BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015E07

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     108   1e-25   Nicotiana sylvestris
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     107   1e-25   Nicotiana tomentosiformis
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     103   4e-24   Solanum tuberosum [potatoes]
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   91.7    9e-20   Solanum lycopersicum
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   91.3    1e-19   Nicotiana sylvestris
ref|XP_010316802.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  90.5    2e-19   Solanum lycopersicum
ref|XP_010316801.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  90.5    2e-19   Solanum lycopersicum
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  89.4    6e-19   Solanum lycopersicum
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   89.0    8e-19   Nicotiana tomentosiformis
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg           89.0    9e-19   
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645  91.3    9e-19   
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   88.6    1e-18   Prunus mume [ume]
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   89.0    1e-18   Solanum tuberosum [potatoes]
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252  90.9    1e-18   
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   88.2    2e-18   Fragaria vesca subsp. vesca
ref|NP_174181.1|  GDSL esterase/lipase                                88.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007213171.1|  hypothetical protein PRUPE_ppa026981mg           87.0    2e-18   
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg           87.4    3e-18   
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...  87.4    3e-18   Tarenaya hassleriana [spider flower]
ref|NP_180304.1|  GDSL esterase/lipase                                87.4    4e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDO96754.1|  unnamed protein product                              87.0    5e-18   Coffea canephora [robusta coffee]
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580        86.3    6e-18   Vitis vinifera
ref|XP_002893538.1|  predicted protein                                88.6    7e-18   
dbj|BAD44668.1|  putative lipase                                      86.3    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg              85.9    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   85.9    1e-17   Oryza brachyantha
emb|CDO99485.1|  unnamed protein product                              85.9    1e-17   Coffea canephora [robusta coffee]
gb|KJB51165.1|  hypothetical protein B456_008G204600                  85.9    1e-17   Gossypium raimondii
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550        85.9    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   85.9    1e-17   Cucumis melo [Oriental melon]
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  85.5    2e-17   Setaria italica
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  85.5    2e-17   Setaria italica
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   85.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  85.5    2e-17   
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   85.5    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  85.5    2e-17   Brassica rapa
gb|KJB62807.1|  hypothetical protein B456_009G437300                  85.5    2e-17   Gossypium raimondii
ref|XP_002879083.1|  predicted protein                                85.1    2e-17   
emb|CDO96753.1|  unnamed protein product                              85.1    3e-17   Coffea canephora [robusta coffee]
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   85.1    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   84.7    3e-17   Brassica rapa
gb|AAF24548.2|AC007508_11  F1K23.17                                   86.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540491.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  84.0    3e-17   Tarenaya hassleriana [spider flower]
emb|CDY15658.1|  BnaA07g08290D                                        84.7    3e-17   Brassica napus [oilseed rape]
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   84.7    4e-17   Brassica rapa
emb|CDY30819.1|  BnaC05g21950D                                        84.7    4e-17   Brassica napus [oilseed rape]
gb|KHG23842.1|  hypothetical protein F383_29871                       84.3    4e-17   Gossypium arboreum [tree cotton]
gb|AAX59709.1|  lipase 1                                              84.3    4e-17   Brassica napus [oilseed rape]
emb|CBI30663.3|  unnamed protein product                              86.7    4e-17   Vitis vinifera
emb|CDP21061.1|  unnamed protein product                              84.3    4e-17   Coffea canephora [robusta coffee]
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase               84.3    4e-17   Arabidopsis lyrata subsp. lyrata
emb|CDX94632.1|  BnaC07g10260D                                        84.3    4e-17   
gb|KJB63192.1|  hypothetical protein B456_009G437100                  83.2    5e-17   Gossypium raimondii
gb|EYU28066.1|  hypothetical protein MIMGU_mgv1a009376mg              83.6    5e-17   Erythranthe guttata [common monkey flower]
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  83.6    6e-17   Tarenaya hassleriana [spider flower]
ref|NP_174440.2|  GDSL esterase/lipase                                84.0    6e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95190.1|  hypothetical protein                                 84.0    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG00751.1|  hypothetical protein F383_21550                       83.6    7e-17   Gossypium arboreum [tree cotton]
gb|AAG60153.1|AC074360_18  lipase, putative                           83.6    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031122.1|  GDSL esterase/lipase                             83.6    8e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDO96749.1|  unnamed protein product                              83.6    1e-16   Coffea canephora [robusta coffee]
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878  85.1    1e-16   
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg           85.1    1e-16   
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   83.2    1e-16   Camelina sativa [gold-of-pleasure]
gb|KJB63193.1|  hypothetical protein B456_009G437100                  83.2    1e-16   Gossypium raimondii
ref|XP_010327054.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  82.8    1e-16   Solanum lycopersicum
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   82.8    2e-16   Nelumbo nucifera [Indian lotus]
emb|CDX94633.1|  BnaC07g10250D                                        82.8    2e-16   
ref|XP_008647410.1|  PREDICTED: uncharacterized protein LOC100193...  82.0    2e-16   
dbj|BAJ92568.1|  predicted protein                                    82.4    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   82.8    2e-16   Tarenaya hassleriana [spider flower]
emb|CDO96750.1|  unnamed protein product                              82.4    2e-16   Coffea canephora [robusta coffee]
ref|XP_004958488.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   82.8    2e-16   Setaria italica
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  82.0    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  82.0    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  82.0    3e-16   
emb|CDX90162.1|  BnaA08g18220D                                        82.4    3e-16   
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg           82.0    3e-16   
ref|NP_174179.3|  GDSL esterase/lipase                                82.0    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AFW76565.1|  hypothetical protein ZEAMMB73_187768                  82.0    3e-16   
ref|NP_001132231.1|  uncharacterized protein LOC100193666 precursor   82.0    3e-16   Zea mays [maize]
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...  82.0    3e-16   Solanum lycopersicum
gb|EYU28061.1|  hypothetical protein MIMGU_mgv11b014990mg             82.8    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   82.0    3e-16   Phoenix dactylifera
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  82.0    4e-16   Camelina sativa [gold-of-pleasure]
ref|NP_174186.1|  GDSL esterase/lipase                                81.6    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   82.0    4e-16   Brassica rapa
emb|CDY15657.1|  BnaA07g08280D                                        82.0    4e-16   Brassica napus [oilseed rape]
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   82.0    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   81.3    5e-16   
gb|EAY75193.1|  hypothetical protein OsI_03085                        81.3    6e-16   Oryza sativa Indica Group [Indian rice]
gb|EAZ12915.1|  hypothetical protein OsJ_02838                        80.5    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KCW45468.1|  hypothetical protein EUGRSUZ_L00817                   81.3    6e-16   Eucalyptus grandis [rose gum]
gb|EMT29920.1|  GDSL esterase/lipase                                  77.4    6e-16   
