-amino acid hydrolase ILR1-like 4                  52.8    6e-06   Gossypium arboreum [tree cotton]
ref|XP_010479683.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5  52.8    6e-06   Camelina sativa [gold-of-pleasure]
emb|CDY69786.1|  BnaC06g41050D                                        52.0    8e-06   Brassica napus [oilseed rape]
ref|XP_003597645.1|  IAA-amino acid hydrolase ILR1-like protein       52.0    1e-05   Medicago truncatula
ref|XP_009352597.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  51.6    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_008450808.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  51.6    2e-05   Cucumis melo [Oriental melon]
ref|XP_010088388.1|  IAA-amino acid hydrolase ILR1-like 5             51.2    2e-05   Morus notabilis
ref|XP_004251653.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  51.2    2e-05   Solanum lycopersicum
ref|XP_010462020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5  51.2    2e-05   Camelina sativa [gold-of-pleasure]
gb|ACJ85027.1|  unknown                                               50.1    3e-05   Medicago truncatula
ref|XP_003597644.1|  IAA-amino acid hydrolase ILR1-like protein       50.4    4e-05   Medicago truncatula
gb|AFK37903.1|  unknown                                               50.4    4e-05   Medicago truncatula
ref|XP_009132189.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2  50.4    4e-05   Brassica rapa
ref|XP_011077950.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  50.1    4e-05   
ref|XP_006353512.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  49.7    6e-05   Solanum tuberosum [potatoes]
ref|XP_007024408.1|  Peptidase M20/M25/M40 family protein             49.7    6e-05   
gb|KFK27232.1|  hypothetical protein AALP_AA8G354700                  49.7    6e-05   Arabis alpina [alpine rockcress]
ref|XP_003543612.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  49.3    8e-05   Glycine max [soybeans]
ref|XP_007150548.1|  hypothetical protein PHAVU_005G1617001g          48.5    1e-04   Phaseolus vulgaris [French bean]
ref|XP_008367918.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...  49.3    1e-04   
ref|XP_004297620.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  48.9    1e-04   Fragaria vesca subsp. vesca
emb|CDY22869.1|  BnaA06g02080D                                        48.9    1e-04   Brassica napus [oilseed rape]
ref|XP_009147731.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  48.9    1e-04   Brassica rapa
ref|XP_011077948.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  48.9    1e-04   Sesamum indicum [beniseed]
ref|XP_011077949.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  48.9    1e-04   Sesamum indicum [beniseed]
ref|XP_009396760.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1  48.5    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008387506.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  48.5    2e-04   
gb|EYU30670.1|  hypothetical protein MIMGU_mgv1a006375mg              48.5    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_006401299.1|  hypothetical protein EUTSA_v10013558mg           48.5    2e-04   Eutrema salsugineum [saltwater cress]
ref|XP_003597649.1|  IAA-amino acid hydrolase ILR1-like protein       48.5    2e-04   
gb|AES67900.2|  IAA-amino acid hydrolase ILR1-like protein            48.1    2e-04   Medicago truncatula
gb|ABF55219.1|  auxin conjugate hydrolase                             48.1    2e-04   Medicago truncatula
gb|AFK46529.1|  unknown                                               48.1    2e-04   Lotus japonicus
ref|XP_002283047.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  47.8    3e-04   Vitis vinifera
ref|XP_003546640.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  47.8    3e-04   Glycine max [soybeans]
gb|AAL59907.1|  IAA-amino acid hydrolase                              47.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200477.1|  IAA-amino acid hydrolase ILR1-like 2                47.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49016.1|  ILL2                                                  47.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11910.1|  BnaC03g13360D                                        47.4    4e-04   Brassica napus [oilseed rape]
ref|XP_006451368.1|  hypothetical protein CICLE_v100084061mg          47.4    4e-04   Citrus clementina [clementine]
ref|XP_010914575.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1  47.0    4e-04   
ref|XP_008797894.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  47.0    5e-04   Phoenix dactylifera
ref|XP_008797895.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  47.0    5e-04   Phoenix dactylifera
ref|XP_008380826.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4  47.0    6e-04   
ref|XP_010451352.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1  46.6    6e-04   
ref|XP_010451360.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1  47.0    6e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004510337.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...  46.6    8e-04   
gb|ACJ84380.1|  unknown                                               45.4    8e-04   Medicago truncatula



>ref|XP_006343020.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=445

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTS---QEIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M  S+W FLI +   FSPIPI S+ +L S    EIP  F   AKK+EVFDWM+G+RR+IH
Sbjct  1    MDISRWVFLILIFVSFSPIPIFSDSQLRSGELSEIPSKFLDFAKKSEVFDWMMGVRRRIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_010244354.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Nelumbo nucifera]
Length=452

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M FS W  LIF+  LF P+PISS+  L+++   EI   F  LAKK E+ DWM+GIRRKIH
Sbjct  8    MEFSTWVCLIFILQLFLPMPISSDSSLSTKGFAEISANFLNLAKKPELADWMIGIRRKIH  67

Query  226  ENPE  237
            ENPE
Sbjct  68   ENPE  71



>ref|XP_009786385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=441

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M FS+W FLI +   FS IPI S+  L+  EIP  F   AKKAEVFDW+VG+RR+IHENP
Sbjct  1    MDFSRWVFLILILISFSAIPIWSDSSLS--EIPINFLNFAKKAEVFDWIVGVRRRIHENP  58

Query  235  E  237
            E
Sbjct  59   E  59



>gb|AFR58665.1| jasmonoyl-L-isoleucine hydrolase 1 [Nicotiana attenuata]
Length=441

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M FS+W FLI +   FS IPI S+  L+  EIP  F   AKKAEVFDW+VG+RR+IHENP
Sbjct  1    MDFSRWVFLILIFVSFSAIPIWSDSSLS--EIPINFLNFAKKAEVFDWIVGVRRRIHENP  58

Query  235  E  237
            E
Sbjct  59   E  59



>ref|XP_004235624.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=445

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRRKIH  225
            M  S+W FLI +   F+ IPI S+ +L+S E+P I   F   AKK+EVFDWMV +RR+IH
Sbjct  1    MDISRWVFLILIFVSFATIPIFSDSQLSSGELPDIPVKFLDFAKKSEVFDWMVEVRRRIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_007012936.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 ref|XP_007012937.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 ref|XP_007012938.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY30555.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY30556.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY30557.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
Length=330

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+F KW FLIF  +   P PISS   L  +   +IP  F + AKK E+ DWMVG+RRKIH
Sbjct  1    MAFLKWVFLIFSLYSSMPTPISSNPSLNKEALAQIPINFLEFAKKPEILDWMVGLRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|EYU21408.1| hypothetical protein MIMGU_mgv1a006385mg [Erythranthe guttata]
Length=446

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+ S     +FV FLF   PISSE  L+ +E   IP  F   A+KAE+FDWMVG+RRKIH
Sbjct  1    MTHSAAILWVFVLFLFLSKPISSESDLSPEELSEIPRNFLSFARKAEIFDWMVGVRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_009630468.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=441

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M FS+W FLI +   F  IPI S+  L+  EIP  F   AKKAEVFDW+VG+RR+IHENP
Sbjct  1    MDFSRWVFLILIFVSFFAIPIWSDSSLS--EIPINFLNFAKKAEVFDWIVGVRRRIHENP  58

Query  235  E  237
            E
Sbjct  59   E  59



>ref|XP_007012935.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOY30554.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=444

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+F KW FLIF  +   P PISS   L  +   +IP  F + AKK E+ DWMVG+RRKIH
Sbjct  1    MAFLKWVFLIFSLYSSMPTPISSNPSLNKEALAQIPINFLEFAKKPEILDWMVGLRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_007012939.1| Peptidase M20/M25/M40 family protein isoform 5 [Theobroma cacao]
 gb|EOY30558.1| Peptidase M20/M25/M40 family protein isoform 5 [Theobroma cacao]
Length=445

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+F KW FLIF  +   P PISS   L  +   +IP  F + AKK E+ DWMVG+RRKIH
Sbjct  1    MAFLKWVFLIFSLYSSMPTPISSNPSLNKEALAQIPINFLEFAKKPEILDWMVGLRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KJB65087.1| hypothetical protein B456_010G080300 [Gossypium raimondii]
Length=319

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRRKIH  225
            M+F KW  LIF    F P PISS L L  + +P I   F + +KK E+ DWMV IRRKIH
Sbjct  1    MAFLKWVLLIFTLHSFMPTPISSNLSLNKEALPQIPLNFLEFSKKPEIMDWMVNIRRKIH  60

Query  226  ENPE  237
            EN E
Sbjct  61   ENRE  64



>gb|KJB54327.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=444

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+F K  FLIF+   F PIPISS   L  +   +I   F   AKK E+ DWMVGIRRKIH
Sbjct  1    MAFLKLIFLIFILHSFMPIPISSTPSLNKEVFAQIRPDFLDFAKKPEIMDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KJB54330.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=445

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+F K  FLIF+   F PIPISS   L  +   +I   F   AKK E+ DWMVGIRRKIH
Sbjct  1    MAFLKLIFLIFILHSFMPIPISSTPSLNKEVFAQIRPDFLDFAKKPEIMDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KJB54329.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=443

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+F K  FLIF+   F PIPISS   L  +   +I   F   AKK E+ DWMVGIRRKIH
Sbjct  1    MAFLKLIFLIFILHSFMPIPISSTPSLNKEVFAQIRPDFLDFAKKPEIMDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KJB65086.1| hypothetical protein B456_010G080300 [Gossypium raimondii]
Length=488

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRRKIH  225
            M+F KW  LIF    F P PISS L L  + +P I   F + +KK E+ DWMV IRRKIH
Sbjct  46   MAFLKWVLLIFTLHSFMPTPISSNLSLNKEALPQIPLNFLEFSKKPEIMDWMVNIRRKIH  105

Query  226  ENPE  237
            EN E
Sbjct  106  ENRE  109



>gb|KHG25042.1| IAA-amino acid hydrolase ILR1-like 4 [Gossypium arboreum]
Length=437

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+F KW  LIF    F P PISS L L  +   +IP  F + +KK E+ DWMV IRRKIH
Sbjct  1    MAFLKWVLLIFTLHSFMPTPISSNLSLNKEALAQIPLNFLEFSKKPEIMDWMVNIRRKIH  60

Query  226  ENPE  237
            EN E
Sbjct  61   ENRE  64



>ref|XP_006392996.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
 gb|ESQ30282.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
Length=322

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF KW   + +  L +   ISS   LTS    +IP  F  LAK+A+ FDWMVGIRRKIH
Sbjct  1    MSFLKWVSFVLILHLLNSCMISSSSSLTSNGFSQIPPKFLALAKRADFFDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KDO58673.1| hypothetical protein CISIN_1g013076mg [Citrus sinensis]
Length=316

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = +1

Query  49   AIMSFSKWFFLIFVQFLFSPIPISSELKLTSQ----EIPGIFFKLAKKAEVFDWMVGIRR  216
              MSFSKW F++FV  L +P P+      +S     +IP      AK+ E+  WM+GIRR
Sbjct  3    GAMSFSKWVFVVFVLHLLNPCPVRFSYGSSSSNGLSDIPKKLLNFAKRQELVGWMIGIRR  62

Query  217  KIHENPE  237
            KIH+NPE
Sbjct  63   KIHQNPE  69



>ref|XP_010088385.1| IAA-amino acid hydrolase ILR1-like 4 [Morus notabilis]
 gb|EXB34859.1| IAA-amino acid hydrolase ILR1-like 4 [Morus notabilis]
Length=445

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +1

Query  67   KWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
             W  LI + F+    PI S   L+S    +IP  F   AKK EVFDWMVGIRRKIHENPE
Sbjct  5    NWVSLISIIFMLVTTPILSASSLSSDGQSQIPSKFLNFAKKGEVFDWMVGIRRKIHENPE  64



>ref|XP_006426465.1| hypothetical protein CICLE_v10025591mg [Citrus clementina]
 gb|ESR39705.1| hypothetical protein CICLE_v10025591mg [Citrus clementina]
Length=450

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = +1

Query  49   AIMSFSKWFFLIFVQFLFSPIPISSELKLTSQ----EIPGIFFKLAKKAEVFDWMVGIRR  216
              MSFSKW F++FV  L +P P+      +S     +IP      AK+ E+  WM+GIRR
Sbjct  3    GAMSFSKWVFVVFVLHLLNPCPVRFSYGSSSSNGLSDIPKKLLNFAKRQELVGWMIGIRR  62

Query  217  KIHENPE  237
            KIH+NPE
Sbjct  63   KIHQNPE  69



>ref|XP_006392998.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
 gb|ESQ30284.1| hypothetical protein EUTSA_v10011481mg [Eutrema salsugineum]
Length=444

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF KW   + +  L +   ISS   LTS    +IP  F  LAK+A+ FDWMVGIRRKIH
Sbjct  1    MSFLKWVSFVLILHLLNSCMISSSSSLTSNGFSQIPPKFLALAKRADFFDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_006466100.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Citrus 
sinensis]
Length=450

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = +1

Query  49   AIMSFSKWFFLIFVQFLFSPIPISSELKLTSQ----EIPGIFFKLAKKAEVFDWMVGIRR  216
              MSFSKW F++FV  L +P P+      +S     +IP      AK+ E+  WM+GIRR
Sbjct  3    GAMSFSKWVFVVFVLHLLNPCPVRFSYGSSSSNGLSDIPKKLLNFAKRQELVGWMIGIRR  62

Query  217  KIHENPE  237
            KIH+NPE
Sbjct  63   KIHQNPE  69



>gb|KDO58672.1| hypothetical protein CISIN_1g013076mg [Citrus sinensis]
Length=450

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = +1

Query  49   AIMSFSKWFFLIFVQFLFSPIPISSELKLTSQ----EIPGIFFKLAKKAEVFDWMVGIRR  216
              MSFSKW F++FV  L +P P+      +S     +IP      AK+ E+  WM+GIRR
Sbjct  3    GAMSFSKWVFVVFVLHLLNPCPVRFSYGSSSSNGLSDIPKKLLNFAKRQELVGWMIGIRR  62

Query  217  KIHENPE  237
            KIH+NPE
Sbjct  63   KIHQNPE  69



>ref|XP_008242448.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Prunus mume]
Length=445

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+  KW  LIF+  +  P+ ISS+  L+ +E   IP  F   AK+ E+FD+MVG+RRKIH
Sbjct  1    MALCKWVSLIFIVLVIMPLLISSDHSLSPEEVAQIPVKFLDHAKRQELFDFMVGVRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>emb|CAA73905.1| JR3 protein [Arabidopsis thaliana]
Length=444

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MSF KW   + +  L +P  IS      SQ IP  F  LAK+ + FDWMVGIRR+IHENP
Sbjct  1    MSFFKWVSFVLILHLLNPTLISCSSNGLSQ-IPSKFLTLAKRNDFFDWMVGIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|NP_175587.1| IAA-amino acid hydrolase IAR3 [Arabidopsis thaliana]
 sp|O04373.2|ILL4_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50883.1|AC025294_21 IAA-Ala hydrolase (IAR3) [Arabidopsis thaliana]
 gb|AAK53028.1|AF375444_1 At1g51760/F19C24_4 [Arabidopsis thaliana]
 gb|AAC32192.1| IAA-Ala hydrolase [Arabidopsis thaliana]
 gb|AAN28900.1| At1g51760/F19C24_4 [Arabidopsis thaliana]
 gb|AEE32712.1| IAA-amino acid hydrolase ILR1-like 4 [Arabidopsis thaliana]
Length=440

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MSF KW   + +  L +P  IS      SQ IP  F  LAK+ + FDWMVGIRR+IHENP
Sbjct  1    MSFFKWVSFVLILHLLNPTLISCSSNGLSQ-IPSKFLTLAKRNDFFDWMVGIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|NP_001288913.1| IAA-amino acid hydrolase ILR1-like 4 precursor [Brassica rapa]
 gb|ABB60091.1| IAA-amino acid hydrolase 3 [Brassica rapa]
Length=444