ref|NP_973930.1|  GDSL esterase/lipase                                80.1    6e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02148.1|  putative lipase                                      80.9    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057069.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   81.3    7e-16   Eucalyptus grandis [rose gum]
ref|NP_174180.1|  GDSL esterase/lipase                                80.9    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   80.5    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078           80.5    1e-15   
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   80.5    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  80.5    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  80.5    1e-15   
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  80.5    1e-15   
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  80.9    1e-15   Sesamum indicum [beniseed]
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  80.5    1e-15   Brassica rapa
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  80.5    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3     80.1    1e-15   
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...  80.5    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  80.1    1e-15   
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                  82.4    1e-15   Arabis alpina [alpine rockcress]
ref|XP_010912621.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   78.2    1e-15   
ref|NP_174185.2|  GDSL esterase/lipase                                80.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   80.5    2e-15   
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650        80.1    2e-15   Sorghum bicolor [broomcorn]
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  80.1    2e-15   Elaeis guineensis
ref|XP_002461107.1|  hypothetical protein SORBIDRAFT_02g040890        80.1    2e-15   
ref|XP_008777732.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   78.6    2e-15   Phoenix dactylifera
gb|AAF24544.2|AC007508_7  F1K23.13                                    81.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592  81.3    2e-15   
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   79.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925  81.3    2e-15   
ref|XP_006651412.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   79.3    3e-15   
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  79.3    3e-15   Elaeis guineensis
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                  79.3    3e-15   Arabis alpina [alpine rockcress]
emb|CDP22023.1|  unnamed protein product                              77.0    3e-15   Coffea canephora [robusta coffee]
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   79.0    3e-15   
gb|KEH36573.1|  GDSL-like lipase/acylhydrolase                        78.6    4e-15   Medicago truncatula
ref|NP_001043731.1|  Os01g0651300                                     77.0    4e-15   
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...  79.0    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382515.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   79.0    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADN33970.1|  lipase                                                78.6    4e-15   Cucumis melo subsp. melo
ref|XP_010480704.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   78.6    4e-15   
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  79.0    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008812182.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   77.8    5e-15   
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g           79.3    5e-15   
ref|XP_008364168.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   77.8    5e-15   
ref|XP_010040115.1|  PREDICTED: uncharacterized protein LOC104428890  80.5    5e-15   
ref|XP_002893540.1|  predicted protein                                80.5    5e-15   
gb|KJB62810.1|  hypothetical protein B456_009G437600                  78.6    5e-15   Gossypium raimondii
ref|XP_008439284.1|  PREDICTED: GDSL esterase/lipase At3g48460        78.6    5e-15   Cucumis melo [Oriental melon]
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924  80.1    5e-15   
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  78.6    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006844514.1|  hypothetical protein AMTR_s00016p00146420        75.9    6e-15   
emb|CDY43309.1|  BnaC03g58810D                                        78.6    6e-15   Brassica napus [oilseed rape]
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   78.6    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610        78.6    6e-15   Solanum lycopersicum
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  78.6    6e-15   Camelina sativa [gold-of-pleasure]
emb|CDM83767.1|  unnamed protein product                              77.8    6e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   78.6    6e-15   Cucumis sativus [cucumbers]
gb|AFK42362.1|  unknown                                               78.2    6e-15   Medicago truncatula
ref|XP_003593737.1|  GDSL esterase/lipase                             78.2    7e-15   Medicago truncatula
emb|CDX90163.1|  BnaA08g18210D                                        78.6    7e-15   
ref|XP_004152509.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   78.6    7e-15   Cucumis sativus [cucumbers]
ref|NP_001031103.1|  GDSL esterase/lipase                             77.0    8e-15   
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   78.2    9e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  78.2    9e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007214461.1|  hypothetical protein PRUPE_ppa023988mg           78.6    9e-15   
gb|EAZ27028.1|  hypothetical protein OsJ_10957                        77.8    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04881.1|  hypothetical protein OsI_27063                        77.8    1e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001060434.1|  Os07g0642200                                     77.8    1e-14   
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479  79.3    1e-14   
emb|CDY43308.1|  BnaC03g58800D                                        77.8    1e-14   Brassica napus [oilseed rape]
gb|EAY90132.1|  hypothetical protein OsI_11698                        77.8    1e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   77.8    1e-14   Nicotiana tomentosiformis
gb|KJB62806.1|  hypothetical protein B456_009G437200                  77.4    2e-14   Gossypium raimondii
gb|KJB62808.1|  hypothetical protein B456_009G437400                  77.0    2e-14   Gossypium raimondii
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like   77.0    2e-14   Cicer arietinum [garbanzo]
ref|XP_003593736.1|  GDSL esterase/lipase                             77.4    2e-14   Medicago truncatula
ref|NP_001151904.1|  alpha-L-fucosidase 2 precursor                   77.0    2e-14   Zea mays [maize]
ref|XP_002511260.1|  Esterase precursor, putative                     77.0    2e-14   Ricinus communis
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   77.0    2e-14   Phoenix dactylifera
ref|NP_174182.1|  GDSL esterase/lipase                                77.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65183.1|  lipase, putative                                      77.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009791093.1|  PREDICTED: GDSL esterase/lipase At3g48460        77.0    2e-14   Nicotiana sylvestris
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280        77.0    2e-14   Amborella trichopoda
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   77.0    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910        76.6    2e-14   Fragaria vesca subsp. vesca
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   76.6    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC41872.1|  unknown protein                                      75.5    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009353234.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   76.6    3e-14   
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670        76.6    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   76.6    3e-14   Elaeis guineensis
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   76.6    3e-14   Populus euphratica
gb|KCW45467.1|  hypothetical protein EUGRSUZ_L00816                   77.0    3e-14   Eucalyptus grandis [rose gum]
ref|XP_007209226.1|  hypothetical protein PRUPE_ppa006897mg           76.6    3e-14   Prunus persica
ref|XP_010057068.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   76.6    3e-14   Eucalyptus grandis [rose gum]
dbj|BAK04206.1|  predicted protein                                    76.3    3e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006658887.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   76.6    3e-14   Oryza brachyantha
ref|XP_008239404.1|  PREDICTED: GDSL esterase/lipase At3g48460        76.6    4e-14   Prunus mume [ume]
ref|XP_006351456.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   76.3    4e-14   Solanum tuberosum [potatoes]
ref|XP_009596313.1|  PREDICTED: GDSL esterase/lipase At3g48460        76.3    4e-14   Nicotiana tomentosiformis
ref|XP_010026792.1|  PREDICTED: GDSL esterase/lipase At3g48460        76.3    4e-14   Eucalyptus grandis [rose gum]
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   76.3    4e-14   Brassica rapa
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   76.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg           76.3    5e-14   Eutrema salsugineum [saltwater cress]
ref|XP_004236316.1|  PREDICTED: GDSL esterase/lipase At3g48460        76.3    5e-14   Solanum lycopersicum
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  75.9    5e-14   
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   76.3    5e-14   Brassica rapa
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   76.3    5e-14   
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   75.9    6e-14   Phoenix dactylifera
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   75.9    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   75.9    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004980345.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   75.5    6e-14   Setaria italica
dbj|BAD44794.1|  lipase-like                                          73.6    6e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CDY15655.1|  BnaA07g08260D                                        75.9    6e-14   Brassica napus [oilseed rape]
ref|NP_564313.1|  GDSL esterase/lipase                                74.3    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   75.9    6e-14   Elaeis guineensis
ref|XP_009414901.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   75.5    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT29449.1|  GDSL esterase/lipase                                  74.7    7e-14   
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   75.5    9e-14   Cucumis melo [Oriental melon]
gb|EYU40122.1|  hypothetical protein MIMGU_mgv1a007918mg              75.5    9e-14   Erythranthe guttata [common monkey flower]
ref|XP_003566943.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   75.1    1e-13   Brachypodium distachyon [annual false brome]
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  76.6    1e-13   
ref|XP_002463272.1|  hypothetical protein SORBIDRAFT_02g040950        75.1    1e-13   
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   75.1    1e-13   
ref|XP_006440021.1|  hypothetical protein CICLE_v10020570mg           75.1    1e-13   Citrus clementina [clementine]
ref|NP_001241470.1|  uncharacterized protein LOC100816865             75.1    1e-13   Glycine max [soybeans]
emb|CDO96752.1|  unnamed protein product                              75.1    1e-13   Coffea canephora [robusta coffee]
gb|ACU19966.1|  unknown                                               73.2    1e-13   Glycine max [soybeans]
emb|CDY30822.1|  BnaC05g21980D                                        75.1    1e-13   Brassica napus [oilseed rape]
ref|XP_006476962.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   75.1    1e-13   Citrus sinensis [apfelsine]
ref|XP_002442352.1|  hypothetical protein SORBIDRAFT_08g018740        74.7    1e-13   Sorghum bicolor [broomcorn]
ref|NP_174188.1|  lipase ARAB-1                                       74.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|EMT30305.1|  GDSL esterase/lipase                                  75.1    1e-13   
ref|XP_002456055.1|  hypothetical protein SORBIDRAFT_03g029610        74.7    1e-13   Sorghum bicolor [broomcorn]
gb|KHN08454.1|  GDSL esterase/lipase                                  75.9    1e-13   Glycine soja [wild soybean]
gb|EMT20589.1|  GDSL esterase/lipase                                  74.3    1e-13   
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   74.7    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_010101939.1|  GDSL esterase/lipase                             74.7    2e-13   Morus notabilis
ref|XP_004983111.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   74.7    2e-13   Setaria italica
dbj|BAJ88861.1|  predicted protein                                    74.7    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   74.7    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT30303.1|  GDSL esterase/lipase                                  74.3    2e-13   
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   74.3    2e-13   
ref|XP_007148067.1|  hypothetical protein PHAVU_006G177800g           73.6    2e-13   Phaseolus vulgaris [French bean]
gb|EEE65824.1|  hypothetical protein OsJ_21563                        74.7    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  74.7    2e-13   
emb|CDP15060.1|  unnamed protein product                              74.3    2e-13   Coffea canephora [robusta coffee]
emb|CDY63998.1|  BnaA07g36520D                                        74.3    2e-13   Brassica napus [oilseed rape]
gb|AAX62802.1|  lipase 2                                              74.3    2e-13   Brassica napus [oilseed rape]
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   74.7    2e-13   
ref|NP_564314.1|  GDSL esterase/lipase                                73.9    2e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94634.1|  BnaC07g10240D                                        74.3    2e-13   
ref|NP_849723.1|  GDSL esterase/lipase                                73.9    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320        73.9    2e-13   Amborella trichopoda
gb|EMT30306.1|  GDSL esterase/lipase                                  73.6    3e-13   
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  74.3    3e-13   
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   73.9    3e-13   Brassica rapa
emb|CAN62554.1|  hypothetical protein VITISV_031355                   73.9    3e-13   Vitis vinifera
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   73.9    3e-13   Brachypodium distachyon [annual false brome]
ref|XP_002274810.1|  PREDICTED: GDSL esterase/lipase At3g48460        73.9    3e-13   Vitis vinifera
dbj|BAB89203.1|  lipase-like                                          73.9    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   73.9    3e-13   Nicotiana sylvestris
ref|XP_002439449.1|  hypothetical protein SORBIDRAFT_09g006580        73.2    3e-13   
gb|EAZ12911.1|  hypothetical protein OsJ_02834                        73.9    3e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CBI14877.3|  unnamed protein product                              73.9    3e-13   Vitis vinifera
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                   73.6    3e-13   Eucalyptus grandis [rose gum]
gb|EMT01150.1|  GDSL esterase/lipase                                  73.2    4e-13   
gb|ADB85299.1|  putative retrotransposon protein                      75.1    4e-13   Phyllostachys edulis [kikko-chiku]
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...  73.6    4e-13   Brassica napus [oilseed rape]
ref|XP_006646152.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   73.6    4e-13   Oryza brachyantha
ref|XP_008675276.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   73.2    4e-13   Zea mays [maize]
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   73.6    4e-13   Phoenix dactylifera
dbj|BAJ95195.1|  predicted protein                                    73.2    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94075.1|  predicted protein                                    73.2    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   73.2    5e-13   
ref|XP_007020870.1|  GDSL esterase/lipase                             71.6    5e-13   
ref|NP_973932.1|  GDSL esterase/lipase                                73.2    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004301038.1|  PREDICTED: GDSL esterase/lipase At3g48460        72.8    6e-13   Fragaria vesca subsp. vesca
ref|XP_011084056.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   73.2    6e-13   Sesamum indicum [beniseed]
ref|XP_011072984.1|  PREDICTED: GDSL esterase/lipase At3g48460        73.2    6e-13   Sesamum indicum [beniseed]
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970        73.2    6e-13   
gb|EEC80750.1|  hypothetical protein OsI_23233                        72.8    6e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001057785.1|  Os06g0531600                                     72.8    6e-13   
gb|EAY99508.1|  hypothetical protein OsI_21478                        73.2    6e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001168047.1|  uncharacterized protein LOC100381776 precursor   72.4    7e-13   Zea mays [maize]
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650        72.8    7e-13   
ref|XP_002439448.1|  hypothetical protein SORBIDRAFT_09g006570        72.4    8e-13   Sorghum bicolor [broomcorn]
ref|NP_001043722.1|  Os01g0650000                                     70.5    9e-13   
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g           72.4    9e-13   
gb|AFK33964.1|  unknown                                               70.9    9e-13   
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600        72.4    1e-12   