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF KW   + +  L +   ISS   LTS    +IP  F  LAK+ + FDWMVGIRRKIH
Sbjct  1    MSFCKWVSFVLIIHLLNSCQISSSSSLTSNGFSQIPPKFLALAKRDDFFDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_007202052.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
 gb|EMJ03251.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
Length=445

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M+  KW  LIF+  +  P+ ISS+  L+ +E   IP  F   AK+ E+FD+MVG+RRKIH
Sbjct  1    MALCKWVSLIFIVVVIMPLLISSDHSLSPEEVAQIPVKFLDHAKRQELFDFMVGVRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_006307542.1| hypothetical protein CARUB_v10009165mg [Capsella rubella]
 gb|EOA40440.1| hypothetical protein CARUB_v10009165mg [Capsella rubella]
Length=440

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MSFSKW   + + +L +   IS      SQ IP  F   AK+ + FDWMVGIRR+IHENP
Sbjct  1    MSFSKWVSFVLILYLLNSCLISCSSSGLSQ-IPSKFLTFAKRNDFFDWMVGIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_010049762.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
Length=454

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPI--SSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRK  219
            M FSKW  L+ +  LF P     SS L LT +E   IP  F  LA+K E+ D+MVGIRR+
Sbjct  1    MDFSKWVLLLLIPCLFIPRSCLCSSRLGLTPEELARIPVEFLNLAQKPEIVDYMVGIRRR  60

Query  220  IHENPE  237
            IHE PE
Sbjct  61   IHEYPE  66



>emb|CDX87841.1| BnaC06g09030D [Brassica napus]
Length=444

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF KW   + +  L +   ISS   LTS    +IP  F  LAK+ + FDWM+GIRRKIH
Sbjct  1    MSFCKWVSFVLIIHLLNSCQISSSSSLTSNGFSQIPPKFLALAKRDDFFDWMIGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_010528938.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Tarenaya hassleriana]
Length=445

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTS---QEIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF KW  L+ +  L +P  IS     TS    +IP  F  LA++ +  DWM+GIRRK+H
Sbjct  1    MSFCKWVSLVLIIHLLNPSSISCSFPQTSIGLSQIPQKFLNLAQRDDFVDWMIGIRRKLH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KCW82520.1| hypothetical protein EUGRSUZ_C03922 [Eucalyptus grandis]
Length=539

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPI--SSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRK  219
            M FSKW  L+ +  LF P     SS L LT +E   IP  F  LA+K E+ D+MVGIRR+
Sbjct  86   MDFSKWVLLLLIPCLFIPRSCLCSSRLGLTPEELARIPVEFLNLAQKPEIVDYMVGIRRR  145

Query  220  IHENPE  237
            IHE PE
Sbjct  146  IHEYPE  151



>emb|CAN70580.1| hypothetical protein VITISV_033718 [Vitis vinifera]
Length=441

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M++++W   IF+  LF P PISSE  L+S  IP  F   A+K EV DW+VG+RRKIHENP
Sbjct  1    MTYTEWVSWIFILCLFGPTPISSESSLSSN-IPTNFLSFARKQEVVDWLVGVRRKIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_002281321.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
 emb|CBI35990.3| unnamed protein product [Vitis vinifera]
Length=441

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M++++W   IF+  LF P PISSE  L+S  IP  F   A+K EV DW+VG+RRKIHENP
Sbjct  1    MTYTEWVSWIFILCLFGPTPISSESSLSSN-IPTNFLSFARKQEVVDWLVGVRRKIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_002303219.1| putative auxin-amidohydrolase precursor family protein [Populus 
trichocarpa]
 gb|EEE78198.1| putative auxin-amidohydrolase precursor family protein [Populus 
trichocarpa]
Length=438

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLT-SQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            MS   W  L F  +L SPI     L L  S +IP  F   AKK E+FDWMVG+RRKIHEN
Sbjct  1    MSLFNWVSLGFFLYLLSPI-----LSLNGSSDIPSRFLNYAKKEELFDWMVGVRRKIHEN  55

Query  232  PE  237
            PE
Sbjct  56   PE  57



>ref|XP_004146834.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 ref|XP_004154807.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 gb|KGN59844.1| hypothetical protein Csa_3G850490 [Cucumis sativus]
Length=449

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +1

Query  52   IMSFSKWFFLIFVQFLFSPIPI---SSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKI  222
            IM+  +W   I +  LF    +   SS L    QEIP  F + AK++E+FDWMVGIRRKI
Sbjct  4    IMASLRWISWILIAHLFVSTFVHSDSSSLSNNPQEIPKKFLQFAKESELFDWMVGIRRKI  63

Query  223  HENPE  237
            HENPE
Sbjct  64   HENPE  68



>ref|XP_003597384.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AES67635.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=443

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  67   KWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            K F +IF+ FL S  PI S+   +S  IP  F +LAK+ +VFDWMV IRRKIHENPE
Sbjct  8    KLFIVIFISFL-SATPIFSDSSTSSNAIPN-FLELAKEPQVFDWMVDIRRKIHENPE  62



>gb|KCW82521.1| hypothetical protein EUGRSUZ_C03922 [Eucalyptus grandis]
Length=411

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSP--IPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRK  219
            M FSKW  L+ +  LF P     SS L LT +E   IP  F  LA+K E+ D+MVGIRR+
Sbjct  86   MDFSKWVLLLLIPCLFIPRSCLCSSRLGLTPEELARIPVEFLNLAQKPEIVDYMVGIRRR  145

Query  220  IHENPE  237
            IHE PE
Sbjct  146  IHEYPE  151



>ref|XP_011013030.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=438

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKL-TSQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            MS   W  L F  +L SPI     L L  S +IP  F   AKK E+FDWMVG+RRKIHEN
Sbjct  1    MSLFNWVSLGFFLYLLSPI-----LSLKGSSDIPSRFLNYAKKEELFDWMVGVRRKIHEN  55

Query  232  PE  237
            PE
Sbjct  56   PE  57



>emb|CDY43926.1| BnaA05g15360D [Brassica napus]
Length=444

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MS  KW   + +  L +   ISS   LTS    +IP  F  LAK+ + FDWMVGIRRKIH
Sbjct  1    MSLCKWVSFVLIIHLLNSCQISSSSSLTSNGFSQIPPKFLALAKRDDFFDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|ACZ56438.1| IAA-amino acid hydrolase [Populus tomentosa]
Length=438

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLT-SQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            MS+  W  L F  +L SPI     L L  S +IP  F   AKK E+FDWMVG+RRKIHEN
Sbjct  1    MSWFNWVSLGFFLYLLSPI-----LSLNGSSDIPSRFLNYAKKEELFDWMVGVRRKIHEN  55

Query  232  PE  237
            PE
Sbjct  56   PE  57



>ref|XP_004287508.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Fragaria vesca 
subsp. vesca]
Length=473

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ----EIPGIFFKLAKKAEVFDWMVGIRRKI  222
            M+  KW  L F+  +F P+PISS   L+ +    +IP  F + AK+ E+FD MV IRRKI
Sbjct  18   MASPKWVSLTFILSMFMPLPISSNQSLSPEPELAQIPVSFLEHAKRPELFDRMVSIRRKI  77

Query  223  HENPE  237
            HENPE
Sbjct  78   HENPE  82



>ref|XP_003531635.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN11320.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=443

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  52   IMSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            + SF KWF L  +  + +  PI S    +S ++   F ++AKK +VFDWMV IRRKIHEN
Sbjct  1    MCSFKKWFNLYIIFHVLASTPIFSLSDHSSNQLSTNFLEIAKKPDVFDWMVKIRRKIHEN  60

Query  232  PE  237
            PE
Sbjct  61   PE  62



>emb|CAG32961.1| putative auxin-amidohydrolase precursor [Populus tremula x Populus 
alba]
Length=438