ref|XP_006650886.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   72.0    1e-12   
dbj|BAK05815.1|  predicted protein                                    72.0    1e-12   
ref|XP_006645634.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   72.4    1e-12   
ref|XP_004959853.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   72.4    1e-12   
gb|KJB57433.1|  hypothetical protein B456_009G164000                  72.4    1e-12   
tpg|DAA58338.1|  TPA: hypothetical protein ZEAMMB73_636863            70.1    1e-12   
ref|XP_002438500.1|  hypothetical protein SORBIDRAFT_10g020940        72.0    1e-12   
ref|XP_010248800.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   72.4    1e-12   
ref|XP_002321669.1|  GDSL-motif lipase/hydrolase family protein       72.0    1e-12   
ref|XP_010518794.1|  PREDICTED: GDSL esterase/lipase At5g45910        71.2    1e-12   
gb|EEC75320.1|  hypothetical protein OsI_11693                        71.6    1e-12   
emb|CDO96748.1|  unnamed protein product                              70.5    1e-12   
gb|ACN28561.1|  unknown                                               71.2    1e-12   
ref|XP_002461110.1|  hypothetical protein SORBIDRAFT_02g040940        72.0    1e-12   
emb|CDY64716.1|  BnaCnng44670D                                        72.0    1e-12   
ref|XP_011024095.1|  PREDICTED: GDSL esterase/lipase At3g48460        72.0    1e-12   
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   72.0    1e-12   
ref|XP_002467296.1|  hypothetical protein SORBIDRAFT_01g023210        72.0    2e-12   
emb|CDX92960.1|  BnaA03g36820D                                        68.6    2e-12   
gb|ABK24921.1|  unknown                                               72.0    2e-12   
emb|CAG27610.1|  esterase                                             72.0    2e-12   
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  71.6    2e-12   
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   71.6    2e-12   
emb|CDY64274.1|  BnaCnng43610D                                        67.8    2e-12   
gb|EMT11816.1|  GDSL esterase/lipase                                  69.3    2e-12   
ref|NP_001064520.1|  Os10g0393800                                     71.6    2e-12   
emb|CDM82194.1|  unnamed protein product                              71.2    2e-12   
ref|XP_004981071.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   71.6    2e-12   
ref|NP_001130668.1|  uncharacterized protein LOC100191771 precursor   71.2    2e-12   
ref|XP_003566944.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   71.2    2e-12   
ref|XP_004969325.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   71.6    2e-12   
gb|EMT05392.1|  GDSL esterase/lipase                                  71.2    2e-12   
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   71.2    2e-12   
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   71.2    2e-12   
ref|XP_008371712.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   71.6    2e-12   
ref|XP_002454933.1|  hypothetical protein SORBIDRAFT_03g001670        71.2    2e-12   
gb|EEC75319.1|  hypothetical protein OsI_11692                        69.7    2e-12   
gb|AGT16586.1|  hypothetical protein SHCRBa_109_M04_R_50              71.2    3e-12   
ref|XP_006651409.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   71.2    3e-12   
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   71.2    3e-12   
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880        71.2    3e-12   
ref|XP_008671733.1|  PREDICTED: uncharacterized protein LOC100191...  71.2    3e-12   
dbj|BAK06902.1|  predicted protein                                    71.2    3e-12   
ref|XP_006852380.1|  hypothetical protein AMTR_s00049p00229270        71.2    3e-12   
ref|XP_010054331.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   70.1    3e-12   
gb|EEE55085.1|  hypothetical protein OsJ_02827                        70.9    3e-12   
ref|XP_003589576.1|  Early nodulin                                    70.9    3e-12   
gb|EYU40388.1|  hypothetical protein MIMGU_mgv1a008158mg              70.9    4e-12   
gb|EEE54111.1|  hypothetical protein OsJ_00875                        70.9    4e-12   
ref|XP_002463534.1|  hypothetical protein SORBIDRAFT_01g001540        70.9    4e-12   
ref|XP_008655072.1|  PREDICTED: LOC100284848 isoform X1               70.9    4e-12   
dbj|BAD73008.1|  putative esterase                                    69.7    4e-12   
gb|ACF83155.1|  unknown                                               70.5    4e-12   
ref|XP_008367797.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   68.6    4e-12   
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   70.9    4e-12   
ref|XP_004959854.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   70.9    4e-12   
gb|EMT00792.1|  GDSL esterase/lipase                                  70.1    4e-12   
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   70.9    4e-12   
ref|XP_009383572.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   70.5    4e-12   
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   70.5    4e-12   
ref|NP_001151215.1|  LOC100284848 precursor                           70.5    4e-12   
dbj|BAJ99647.1|  predicted protein                                    70.5    4e-12   
gb|EAY92552.1|  hypothetical protein OsI_14292                        70.5    4e-12   
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   70.9    4e-12   
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                   70.5    4e-12   
gb|EMT16273.1|  GDSL esterase/lipase                                  70.9    5e-12   
ref|NP_001130974.1|  uncharacterized protein LOC100192079             70.9    5e-12   
gb|EEC70171.1|  hypothetical protein OsI_00893                        70.5    5e-12   
ref|NP_001051872.1|  Os03g0844600                                     70.5    5e-12   
dbj|BAD68794.1|  lipase-like                                          70.5    5e-12   
dbj|BAJ86670.1|  predicted protein                                    70.5    5e-12   
gb|EMT25207.1|  GDSL esterase/lipase                                  70.1    5e-12   
ref|XP_006853138.1|  hypothetical protein AMTR_s00038p00165200        71.6    5e-12   
gb|EAY75181.1|  hypothetical protein OsI_03071                        70.5    5e-12   
gb|EYU40119.1|  hypothetical protein MIMGU_mgv1a021460mg              70.5    6e-12   
ref|NP_001064519.1|  Os10g0393500                                     68.6    6e-12   
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like   70.5    6e-12   
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   70.1    6e-12   
ref|XP_010696197.1|  PREDICTED: GDSL esterase/lipase At3g48460        70.5    6e-12   
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   70.1    6e-12   
ref|XP_002456052.1|  hypothetical protein SORBIDRAFT_03g029580        70.5    6e-12   
ref|XP_003565495.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   70.1    7e-12   
ref|XP_006404256.1|  hypothetical protein EUTSA_v10010448mg           70.1    7e-12   
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910        70.1    7e-12   
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   70.1    7e-12   
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   70.1    7e-12   
ref|XP_008806794.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   70.1    7e-12   
ref|XP_010682277.1|  PREDICTED: GDSL esterase/lipase At3g26430        70.1    7e-12   
emb|CDM81086.1|  unnamed protein product                              69.7    8e-12   
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   70.1    8e-12   
ref|XP_006646151.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   69.7    8e-12   
gb|EMT00808.1|  GDSL esterase/lipase                                  70.1    8e-12   
emb|CDY48195.1|  BnaA04g15590D                                        70.1    8e-12   
ref|XP_010911635.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   70.1    8e-12   
gb|EEE54110.1|  hypothetical protein OsJ_00874                        69.7    9e-12   
emb|CDX77066.1|  BnaC04g38610D                                        69.7    9e-12   
ref|XP_010106362.1|  hypothetical protein L484_004390                 70.1    9e-12   
ref|XP_003562455.1|  PREDICTED: GDSL esterase/lipase At3g48460        69.7    1e-11   
ref|XP_006361073.1|  PREDICTED: GDSL esterase/lipase At2g27360-like   68.9    1e-11   
ref|XP_008360766.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   67.8    1e-11   
emb|CDY63997.1|  BnaA07g36510D                                        69.3    1e-11   
ref|XP_010250902.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   69.7    1e-11   
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   69.7    1e-11   
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   69.7    1e-11   
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   69.3    1e-11   
gb|ACJ84905.1|  unknown                                               67.8    1e-11   
gb|ABF96122.1|  GDSL-like Lipase/Acylhydrolase family protein         68.9    1e-11   
ref|XP_006852134.1|  hypothetical protein AMTR_s00049p00054830        69.3    1e-11   
gb|KDP40644.1|  hypothetical protein JCGZ_24643                       69.3    1e-11   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850        69.3    1e-11   
ref|XP_008383651.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   67.4    1e-11   
gb|EMT16275.1|  GDSL esterase/lipase                                  69.3    1e-11   
ref|XP_009775228.1|  PREDICTED: acetylajmalan esterase-like           67.0    1e-11   
dbj|BAJ86481.1|  predicted protein                                    69.3    1e-11   
ref|XP_010907776.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   67.8    1e-11   
ref|XP_008351750.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   67.4    1e-11   
ref|XP_006662320.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   67.8    1e-11   
ref|XP_002875905.1|  GDSL-motif lipase/hydrolase family protein       69.3    1e-11   
gb|KJB66735.1|  hypothetical protein B456_010G156100                  68.2    1e-11   
ref|XP_006651410.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   68.9    1e-11   
ref|NP_001042396.1|  Os01g0215700                                     68.9    1e-11   
gb|KFK34151.1|  gdsl esterase lipase                                  68.9    1e-11   
gb|EPS63670.1|  hypothetical protein M569_11113                       68.9    1e-11   
ref|XP_008371713.1|  PREDICTED: GDSL esterase/lipase At5g45910        67.4    2e-11   
gb|EMT01182.1|  GDSL esterase/lipase                                  69.3    2e-11   
ref|XP_006383582.1|  hypothetical protein POPTR_0005s20025g           67.0    2e-11   
ref|XP_008655774.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   68.9    2e-11   
ref|NP_001150126.1|  esterase precursor                               68.9    2e-11   
gb|EAY90131.1|  hypothetical protein OsI_11697                        68.9    2e-11   
dbj|BAA94228.1|  putative esterase                                    68.9    2e-11   
ref|XP_002457138.1|  hypothetical protein SORBIDRAFT_03g001860        68.9    2e-11   
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   68.9    2e-11   
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   68.9    2e-11   
ref|NP_190416.1|  GDSL esterase/lipase                                68.9    2e-11   
dbj|BAJ87991.1|  predicted protein                                    68.9    2e-11   
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g           68.9    2e-11   
ref|NP_001147763.1|  esterase precursor                               68.9    2e-11   
gb|AFW80390.1|  esterase                                              68.9    2e-11   
ref|XP_004971835.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   68.6    2e-11   
ref|XP_008643602.1|  PREDICTED: esterase isoform X1                   68.9    2e-11   
ref|NP_001132224.1|  alpha-L-fucosidase 2 precursor                   68.6    2e-11   
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   68.6    2e-11   
gb|KHG30334.1|  hypothetical protein F383_10781                       68.6    2e-11   
ref|NP_001043721.1|  Os01g0649900                                     68.9    2e-11   
ref|XP_011034055.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...  67.4    2e-11   
ref|XP_004971765.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   68.6    2e-11   
ref|XP_004509605.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   68.6    2e-11   
ref|XP_010503477.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   68.6    2e-11   
dbj|BAD68800.1|  lipase-like                                          67.0    2e-11   
gb|EAY78349.1|  hypothetical protein OsI_33438                        68.6    2e-11   
gb|AAM22734.1|AC092388_18  putative lipase                            68.6    2e-11   
ref|XP_002300062.1|  hypothetical protein POPTR_0001s35620g           68.6    2e-11   
tpg|DAA58331.1|  TPA: hypothetical protein ZEAMMB73_278814            67.8    2e-11   
ref|XP_004968624.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   68.6    2e-11   
ref|XP_009359493.1|  PREDICTED: GDSL esterase/lipase At3g48460        68.6    2e-11   
emb|CDY64717.1|  BnaCnng44680D                                        67.0    2e-11   
gb|EEE59101.1|  hypothetical protein OsJ_10956                        68.6    3e-11   
ref|NP_001050175.1|  Os03g0365800                                     68.6    3e-11   
ref|NP_001043724.1|  Os01g0650200                                     67.4    3e-11   
ref|NP_001149156.1|  esterase precursor                               68.2    3e-11   
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   68.6    3e-11   
ref|XP_009333827.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   68.6    3e-11   
gb|KEH33577.1|  GDSL-like lipase/acylhydrolase                        68.2    3e-11   
ref|XP_008351751.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  66.6    3e-11   
ref|XP_008646237.1|  PREDICTED: uncharacterized protein LOC100384...  67.8    3e-11   
gb|EEE55086.1|  hypothetical protein OsJ_02828                        67.0    3e-11   
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   68.6    3e-11   
emb|CBI21953.3|  unnamed protein product                              67.4    3e-11   
ref|XP_008655643.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   68.2    3e-11   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   68.2    3e-11   
ref|XP_008393854.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   68.6    3e-11   
ref|NP_001170366.1|  uncharacterized protein LOC100384344 precursor   68.2    3e-11   
ref|XP_006643907.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   68.2    3e-11   
emb|CDM83549.1|  unnamed protein product                              68.2    4e-11   
gb|EEE62721.1|  hypothetical protein OsJ_17524                        67.0    4e-11   
gb|KDO77811.1|  hypothetical protein CISIN_1g018031mg                 66.2    4e-11   
gb|ACG28261.1|  alpha-L-fucosidase 2 precursor                        68.2    4e-11   
ref|XP_004965532.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  68.2    4e-11   
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   68.2    4e-11   
ref|XP_006392486.1|  hypothetical protein EUTSA_v10023524mg           68.2    4e-11   
gb|EMT22154.1|  GDSL esterase/lipase                                  68.2    4e-11   
ref|XP_003633253.2|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.4    4e-11   
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein       67.8    4e-11   
ref|XP_007141041.1|  hypothetical protein PHAVU_008G162300g           68.2    4e-11   
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.8    4e-11   
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.8    4e-11   
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.8    4e-11   
ref|XP_007141040.1|  hypothetical protein PHAVU_008G162300g           68.2    4e-11   
gb|KDP26686.1|  hypothetical protein JCGZ_17844                       68.2    4e-11   
gb|KJB66739.1|  hypothetical protein B456_010G156100                  67.8    4e-11   
gb|KJB66738.1|  hypothetical protein B456_010G156100                  67.8    4e-11   
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                   67.8    4e-11   
gb|EMT08653.1|  GDSL esterase/lipase                                  68.2    4e-11   
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.8    4e-11   
ref|XP_010550714.1|  PREDICTED: GDSL esterase/lipase At3g48460        67.8    4e-11   
ref|XP_002530043.1|  Alpha-L-fucosidase 2 precursor, putative         67.8    4e-11   
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.8    5e-11   
ref|XP_008646242.1|  PREDICTED: uncharacterized protein LOC100384...  66.6    5e-11   
gb|AES91099.2|  GDSL-like lipase/acylhydrolase                        67.8    5e-11   
emb|CDX71574.1|  BnaC04g18090D                                        67.8    5e-11   
gb|EMT16237.1|  GDSL esterase/lipase                                  67.8    5e-11   
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.8    5e-11   
ref|XP_003529851.1|  PREDICTED: GDSL esterase/lipase 5-like           67.8    5e-11   
gb|ABK23063.1|  unknown                                               65.5    5e-11   
ref|XP_004971762.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   67.4    6e-11   
dbj|BAJ90380.1|  predicted protein                                    67.4    6e-11   
ref|XP_003593740.1|  GDSL esterase/lipase                             67.4    6e-11   
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.4    6e-11   
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   67.4    6e-11   
gb|ABL11233.1|  UCW116, putative lipase                               67.4    6e-11   
ref|NP_001043727.1|  Os01g0650900                                     67.4    6e-11   
ref|XP_006377555.1|  hypothetical protein POPTR_0011s07620g           64.7    6e-11   
ref|XP_011042394.1|  PREDICTED: alpha-L-fucosidase 3-like             67.4    7e-11   
ref|XP_002530042.1|  Alpha-L-fucosidase 2 precursor, putative         67.4    7e-11   
ref|XP_006291232.1|  hypothetical protein CARUB_v10017363mg           67.4    7e-11   
ref|XP_010515164.1|  PREDICTED: GDSL esterase/lipase At3g48460        67.4    7e-11   
ref|XP_011042393.1|  PREDICTED: alpha-L-fucosidase 3-like             67.4    7e-11   