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLT-SQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            MS+  W  L F  +L SPI     L L  S +IP  F   AKK E+FDWMVG+RRKIHEN
Sbjct  1    MSWFNWVSLGFFLYLLSPI-----LSLNGSSDIPSRFLNHAKKEELFDWMVGVRRKIHEN  55

Query  232  PE  237
            PE
Sbjct  56   PE  57



>ref|XP_011072466.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Sesamum indicum]
Length=445

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRRKIH  225
            MSFSK  FLIF+ FL    P  S+L LTS+++P I   F   AK+ EVFDWMVGIRR+IH
Sbjct  1    MSFSKVSFLIFILFLLLCKPTFSDLLLTSKDLPEIPINFLNFAKQTEVFDWMVGIRRQIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_010535205.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Tarenaya hassleriana]
Length=444

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFV-QFLFSPIPISSELKLTS--QEIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF KW FLI V   L  P+  SS  + ++   + P  F  LAK+ E FDWMVGIRRKIH
Sbjct  1    MSFCKWVFLILVLHLLNCPLISSSSPQSSTGLSQFPQKFINLAKRDEFFDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|NP_001242296.1| uncharacterized protein LOC100789607 precursor [Glycine max]
 gb|ACU21355.1| unknown [Glycine max]
Length=431

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +1

Query  58   SFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            SF  WF L  + ++ +  PI S L  +S ++   F ++AKK EVFDWMV IRRKIHENPE
Sbjct  3    SFKTWFNLFTIFYVLAATPIFS-LTDSSNQLSTNFLEIAKKPEVFDWMVKIRRKIHENPE  61



>ref|XP_010049575.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW82275.1| hypothetical protein EUGRSUZ_C03691 [Eucalyptus grandis]
Length=445

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 40/66 (61%), Gaps = 5/66 (8%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPI--SSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRK  219
            M FSKW  L+ +  LF P     SS   LT +E   IP  F  LA+K E+ D+MVGIRR+
Sbjct  1    MDFSKWVLLLLIPCLFIPRSCLCSSRPGLTPEELARIPVEFLNLAQKPEIVDYMVGIRRR  60

Query  220  IHENPE  237
            IHE PE
Sbjct  61   IHEYPE  66



>gb|AES67899.2| tyrosine kinase family protein [Medicago truncatula]
Length=610

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  67   KWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            K F ++F+ FL S  PI S+   +S  IP  F +LAK+ +VFDWMV IRRKIHENPE
Sbjct  8    KLFIIMFISFL-SATPIFSDSSSSSNAIPN-FLELAKEPQVFDWMVDIRRKIHENPE  62



>ref|XP_003597648.1| Receptor-like protein kinase [Medicago truncatula]
Length=604

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +1

Query  67   KWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            K F ++F+ FL S  PI S+   +S  IP  F +LAK+ +VFDWMV IRRKIHENPE
Sbjct  8    KLFIIMFISFL-SATPIFSDSSSSSNAIPN-FLELAKEPQVFDWMVDIRRKIHENPE  62



>ref|XP_003530010.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=441

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  58   SFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            SF  WF L  +    +  PI S L  +  ++   F ++AKK EVFDWMV IRRKIHENPE
Sbjct  3    SFKTWFNLFIIFLASAATPIFS-LTDSPNQLSTNFLEIAKKPEVFDWMVKIRRKIHENPE  61



>ref|XP_010479682.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Camelina sativa]
Length=441

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  55   MSFSKWF-FLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            MSF K   F++ + +L +   ISS     SQ IP  F  LAK+ + FDWMVGIRR+IHEN
Sbjct  1    MSFCKRVSFVLILLYLLNSCLISSSSNGLSQ-IPSNFLTLAKRNDFFDWMVGIRRRIHEN  59

Query  232  PE  237
            PE
Sbjct  60   PE  61



>ref|XP_003530016.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=442

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M F KWF L  +  + +  PI S L  +S ++   F     K EVFDWMV IRRKIHENP
Sbjct  1    MCFFKWFNLFIIFHVLAATPIFS-LTDSSNQVSTNFLDNTNKPEVFDWMVKIRRKIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_004486800.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=445

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +1

Query  55   MSFSKWFFLIFVQF-LFSPIPISSELKLTSQEIP-GIFFKLAKKAEVFDWMVGIRRKIHE  228
            M FSKW  L+F+ F  F PI   S    ++  +P   F  LAK  +VFDWMV IRRKIHE
Sbjct  1    MGFSKWVNLLFIIFNCFLPIFSDSSSSTSNDNLPINKFLDLAKNPQVFDWMVDIRRKIHE  60

Query  229  NPE  237
            NPE
Sbjct  61   NPE  63



>ref|XP_009794201.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=445

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 35/64 (55%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRRKIH  225
            M F KW   IF    +   P  S+  L   E+  I   F  LAK+ ++FDWMV IRR IH
Sbjct  1    MGFLKWVLAIFTLCTYLATPTLSDSLLNKDELASISANFLNLAKRTDLFDWMVKIRRTIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|EPS67015.1| hypothetical protein M569_07761, partial [Genlisea aurea]
Length=418

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +1

Query  82   IFVQFLFSPIPISSE---LKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            I   FLFSP  ++     + ++S+ +P  F   AK A+VFDWMVGIRR++HENPE
Sbjct  1    ILFCFLFSPFVLAESKNPVSVSSEGVPKFFLDAAKGADVFDWMVGIRRRLHENPE  55



>ref|XP_008447583.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis melo]
Length=449

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +1

Query  52   IMSFSKWFFLIFVQFLFSPIPISSELKLTS---QEIPGIFFKLAKKAEVFDWMVGIRRKI  222
            IM+  +WF  I +  LF    + S+    S   QEIP  F + AK++E+FDWMVGIRRKI
Sbjct  4    IMASLRWFSWILIAHLFVSTFVHSDSSSHSNNPQEIPKRFLQFAKESELFDWMVGIRRKI  63

Query  223  HENPE  237
            HENPE
Sbjct  64   HENPE  68



>ref|XP_002891660.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67919.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MSF KW   + +  L +P  IS      SQ IP  F  LAK  + FDWMV IRR+IHENP
Sbjct  1    MSFFKWVSFVLILHLLNPSLISCSSNGLSQ-IPSKFLTLAKSNDFFDWMVRIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_007135596.1| hypothetical protein PHAVU_010G142700g [Phaseolus vulgaris]
 gb|ESW07590.1| hypothetical protein PHAVU_010G142700g [Phaseolus vulgaris]
Length=430

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M    WF L  +  +FS  PISS L  +S  I   F   AKK EVFDWMV +RRKIHENP
Sbjct  1    MVVKMWFHLFILFHVFSATPISS-LTDSSNIISTNFLDDAKKPEVFDWMVKLRRKIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_010462018.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Camelina 
sativa]
 ref|XP_010462019.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X2 [Camelina 
sativa]
Length=441

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  55   MSFSKWF-FLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            MSF K   +++ + +L +   ISS     SQ IP  F  LAK+ + FDWMVGIRR+IHEN
Sbjct  1    MSFCKRVSYVLILLYLLNSCLISSSSNGLSQ-IPSKFLTLAKRNDFFDWMVGIRRRIHEN  59

Query  232  PE  237
            PE
Sbjct  60   PE  61



>ref|XP_003531633.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN11319.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=442

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M+F  W     V  +F+  P    L  +S+++P  F   AKK EVFDWMV IRRKIHENP
Sbjct  1    MNFFNWVHTFIVFHVFAATPHFFLLADSSEQLPTNFLDAAKKPEVFDWMVRIRRKIHENP  60

Query  235  E  237
            E
Sbjct  61   E  61



>ref|XP_010536843.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Tarenaya hassleriana]
Length=446

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  73   FFLIFVQFLFSPIPISSELK-LTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
               +FV   F    +SSEL  + S      F +LAKK EVFDWMVGIRRKIHENPE
Sbjct  9    LIFVFVVHCFVSRGVSSELPWVHSDGDSSRFLQLAKKPEVFDWMVGIRRKIHENPE  64