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score =   108 bits (269),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 3/84 (4%)
 Frame = +3

Query  39   TAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYG  218
            ++ ++  I+L++  S G V G CY++I+SFGDS+TDTGNLI  SK  S   V SSVPPYG
Sbjct  4    SSCSFIYIILLLISSFGLVLG-CYESIISFGDSLTDTGNLIRLSK--SNKHVASSVPPYG  60

Query  219  ETFFHHPTGRYSDGRLIIDFIAQS  290
            ETFFHHPTGR+SDGRLIIDFIA+S
Sbjct  61   ETFFHHPTGRFSDGRLIIDFIAES  84



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 3/83 (4%)
 Frame = +3

Query  42   AITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGE  221
            A ++  I+L++  S G V G CY++I+SFGDS+TDTGNLI  SK  S   V SSVPPYGE
Sbjct  6    ASSFIYIILMLIASFGLVLG-CYESIISFGDSLTDTGNLIRLSK--SNSHVASSVPPYGE  62

Query  222  TFFHHPTGRYSDGRLIIDFIAQS  290
            TFFHHPTGR+SDGRL+IDFIA+S
Sbjct  63   TFFHHPTGRFSDGRLVIDFIAES  85



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (80%), Gaps = 3/79 (4%)
 Frame = +3

Query  51   YYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFF  230
            + C+++++  S GHV G CY++I+SFGDS+ DTGNLI  SK  S   V SSV PYGETFF
Sbjct  11   FICVIILLITSFGHVHG-CYESIISFGDSLADTGNLIRLSK--SNKIVASSVLPYGETFF  67

Query  231  HHPTGRYSDGRLIIDFIAQ  287
            HHPTGR+SDGRL+IDFIA+
Sbjct  68   HHPTGRFSDGRLVIDFIAE  86



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            G Y++I+SFGDS+ DTGNLI  SK  S   V SSV PYGETFFHHPTGR+SDGRL+IDFI
Sbjct  24   GSYESIISFGDSLADTGNLIRLSK--SNKIVASSVLPYGETFFHHPTGRFSDGRLVIDFI  81

Query  282  AQ  287
            A+
Sbjct  82   AE  83



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 61/84 (73%), Gaps = 5/84 (6%)
 Frame = +3

Query  39   TAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYG  218
            TAI +  ++L  F++T     GC+ +I+SFGDS+ DTGN +H S+  +      +V PYG
Sbjct  15   TAIAFIILLLNFFQATK----GCFNSIISFGDSLADTGNKLHLSQYKTH-LPHFAVRPYG  69

Query  219  ETFFHHPTGRYSDGRLIIDFIAQS  290
            ETFFHHPTGR+SDGRL+IDFIA+S
Sbjct  70   ETFFHHPTGRFSDGRLVIDFIAES  93



>ref|XP_010316802.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X3 [Solanum 
lycopersicum]
Length=313

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 5/65 (8%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKS--KVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            GC+ +I+SFGDS+ DTGN +H S  K     F   S+PPYGETFFHHPTGR+SDGRL+ID
Sbjct  27   GCFDSIISFGDSLADTGNKLHISLNKTPPSHF---SLPPYGETFFHHPTGRFSDGRLVID  83

Query  276  FIAQS  290
            FIA+S
Sbjct  84   FIAES  88



>ref|XP_010316801.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Solanum 
lycopersicum]
Length=328

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 5/65 (8%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKS--KVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            GC+ +I+SFGDS+ DTGN +H S  K     F   S+PPYGETFFHHPTGR+SDGRL+ID
Sbjct  27   GCFDSIISFGDSLADTGNKLHISLNKTPPSHF---SLPPYGETFFHHPTGRFSDGRLVID  83

Query  276  FIAQS  290
            FIA+S
Sbjct  84   FIAES  88



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +3

Query  54   YCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKS--KVLSKGFVKSSVPPYGETF  227
            +  + +V         GC+ +I+SFGDS+ DTGN +H S  K     F   S+PPYGETF
Sbjct  11   WSFIFLVLNHNFQRIEGCFDSIISFGDSLADTGNKLHISLNKTPPSHF---SLPPYGETF  67

Query  228  FHHPTGRYSDGRLIIDFIAQS  290
            FHHPTGR+SDGRL+IDFIA+S
Sbjct  68   FHHPTGRFSDGRLVIDFIAES  88



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 9/90 (10%)
 Frame = +3

Query  27   FSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIH--KSKVLSKGFVKS  200
            ++  TAI    +VL  F++T     GC+ +I+SFGDS+ DTGN +H  ++K L   F   
Sbjct  11   YTWNTAIACIILVLNFFQATE----GCFNSIISFGDSLADTGNRLHLSQNKTLLPHF---  63

Query  201  SVPPYGETFFHHPTGRYSDGRLIIDFIAQS  290
            +V PYGETFFH PTGR+SDGR++IDFIA+S
Sbjct  64   AVRPYGETFFHRPTGRFSDGRIVIDFIAES  93



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GC+ +++SFGDS+TDTGNL + S   S  + +   PPYGET+FHHPTGR SDGRLIIDFI
Sbjct  28   GCFNSVISFGDSLTDTGNLYNSSPNRSLHYFQ---PPYGETYFHHPTGRCSDGRLIIDFI  84

Query  282  AQ  287
            AQ
Sbjct  85   AQ  86



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +3

Query  54   YCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFH  233
            Y I+L++  S   +A GCY +I+SFGDS+ DTGNL+  S   +        PPYG TFFH
Sbjct  7    YAIILILVASISRLASGCYDSIISFGDSLADTGNLLLLSPPNNPPLCGR--PPYGRTFFH  64

Query  234  HPTGRYSDGRLIIDFIAQS  290
              TGRYSDGRL+IDFIA+S
Sbjct  65   RTTGRYSDGRLVIDFIAES  83


 Score = 83.2 bits (204),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            ++  C +L++       +  C+ +I+SFGDS+ DTGN  + S    +     ++PPYGET
Sbjct  401  LSLACTILILSHKLSFASASCFTSIISFGDSIADTGNAPYLSPESGRPPF-YTLPPYGET  459

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            FF+HPTGR SDGRLIIDFIA+
Sbjct  460  FFNHPTGRCSDGRLIIDFIAE  480



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  30   SLGTAITYYC--IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSS  203
            S+G +   Y   ++LV      HV G C+ +++SFGDS+TDTGNL + S   S  + +  
Sbjct  3    SMGWSFQAYLMNLILVSVFIIPHVLG-CFNSVISFGDSLTDTGNLYNSSPNRSLHYFQ--  59

Query  204  VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             PPYGET+FHHPTGR SDGRLIIDFIAQ
Sbjct  60   -PPYGETYFHHPTGRCSDGRLIIDFIAQ  86



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 5/81 (6%)
 Frame = +3

Query  54   YCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIH--KSKVLSKGFVKSSVPPYGETF  227
            +  + +V         GC+ +I+SFGDS+ DTGN +H   +K+    F   S+PPYGETF
Sbjct  11   WSFLFLVLNHNFQNIEGCFDSIISFGDSLADTGNKLHITLNKIPPSHF---SLPPYGETF  67

Query  228  FHHPTGRYSDGRLIIDFIAQS  290
            FHHPTGR+SDGRL+IDFIA+S
Sbjct  68   FHHPTGRFSDGRLVIDFIAES  88



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A GCY +I+SFGDSV+DTGNL + S   S  F     PPYGET+FHHPTGR SDGRL+ID
Sbjct  478  ALGCYSSIISFGDSVSDTGNLYNSSPNKSFNFF---FPPYGETYFHHPTGRCSDGRLVID  534

Query  276  FIAQS  290
            FIA+S
Sbjct  535  FIAES  539


 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A GCY +I+SFGDS+ DTGNL + S   S  F     PPYGET+FH P GR SDGRLIID
Sbjct  18   ALGCYSSIISFGDSIADTGNLYNSSPNKSLDFF---FPPYGETYFHRPVGRCSDGRLIID  74

Query  276  FIAQ  287
            FIA+
Sbjct  75   FIAE  78



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTGHVAG--GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSS  203
            S+ ++ + Y + L++   +   AG  GCY +I SFGDS+TDTGNL   SK  S  F    
Sbjct  6    SMASSSSPYLMNLLLISLSVFFAGAFGCYSSIFSFGDSITDTGNLYISSKNSSFHFF---  62

Query  204  VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             PPYGET+FHHPTGR SDGRLIIDFIA+
Sbjct  63   FPPYGETYFHHPTGRCSDGRLIIDFIAE  90



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGRYSDGRLIIDFIA+
Sbjct  34   FKSIISFGDSIADTGNLLGLSD--PNDLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAE  91



>ref|XP_007213171.1| hypothetical protein PRUPE_ppa026981mg, partial [Prunus persica]
 gb|EMJ14370.1| hypothetical protein PRUPE_ppa026981mg, partial [Prunus persica]
Length=310

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 3/62 (5%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GC+ +++SFGDS+TDTGNL   S   S  + +   PPYGET+FHHPTGR SDGRLIIDFI
Sbjct  36   GCFNSVISFGDSLTDTGNLYDSSPNRSLHYFQ---PPYGETYFHHPTGRCSDGRLIIDFI  92

Query  282  AQ  287
            AQ
Sbjct  93   AQ  94



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY +I+ FGDS+TDTGNL +     S  F     PPYGET+FHHPTGR SDGRL+IDFI
Sbjct  25   GCYNSIIGFGDSITDTGNLYNSDPNRSLNFFH---PPYGETYFHHPTGRCSDGRLVIDFI  81

Query  282  AQ  287
            A+
Sbjct  82   AE  83



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            +T + ++L       H    CY++I+SFGDS+ DTGNL+  S          ++PPYGET
Sbjct  13   LTSFLLILFAVPIDSHRPRRCYESIISFGDSIADTGNLLILSD--PNHLPHFALPPYGET  70

Query  225  FFHHPTGRYSDGRLIIDFIAQS  290
            FFH PTGR+SDGRLIIDFIA+S
Sbjct  71   FFHFPTGRHSDGRLIIDFIAES  92



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+TDTGNL+  S        +S+ PPYGETFFHHP+GR+SDGRLIIDFIA+
Sbjct  31   FKSIISFGDSITDTGNLLGLSS--PNDLPESAFPPYGETFFHHPSGRFSDGRLIIDFIAE  88



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTG----HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVK  197
            SL    T + I+++ F ++       AG CYK+++SFGDS+ DTGNL H     S     
Sbjct  5    SLAPLTTAFTIIILTFLNSSITVSASAGICYKSLISFGDSLADTGNLFHLDSPSSSSDAP  64

Query  198  SS-VPPYGETFFHHPTGRYSDGRLIIDFIAQS  290
               +PPYGET+FHHPTGR SDGRL++DFIA+S
Sbjct  65   HFFLPPYGETYFHHPTGRCSDGRLVVDFIAES  96



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHP  239
            I++++F  T  V G CY++I SFGDS+TDTGNL+  S   +      + PPYGETFFH P
Sbjct  6    ILVLIFAHTQQVIG-CYESIFSFGDSLTDTGNLLLASP--AHNLPHFAKPPYGETFFHRP  62

Query  240  TGRYSDGRLIIDFIA  284
            TGR SDGRLIIDFIA
Sbjct  63   TGRCSDGRLIIDFIA  77



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            +++    L+V  +        +K+I+SFGDS+ DTGNL+  S         S+ PPYGET
Sbjct  432  VSFLLSTLLVTSANSQTQCRNFKSIISFGDSIADTGNLLGLSD--PNNLPASAFPPYGET  489

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            FFHHPTGRYSDGRLIIDFIA+
Sbjct  490  FFHHPTGRYSDGRLIIDFIAE  510


 Score = 80.5 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVP  209
            SL   +T+    L+V   +       +K+I+SFGDS+ DTGNL+  S         ++ P
Sbjct  3    SLDALLTFLYSTLLVTIVSSETPCQNFKSIISFGDSIADTGNLVGLSN--RNNLPVTAFP  60

Query  210  PYGETFFHHPTGRYSDGRLIIDFIAQ  287
            PYGETFFHHPTGR  DGR+I+DFIA+
Sbjct  61   PYGETFFHHPTGRSCDGRIIMDFIAE  86



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+TDTGNL+  S        +S+ PPYGETFFHHP+GR+SDGRLIIDFIA+
Sbjct  27   FKSIISFGDSITDTGNLLGLSS--PNDLPESAFPPYGETFFHHPSGRFSDGRLIIDFIAE  84



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY++I+SFGDS+ DTGNL+  S   +K    ++ PPYG TFFH PTGR+SDGRL+IDFI
Sbjct  29   GCYESIISFGDSLADTGNLLLLSPADNK--PAAARPPYGRTFFHRPTGRFSDGRLVIDFI  86

Query  282  AQ  287
            AQ
Sbjct  87   AQ  88



>ref|XP_006646155.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=375

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +3

Query  24   GFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSS  203
            GFS   A+  +C  L V       A GCY  I SFGDS+TDTGN +H +    KG     
Sbjct  10   GFSPALAV-LWCAALTVAGGLPPPALGCYSRIFSFGDSLTDTGNYVHLTA--GKGPSPYG  66

Query  204  VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             PPYG TFF  PTGR SDGRL+IDFIAQ
Sbjct  67   APPYGRTFFGRPTGRASDGRLVIDFIAQ  94



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 12/93 (13%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGN-------LIHKSKVLSKG  188
            SL T I++    L++  S    A GC+ +I + GDS+ DTGN       + H    LSKG
Sbjct  7    SLPTTISFSVTFLILLSSL-KTASGCFTSIFALGDSLADTGNYATIYPPIFH----LSKG  61