>ref|XP_002891662.1| hypothetical protein ARALYDRAFT_892161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67921.1| hypothetical protein ARALYDRAFT_892161 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MSF K    + +  L +   IS      SQ IP  F  LAK+ + FDWMVGIRR+IHENP
Sbjct  1    MSFCKLVSFVLILHLLNSCLISCSSNELSQ-IPKKFLSLAKRDDFFDWMVGIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|NP_175589.1| IAA-amino acid hydrolase ILR1-like 5 [Arabidopsis thaliana]
 sp|Q9SWX9.1|ILL5_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50869.1|AC025294_7 auxin conjugate hydrolase (ILL5) [Arabidopsis thaliana]
 gb|AAD48152.1| auxin conjugate hydrolase [Arabidopsis thaliana]
 gb|AEE32715.1| IAA-amino acid hydrolase ILR1-like 5 [Arabidopsis thaliana]
Length=435

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MSF K    + +  L +   IS      SQ IP  F  LAK+ + FDWMVGIRR+IHENP
Sbjct  1    MSFCKLVSFVLILHLLNSCLISCSSNDLSQ-IPKNFLSLAKREDFFDWMVGIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_002515893.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF46313.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=435

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 7/61 (11%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MSF  W  L F  F F    +SS++ LT       F   AKK ++F+WMVG+RRKIHENP
Sbjct  1    MSFLNWASLAFCFFHFILTGLSSDVSLT-------FLDYAKKDDIFNWMVGVRRKIHENP  53

Query  235  E  237
            E
Sbjct  54   E  54



>ref|XP_010500762.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Camelina sativa]
Length=441

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  55   MSFSKWF-FLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            MSF K   F++ + +L +   ISS     SQ IP  F  LA++ + FDWMVGIRR+IHEN
Sbjct  1    MSFCKRVSFVLILLYLLNSCLISSSSNGLSQ-IPSKFLTLAQRNDFFDWMVGIRRRIHEN  59

Query  232  PE  237
            PE
Sbjct  60   PE  61



>gb|ABB60090.1| IAA-amino acid hydrolase 3 [Brassica rapa]
Length=441

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF KW   + +        ISS   LTS    +IP  F  LAK+ + FDWMVGIRRKIH
Sbjct  1    MSFCKWVSFVLI---IHSCQISSSSSLTSNGFSQIPPKFLALAKRDDFFDWMVGIRRKIH  57

Query  226  ENPE  237
            ENPE
Sbjct  58   ENPE  61



>ref|XP_007215385.1| hypothetical protein PRUPE_ppa005752mg [Prunus persica]
 gb|EMJ16584.1| hypothetical protein PRUPE_ppa005752mg [Prunus persica]
Length=445

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKL---AKKAEVFDWMVGIRRKIH  225
            M F     LI V F+F P  I S   ++S  +  I FKL   A+K +VFDWMVGIRRKIH
Sbjct  1    MEFYMQVALIIVLFVFGPTTIFSSSSVSSNGLSEIPFKLLDFAQKPQVFDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_009624362.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=445

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRRKIH  225
            M F KW    F    +   P  S+  L  +E+  I   F  LAK+ ++FDWMV IRR IH
Sbjct  1    MGFLKWVLAFFSLCTYLATPTLSDSLLNKEELANISTNFLNLAKRTDLFDWMVKIRRTIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_010924947.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=437

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 7/62 (11%)
 Frame = +1

Query  55   MSFSKWFFLI-FVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            M+ SKW  L+ FV  L      SS L  +S   P  F + AK++E  DWMVGIRR+IHEN
Sbjct  1    MASSKWVALVHFVSLL------SSVLTCSSSPDPAGFLQRAKESEFLDWMVGIRRRIHEN  54

Query  232  PE  237
            PE
Sbjct  55   PE  56



>ref|XP_010690089.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=450

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 7/68 (10%)
 Frame = +1

Query  55   MSFSKWFFLIFV--QFLFSPIPISSELKL-----TSQEIPGIFFKLAKKAEVFDWMVGIR  213
            M F +   + F    FLF P+   S+ +L       QEIP  F    +KAEVFDWMV IR
Sbjct  1    MGFFRCLCVFFTLQCFLFKPLLSDSDSELFFNSNELQEIPKYFLNQTQKAEVFDWMVNIR  60

Query  214  RKIHENPE  237
            RK+HENPE
Sbjct  61   RKLHENPE  68



>gb|KHN11323.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=444

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  61   FSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            F K F L F+       PI S L  +S ++   + + AKK EVFDWMV IRRKIHENPE
Sbjct  4    FRKRFNLFFIFLALDATPIFS-LTDSSNQLSTNYLENAKKPEVFDWMVKIRRKIHENPE  61



>ref|NP_001242429.1| uncharacterized protein LOC100790664 precursor [Glycine max]
 gb|ACU20016.1| unknown [Glycine max]
Length=444

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  61   FSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            F K F L F+       PI S L  +S ++   + + AKK EVFDWMV IRRKIHENPE
Sbjct  4    FRKRFNLFFIFLALDATPIFS-LTDSSNQLSTNYLENAKKPEVFDWMVKIRRKIHENPE  61



>gb|KJB70348.1| hypothetical protein B456_011G068400 [Gossypium raimondii]
Length=331

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTS-----QEIPGIFFKLAKKAEVFDWMVGIRRK  219
            M FSK    + +  L +PI + S     S      EIP  F   AK+ EV DWMVGIRRK
Sbjct  1    MIFSKLVSFVLILQLLNPIVVLSSSSSLSSSNGLTEIPKKFLDFAKRKEVVDWMVGIRRK  60

Query  220  IHENPE  237
            IHENPE
Sbjct  61   IHENPE  66



>ref|XP_008244751.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Prunus mume]
Length=445

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKL---AKKAEVFDWMVGIRRKIH  225
            M F     LI V F+F P  I S   ++S  +  I FKL   A+K +VFDWMVGIRRKIH
Sbjct  1    MEFHMQVSLIIVLFVFGPTTIFSSSSVSSNGLSEIPFKLLDFAQKPQVFDWMVGIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KDP40816.1| hypothetical protein JCGZ_24815 [Jatropha curcas]
Length=441

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MS  +W  L++V F     PI S L  +S ++   F   AK+ E+ +WMVGIRRKIHENP
Sbjct  1    MSIFRWVTLVWVVFFLLLTPILS-LNGSSSDLSTRFLNYAKREELVNWMVGIRRKIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>gb|KJB70347.1| hypothetical protein B456_011G068400 [Gossypium raimondii]
Length=453

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTS-----QEIPGIFFKLAKKAEVFDWMVGIRRK  219
            M FSK    + +  L +PI + S     S      EIP  F   AK+ EV DWMVGIRRK
Sbjct  5    MIFSKLVSFVLILQLLNPIVVLSSSSSLSSSNGLTEIPKKFLDFAKRKEVVDWMVGIRRK  64

Query  220  IHENPE  237
            IHENPE
Sbjct  65   IHENPE  70



>gb|KDP33760.1| hypothetical protein JCGZ_07331 [Jatropha curcas]
Length=447

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = +1

Query  61   FSKWFFLIFVQFLFSPIPISSE-LKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIHE  228
            F KW  LI V + F P  ISS  L L+S+E   IP  FF LA+K ++ ++MV IRR+IHE
Sbjct  4    FFKWVSLILVFYSFIPKLISSNILYLSSEELAQIPVNFFDLARKQDLVNYMVNIRRRIHE  63

Query  229  NPE  237
            NPE
Sbjct  64   NPE  66



>ref|XP_003533023.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like isoform 
X1 [Glycine max]
Length=167

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M F KWF L     + +  PI S L  +S ++   F   AKK EVF WMV IRR+IHENP
Sbjct  1    MFFFKWFHLFITFHVLAATPIFS-LTDSSNQVSTNFLDNAKKPEVFYWMVKIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>gb|KHN11324.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=174

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M F KWF L     + +  PI S L  +S ++   F   AKK EVF WMV IRR+IHENP
Sbjct  1    MFFFKWFHLFITFHVLAATPIFS-LTDSSNQVSTNFLDNAKKPEVFYWMVKIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_006305862.1| hypothetical protein CARUB_v10010946mg [Capsella rubella]
 gb|EOA38760.1| hypothetical protein CARUB_v10010946mg [Capsella rubella]
Length=439

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MS +K  + +F+  LF+    S      SQ IP  F  LAK+ + F+WMVGIRR+IHE+P
Sbjct  1    MSVAKLVYAVFILHLFNSFLYSCSSNDLSQ-IPKNFLTLAKREDFFNWMVGIRRRIHEHP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_006585547.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like isoform 
X2 [Glycine max]
 ref|XP_006585548.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like isoform 
X3 [Glycine max]
Length=198

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M F KWF L     + +  PI S L  +S ++   F   AKK EVF WMV IRR+IHENP
Sbjct  1    MFFFKWFHLFITFHVLAATPIFS-LTDSSNQVSTNFLDNAKKPEVFYWMVKIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>gb|KDO55919.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
 gb|KDO55920.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
 gb|KDO55921.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=288

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M  SK   L+   +L +P  ISS++ L+ +E   IP  F   AKK E+F WMV IRRKIH
Sbjct  1    MGSSKLLSLLVTLYLLAPTSISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_006475371.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Citrus 
sinensis]
Length=443

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M  SK   L+   +L +P  ISS++ L+ +E   IP  F   AKK E+F WMV IRRKIH
Sbjct  1    MGSSKLLSLLVTLYLLAPTSISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KDO55918.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=326

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M  SK   L+   +L +P  ISS++ L+ +E   IP  F   AKK E+F WMV IRRKIH
Sbjct  1    MGSSKLLSLLVTLYLLAPTSISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KDO55917.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=443

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M  SK   L+   +L +P  ISS++ L+ +E   IP  F   AKK E+F WMV IRRKIH
Sbjct  1    MGSSKLLSLLVTLYLLAPTSISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KDO55915.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=423

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M  SK   L+   +L +P  ISS++ L+ +E   IP  F   AKK E+F WMV IRRKIH
Sbjct  1    MGSSKLLSLLVTLYLLAPTSISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>gb|KDO55916.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=445

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIH  225
            M  SK   L+   +L +P  ISS++ L+ +E   IP  F   AKK E+F WMV IRRKIH
Sbjct  1    MGSSKLLSLLVTLYLLAPTSISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIH  60

Query  226  ENPE  237
            ENPE
Sbjct  61   ENPE  64



>ref|XP_010500767.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=444

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 34/61 (56%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MS  K    + +  L +   IS      SQ IP     LAK+ E FDWMVGIRR+IHENP
Sbjct  1    MSGCKLVSFVLILHLLNSFLISCSSNELSQ-IPKNLLSLAKREEFFDWMVGIRRRIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_007135595.1| hypothetical protein PHAVU_010G142600g [Phaseolus vulgaris]
 gb|ESW07589.1| hypothetical protein PHAVU_010G142600g [Phaseolus vulgaris]
Length=442

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M+F  W  L  V   F+  P    L  +  E+P  F   AKK EVFDWMV IRRKIH+NP
Sbjct  1    MNFFNWVRLFIVFHAFAAAPSFFLLTDSFTELPTNFLDAAKKPEVFDWMVRIRRKIHQNP  60

Query  235  E  237
            E
Sbjct  61   E  61



>ref|XP_008806725.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Phoenix dactylifera]
 ref|XP_008777919.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Phoenix dactylifera]
Length=436

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 5/61 (8%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M+ SKW  L  +  L     ++S L  +S   P  F + AK++E  DWMVGIRR+IHENP
Sbjct  1    MASSKWVALAHLVSL-----LTSVLACSSSPDPAGFLQRAKESEFLDWMVGIRRRIHENP  55

Query  235  E  237
            E
Sbjct  56   E  56



>ref|NP_001288981.1| IAA-amino acid hydrolase ILR1-like 2 precursor [Brassica rapa]
 gb|ABB60092.1| IAA-amino acid hydrolase 2 [Brassica rapa]
Length=444

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +1

Query  115  ISSELKLTS---QEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            ISSE   T+    + P  F +LAK  EVFDWMV IRRKIHENPE
Sbjct  22   ISSESSHTTGDASQFPKKFLELAKTPEVFDWMVRIRRKIHENPE  65



>emb|CDY32768.1| BnaA10g10810D [Brassica napus]
Length=444

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +1

Query  115  ISSELKLTS---QEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            ISSE   T+    + P  F +LAK  EVFDWMV IRRKIHENPE
Sbjct  22   ISSESSHTTGDASQFPKKFLELAKTPEVFDWMVRIRRKIHENPE  65



>ref|XP_009338136.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
Length=473

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 3/47 (6%)
 Frame = +1

Query  106  PIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            P  + S+  L+S    EIP      A++ +VFDWMVGIRRKIHENPE
Sbjct  46   PAAVLSDCSLSSNGVSEIPKKLLNRAQRPQVFDWMVGIRRKIHENPE  92



>ref|XP_004135685.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cucumis 
sativus]
 gb|KGN66199.1| hypothetical protein Csa_1G575150 [Cucumis sativus]
Length=445

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  F + A+  EVFDWMVGIRRKIHENPE
Sbjct  34   QIPSFFLQYAQHPEVFDWMVGIRRKIHENPE  64



>ref|XP_004158429.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
4-like [Cucumis sativus]
Length=445

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  F + A+  EVFDWMVGIRRKIHENPE
Sbjct  34   QIPSFFLQYAQHPEVFDWMVGIRRKIHENPE  64



>emb|CDX88581.1| BnaA03g10680D [Brassica napus]
Length=439

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +1

Query  115  ISSELKLTSQEI---PGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +SSE  L + +    P  F + AK  EVFDWMVGIRRK+HENPE
Sbjct  21   VSSESSLITDDASRRPTKFLEYAKSPEVFDWMVGIRRKLHENPE  64



>emb|CDY32874.1| BnaC09g33210D [Brassica napus]
Length=448

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +1

Query  115  ISSELKLTS---QEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +SSE   T+    + P  F +LAK  EVFDWMV IRRKIHENPE
Sbjct  22   VSSESSHTTGDASQFPKKFLELAKTPEVFDWMVRIRRKIHENPE  65



>ref|XP_010500765.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=456

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MS  K    + +  L +   IS      SQ IP     LAK+ E FDWMVGIRR++HENP
Sbjct  17   MSGCKLVSFVLILHLLNSFLISCSSNELSQ-IPKNLLSLAKRDEFFDWMVGIRRRLHENP  75

Query  235  E  237
            E
Sbjct  76   E  76



>gb|KHG30726.1| IAA-amino acid hydrolase ILR1-like 4 [Gossypium arboreum]
Length=453

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            EIP  F   AK+ EV DWMVGIRRKIHENPE
Sbjct  40   EIPKKFLDFAKRKEVVDWMVGIRRKIHENPE  70



>ref|XP_010479683.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=440

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 33/61 (54%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            MS  K    + +  L +   IS      SQ IP     LAK+ E FDWMVGIRR IHENP
Sbjct  1    MSGCKLVSFVLILHLLNSFLISCSSNELSQ-IPKNLLSLAKRDEFFDWMVGIRRTIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>emb|CDY69786.1| BnaC06g41050D, partial [Brassica napus]
Length=358

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  F  LAK+++ +DWMVGIRR+IHENPE
Sbjct  34   QIPSKFLALAKRSDFYDWMVGIRRRIHENPE  64



>ref|XP_003597645.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AES67896.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 7/67 (10%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLF--SPIPISSELKLTSQE----IPGIFFKLAKKAEVFDWMVGIRR  216
            M+F K   ++ + F+F     PI S+   T+ +    IP +  +LAK+ +VFDWMV IRR
Sbjct  1    MAFFKCVNMLIIIFIFFLCATPIFSDSSSTNSKDHLAIPKLL-ELAKEPQVFDWMVDIRR  59

Query  217  KIHENPE  237
            KIHENPE
Sbjct  60   KIHENPE  66



>ref|XP_009352597.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Pyrus x bretschneideri]
Length=445

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  FF  AK+ E+FD+MVG+RRKIHENPE
Sbjct  34   QIPVKFFDFAKRQELFDYMVGVRRKIHENPE  64



>ref|XP_008450808.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis melo]
Length=445

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  F + AK  EVFDWMV IRRKIHENPE
Sbjct  34   QIPSFFLQYAKHPEVFDWMVDIRRKIHENPE  64



>ref|XP_010088388.1| IAA-amino acid hydrolase ILR1-like 5 [Morus notabilis]
 gb|EXB34862.1| IAA-amino acid hydrolase ILR1-like 5 [Morus notabilis]
Length=434

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  55   MSFSKWFF-LIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHEN  231
            M+F+K F   + V  +F P  + S+L +TS      F + A K EVFDWMVGIR  +HE 
Sbjct  1    MAFAKCFTSFLLVLCVFVPTLVLSDLSITSSN----FLEHANKPEVFDWMVGIRNDLHEC  56

Query  232  PE  237
            PE
Sbjct  57   PE  58



>ref|XP_004251653.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=446

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 8/67 (12%)
 Frame = +1

Query  55   MSFSKWF--FLIFVQFLFSP-IPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRR  216
            M F KW   F I   FL +P + ISS   L  +E+  I   F  LAK+ E+FDW+V IRR
Sbjct  1    MVFLKWVVAFSILCNFLATPTLSISS--ILNKEELANISVNFLNLAKRPELFDWIVRIRR  58

Query  217  KIHENPE  237
             IHENPE
Sbjct  59   TIHENPE  65



>ref|XP_010462020.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Camelina sativa]
Length=456

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP     LAK+ E FDWMVGIRR+IHENPE
Sbjct  46   QIPKNLLSLAKRDEFFDWMVGIRRRIHENPE  76



>gb|ACJ85027.1| unknown [Medicago truncatula]
Length=266

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 4/48 (8%)
 Frame = +1

Query  103  SPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            S  P+ S+   TS +   IP  F  LAK+ +VFDWMV IRRKIHENPE
Sbjct  20   SATPVFSDFSSTSNDHLSIPN-FLDLAKEPKVFDWMVSIRRKIHENPE  66



>ref|XP_003597644.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|ABF55220.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|AES67895.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 4/48 (8%)
 Frame = +1

Query  103  SPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            S  P+ S+   TS +   IP  F  LAK+ +VFDWMV IRRKIHENPE
Sbjct  20   SATPVFSDFSSTSNDHLSIPN-FLDLAKEPKVFDWMVSIRRKIHENPE  66



>gb|AFK37903.1| unknown [Medicago truncatula]
Length=447

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 4/48 (8%)
 Frame = +1

Query  103  SPIPISSELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            S  P+ S+   TS +   IP  F  LAK+ +VFDWMV IRRKIHENPE
Sbjct  20   SATPVFSDFSSTSNDHLSIPN-FLDLAKEPKVFDWMVSIRRKIHENPE  66



>ref|XP_009132189.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Brassica rapa]
Length=439

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  151  PGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            P  F + AK  EVFDWMVGIRRK+HENPE
Sbjct  36   PSKFLEYAKSPEVFDWMVGIRRKLHENPE  64



>ref|XP_011077950.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X3 [Sesamum 
indicum]
Length=341

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +1

Query  55   MSFSKWFFLIF-VQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKI  222
            MS   W  L+F +  L S  P  S+  L  +   EIP  F  LAK+ E+F++MV IRR +
Sbjct  1    MSSFTWVCLLFNLCMLLSSYPALSDPFLGEKGLAEIPSKFLNLAKRPEIFEYMVKIRRSL  60

Query  223  HENPE  237
            HENPE
Sbjct  61   HENPE  65



>ref|XP_006353512.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=446

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = +1

Query  55   MSFSKWF--FLIFVQFLFSP-IPISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRR  216
            M F KW   F I   FL +P + ISS   L  +E   I   F  LAK+ E+FDW+V IRR
Sbjct  1    MGFLKWVVGFSILCTFLATPTLSISS--FLNKEEFANISVNFLNLAKRPELFDWIVRIRR  58

Query  217  KIHENPE  237
             IHENPE
Sbjct  59   TIHENPE  65



>ref|XP_007024408.1| Peptidase M20/M25/M40 family protein [Theobroma cacao]
 gb|EOY27030.1| Peptidase M20/M25/M40 family protein [Theobroma cacao]
Length=448

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTS----QEIPGIFFKLAKKAEVFDWMVGIRRKI  222
            MSFSK+   + +  L +   + S   L+S     EIP  F   AK  E+ DW+VGIRRKI
Sbjct  1    MSFSKFVSFVLMLHLLNTTVVLSSSSLSSSNGWSEIPKKFLHFAKGQELVDWIVGIRRKI  60

Query  223  HENPE  237
            HENPE
Sbjct  61   HENPE  65



>gb|KFK27232.1| hypothetical protein AALP_AA8G354700 [Arabis alpina]
Length=438

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  115  ISSELKLTSQ-EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +SSE  LT+  ++   F + AK  EVFDWMV IRRK+HENPE
Sbjct  19   VSSESPLTTGGDVKNNFLESAKNPEVFDWMVRIRRKLHENPE  60



>ref|XP_003543612.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN30029.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=444

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   FSKWFFL-IFVQFLFSPIPISSELKLTSQEIPGI-FFKLAKKAEVFDWMVGIRRKIHENP  234
            F KW  L +F  FL +  PI S+   +S  I    F  LAK   VFDWMVGIRRKIHENP
Sbjct  4    FLKWVNLFVFFHFL-AATPIFSDSSSSSNAIATTKFLDLAKDPRVFDWMVGIRRKIHENP  62

Query  235  E  237
            E
Sbjct  63   E  63



>ref|XP_007150548.1| hypothetical protein PHAVU_005G1617001g, partial [Phaseolus vulgaris]
 gb|ESW22542.1| hypothetical protein PHAVU_005G1617001g, partial [Phaseolus vulgaris]
Length=266

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +1

Query  160  FFKLAKKAEVFDWMVGIRRKIHENPE  237
            F  LAK   +FDWMVGIRRKIHENPE
Sbjct  38   FLDLAKDPRLFDWMVGIRRKIHENPE  63



>ref|XP_008367918.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
4 [Malus domestica]
Length=466

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  F   AK+ E+FD+MVG+RRKIHENPE
Sbjct  63   QIPVKFLDFAKRQELFDYMVGVRRKIHENPE  93



>ref|XP_004297620.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Fragaria vesca 
subsp. vesca]
Length=445

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            EIP     LA+K ++F+WMVGIRRKIHENPE
Sbjct  34   EIPRKLLTLAQKPQLFEWMVGIRRKIHENPE  64



>emb|CDY22869.1| BnaA06g02080D [Brassica napus]
Length=442

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  F  LAK+ + F+WMVGIRR+IHENPE
Sbjct  34   QIPPKFLALAKRNDFFEWMVGIRRRIHENPE  64



>ref|XP_009147731.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Brassica rapa]
Length=442

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  F  LAK+ + F+WMVGIRR+IHENPE
Sbjct  34   QIPPKFLALAKRNDFFEWMVGIRRRIHENPE  64



>ref|XP_011077948.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X1 [Sesamum 
indicum]
Length=450

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +1

Query  55   MSFSKWFFLIF-VQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKI  222
            MS   W  L+F +  L S  P  S+  L  +   EIP  F  LAK+ E+F++MV IRR +
Sbjct  1    MSSFTWVCLLFNLCMLLSSYPALSDPFLGEKGLAEIPSKFLNLAKRPEIFEYMVKIRRSL  60

Query  223  HENPE  237
            HENPE
Sbjct  61   HENPE  65



>ref|XP_011077949.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 isoform X2 [Sesamum 
indicum]
Length=446

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = +1

Query  55   MSFSKWFFLIF-VQFLFSPIPISSELKLTSQ---EIPGIFFKLAKKAEVFDWMVGIRRKI  222
            MS   W  L+F +  L S  P  S+  L  +   EIP  F  LAK+ E+F++MV IRR +
Sbjct  1    MSSFTWVCLLFNLCMLLSSYPALSDPFLGEKGLAEIPSKFLNLAKRPEIFEYMVKIRRSL  60

Query  223  HENPE  237
            HENPE
Sbjct  61   HENPE  65



>ref|XP_009396760.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 10/64 (16%)
 Frame = +1

Query  55   MSFSKWF-FLIFVQFLFSPIPISSELKLTSQEIPGI--FFKLAKKAEVFDWMVGIRRKIH  225
            M FSK   F++    L S        ++   ++ G+  F + AK+ E FDWMVG+RR+IH
Sbjct  1    MGFSKSIAFIVLFDLLCSA-------RIARSDLDGVVGFLERAKEPEFFDWMVGVRRRIH  53

Query  226  ENPE  237
            ENPE
Sbjct  54   ENPE  57



>ref|XP_008387506.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Malus domestica]
Length=445

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            +IP  FF  AK+ E+FD+MVG+RR IHENPE
Sbjct  34   QIPVKFFDFAKRQELFDYMVGVRRTIHENPE  64



>gb|EYU30670.1| hypothetical protein MIMGU_mgv1a006375mg [Erythranthe guttata]
Length=446

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  130  KLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            K  S EIP  F K AK  E+FD+MV IRR +HENPE
Sbjct  30   KQGSSEIPSEFLKSAKTPEIFDYMVKIRRTLHENPE  65



>ref|XP_006401299.1| hypothetical protein EUTSA_v10013558mg [Eutrema salsugineum]
 gb|ESQ42752.1| hypothetical protein EUTSA_v10013558mg [Eutrema salsugineum]
Length=442

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 3/44 (7%)
 Frame = +1

Query  115  ISSELKLTSQEIPGI---FFKLAKKAEVFDWMVGIRRKIHENPE  237
            +SSE    + ++ GI   F  LAK  EVFD MV IRRKIHENPE
Sbjct  21   VSSESSRIAGDVSGIPTKFLDLAKSPEVFDSMVRIRRKIHENPE  64



>ref|XP_003597649.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=448

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  160  FFKLAKKAEVFDWMVGIRRKIHENPE  237
            F  LAK+ +VFDWMV IRRKIHENPE
Sbjct  42   FLDLAKEPKVFDWMVSIRRKIHENPE  67



>gb|AES67900.2| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=452

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  160  FFKLAKKAEVFDWMVGIRRKIHENPE  237
            F  LAK+ +VFDWMV IRRKIHENPE
Sbjct  46   FLDLAKEPKVFDWMVSIRRKIHENPE  71



>gb|ABF55219.1| auxin conjugate hydrolase [Medicago truncatula]
Length=452

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  160  FFKLAKKAEVFDWMVGIRRKIHENPE  237
            F  LAK+ +VFDWMV IRRKIHENPE
Sbjct  46   FLDLAKEPKVFDWMVSIRRKIHENPE  71



>gb|AFK46529.1| unknown [Lotus japonicus]
Length=447

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +1

Query  55   MSFSKWF-FLIFVQFLFSPIPISS--ELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIH  225
            MSF K F F I +  +F+ I I S  +  LT  ++   F   AKK E FDWMV IRRKIH
Sbjct  1    MSFCKCFHFFIIILQVFAAIAIFSLADSSLTQNQLFTNFLDTAKKPEFFDWMVKIRRKIH  60

Query  226  ENPE  237
            + PE
Sbjct  61   QFPE  64



>ref|XP_002283047.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
Length=439

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 33/61 (54%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   MSFSKWFFLIFVQFLFSPIPISSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENP  234
            M    W   IF+  +F     SS  +  +Q I   F   A++ E+ +WMVGIRR IHENP
Sbjct  1    MGLGNWLRSIFILHMFVATLSSSNPERLAQ-ISADFLDYAREPEISEWMVGIRRIIHENP  59

Query  235  E  237
            E
Sbjct  60   E  60



>ref|XP_003546640.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=444

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +1

Query  160  FFKLAKKAEVFDWMVGIRRKIHENPE  237
            F  LAK   VFDWM+GIRRKIHENPE
Sbjct  38   FLDLAKDPLVFDWMIGIRRKIHENPE  63



>gb|AAL59907.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
Length=439

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  139  SQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            + +I     + AK  EVFDWMV IRRKIHENPE
Sbjct  31   TSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPE  63



>ref|NP_200477.1| IAA-amino acid hydrolase ILR1-like 2 [Arabidopsis thaliana]
 sp|P54970.2|ILL2_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC04866.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
 dbj|BAB09884.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
 gb|AAW38995.1| At5g56660 [Arabidopsis thaliana]
 gb|AED96793.1| IAA-amino acid hydrolase ILR1-like 2 [Arabidopsis thaliana]
Length=439

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  139  SQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            + +I     + AK  EVFDWMV IRRKIHENPE
Sbjct  31   TSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPE  63



>gb|AAC49016.1| ILL2 [Arabidopsis thaliana]
Length=439

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  139  SQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            + +I     + AK  EVFDWMV IRRKIHENPE
Sbjct  31   TSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPE  63



>emb|CDY11910.1| BnaC03g13360D [Brassica napus]
Length=427

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  118  SSELKLTSQEIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            SS +       P  F +LAK  ++FDWMV IRRKIHENP+
Sbjct  25   SSRITGDVSRTPKKFLELAKSQDLFDWMVRIRRKIHENPK  64



>ref|XP_006451368.1| hypothetical protein CICLE_v100084061mg, partial [Citrus clementina]
 gb|ESR64608.1| hypothetical protein CICLE_v100084061mg, partial [Citrus clementina]
Length=421

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +1

Query  121  SELKLTSQE---IPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            S++ L+ +E   IP  F   AKK E+F WMV IRRKIHENPE
Sbjct  1    SDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIHENPE  42



>ref|XP_010914575.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=378

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  151  PGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            P  F + AK++E  DWMVGI+R+IHENPE
Sbjct  28   PAGFLRRAKESEFSDWMVGIKRRIHENPE  56



>ref|XP_008797894.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  151  PGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            P  F + AK++E  DWMVGIRR+IHENPE
Sbjct  29   PAGFLQRAKESEFSDWMVGIRRRIHENPE  57



>ref|XP_008797895.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 isoform X2 [Phoenix 
dactylifera]
Length=421

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  151  PGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            P  F + AK++E  DWMVGIRR+IHENPE
Sbjct  29   PAGFLQRAKESEFSDWMVGIRRRIHENPE  57



>ref|XP_008380826.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Malus domestica]
Length=446

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +1

Query  106  PIPISSELKLTSQEIPGIFFKL---AKKAEVFDWMVGIRRKIHENPE  237
            P  + S+  L+S  +  I  KL   A+  +VFDWMVGIRRKIH NPE
Sbjct  19   PXTVLSDSXLSSNGVSEIXKKLLSFAQNPQVFDWMVGIRRKIHANPE  65



>ref|XP_010451352.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Camelina sativa]
Length=339

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            ++P  + +LAK  EVFD MV IRRKIHENPE
Sbjct  38   QVPKKYLELAKSPEVFDRMVSIRRKIHENPE  68



>ref|XP_010451360.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Camelina sativa]
Length=444

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  EIPGIFFKLAKKAEVFDWMVGIRRKIHENPE  237
            ++P  + +LAK  EVFD MV IRRKIHENPE
Sbjct  38   QVPKKYLELAKSPEVFDRMVSIRRKIHENPE  68



>ref|XP_004510337.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=442

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +1

Query  160  FFKLAKKAEVFDWMVGIRRKIHENPE  237
            F + AK  EVFDWM+ IRRKIHENPE
Sbjct  34   FLESAKSPEVFDWMISIRRKIHENPE  59



>gb|ACJ84380.1| unknown [Medicago truncatula]
Length=207

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  160  FFKLAKKAEVFDWMVGIRRKIHENPE  237
            F   AK  EV+DWM+ IRRKIHENPE
Sbjct  38   FLDSAKNPEVYDWMINIRRKIHENPE  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563183668210