Query  189  FVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             +   +PPYGET+FHHPTGR SDGRLIIDFIA+
Sbjct  62   TLYCGLPPYGETYFHHPTGRCSDGRLIIDFIAE  94



>gb|KJB51165.1| hypothetical protein B456_008G204600 [Gossypium raimondii]
Length=386

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN   +S     GFV+ S PPYG TFFHHPT RYSDGRL+IDF+AQ
Sbjct  43   FKKIYAFGDSFTDTGNT--ESLSGPNGFVRVSNPPYGTTFFHHPTNRYSDGRLVIDFVAQ  100

Query  288  S  290
            S
Sbjct  101  S  101



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGRYSDGRLIIDFIA+
Sbjct  35   FESIISFGDSIADTGNLLGLSD--QNNLPMSAFPPYGETFFHHPTGRYSDGRLIIDFIAE  92



>ref|XP_008439763.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=398

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +3

Query  63   VLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPT  242
            V      + +V G C+ +I +FGDS++DTGNL +     S    KS   PYG+TFF HPT
Sbjct  17   VATALSPSTNVLGNCFNSIFNFGDSLSDTGNLFNNCN--SNKPPKSCFTPYGDTFFRHPT  74

Query  243  GRYSDGRLIIDFIAQS  290
            GR+SDGRLIIDFIAQS
Sbjct  75   GRFSDGRLIIDFIAQS  90



>ref|XP_004969330.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Setaria 
italica]
Length=380

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   VLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPT  242
            VL V  S G  A GCY  I SFGDS+TDTGN +H   + +K       PPYG TFF  PT
Sbjct  22   VLAVLWSGGSPALGCYTRIFSFGDSLTDTGNYVH---LTAKSHSPYGAPPYGRTFFGRPT  78

Query  243  GRYSDGRLIIDFIAQ  287
            GR SDGRL+IDFIA+
Sbjct  79   GRASDGRLVIDFIAE  93



>ref|XP_004969329.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Setaria 
italica]
Length=381

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   VLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPT  242
            VL V  S G  A GCY  I SFGDS+TDTGN +H   + +K       PPYG TFF  PT
Sbjct  22   VLAVLWSGGSPALGCYTRIFSFGDSLTDTGNYVH---LTAKSHSPYGAPPYGRTFFGRPT  78

Query  243  GRYSDGRLIIDFIAQ  287
            GR SDGRL+IDFIA+
Sbjct  79   GRASDGRLVIDFIAE  93



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGRYSDGRLIIDFIA+
Sbjct  27   FESIISFGDSIADTGNLLGLSD--RNNLPMSAFPPYGETFFHHPTGRYSDGRLIIDFIAE  84



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            ++++   L+V   +       +++I+SFGDS+TDTGNLI  S        +S+  PYGET
Sbjct  13   VSFFLYTLLVTSVSSETKCLNFQSIISFGDSITDTGNLIALST--PNELPESAFLPYGET  70

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            FFHHPTGRYSDGRLIIDFIA+
Sbjct  71   FFHHPTGRYSDGRLIIDFIAE  91



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +3

Query  87   GHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRL  266
            G    GCY +I SFGDS+ DTGNL+H    L +   +   PPYG T+FH PTGR+SDGRL
Sbjct  45   GSATTGCYSSIFSFGDSLADTGNLLH---TLGRDGTRIGRPPYGMTYFHRPTGRFSDGRL  101

Query  267  IIDFIAQS  290
            I+DFIAQ+
Sbjct  102  IVDFIAQA  109



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            ++++   L+V   +       +++I+SFGDS+TDTGNLI  S        +S+  PYGET
Sbjct  13   VSFFLYTLLVTSVSSETKCLNFQSIISFGDSITDTGNLIALST--PNELPESAFLPYGET  70

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            FFHHPTGRYSDGRLIIDFIA+
Sbjct  71   FFHHPTGRYSDGRLIIDFIAE  91



>gb|KJB62807.1| hypothetical protein B456_009G437300 [Gossypium raimondii]
Length=401

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = +3

Query  9    KVLIMGFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKG  188
            + LI+GF           + V+  S+     GC+ +I SFGDS+TDTGNL+  S + S  
Sbjct  12   QCLIVGF-----------LFVIMISSIQPVNGCFTSIFSFGDSLTDTGNLLEISLLESNK  60

Query  189  FVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQS  290
               S+ PP G TFFHHP+GR  DGRL+IDF+A++
Sbjct  61   LPPSAFPPNGRTFFHHPSGRRCDGRLVIDFLAEA  94



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            ++++   L+V   T       +K+I+SFGDS+TDTGNL+  S        +S+ PPYGET
Sbjct  10   LSFFISTLLVTIVTSQTGCRNFKSIISFGDSITDTGNLLGLSS--PNDLPESAFPPYGET  67

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            FFH+P+GR+SDGRLIIDFIA+
Sbjct  68   FFHYPSGRFSDGRLIIDFIAE  88



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 9/74 (12%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSS---------VPPYGETFFHHPTGR  248
            AG CY +I+SFGDS+ DTGNL+   ++ S     SS         +PPYGETFFHHPTGR
Sbjct  32   AGTCYNSIISFGDSLADTGNLLRLDRLSSSSSSSSSSSNTPPHFFLPPYGETFFHHPTGR  91

Query  249  YSDGRLIIDFIAQS  290
             SDGRL+IDFIA+S
Sbjct  92   CSDGRLVIDFIAES  105



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +3

Query  93   VAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLII  272
            +  GCY AI SFGDS+ DTGN +H  +    G       PYGETFFHHPTGRYSDGR+++
Sbjct  38   LVAGCYSAIFSFGDSLADTGNRLHSHRFDPVGRF-----PYGETFFHHPTGRYSDGRVML  92

Query  273  DFIAQS  290
            DFIAQ+
Sbjct  93   DFIAQA  98



>ref|XP_009102895.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=382

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S        K + PPYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  36   FKSIISFGDSIADTGNLLGLSD--PNNLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAE  93



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGRYSDGRLIIDFIA+
Sbjct  454  FKSIISFGDSIADTGNLLGLSD--PNDLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAE  511


 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S         ++ PPYGETFFHHPTGR  DGR+I+DFIA+
Sbjct  29   FKSIISFGDSIADTGNLVGLSD--RNQLPVTAFPPYGETFFHHPTGRSCDGRIIMDFIAE  86



>ref|XP_010540491.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X3 [Tarenaya 
hassleriana]
Length=321

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            +T + ++L       H    CY++I+SFGDS+ DTGNL+  S          ++PPYGET
Sbjct  13   LTSFLLILFAVPIDSHRPRRCYESIISFGDSIADTGNLLILSD--PNHLPHFALPPYGET  70

Query  225  FFHHPTGRYSDGRLIIDFI  281
            FFH PTGR+SDGRLIIDFI
Sbjct  71   FFHFPTGRHSDGRLIIDFI  89



>emb|CDY15658.1| BnaA07g08290D [Brassica napus]
Length=386

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S        K + PPYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  36   FKSIISFGDSIADTGNLLGLSD--PNNLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAE  93



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+ FGDS+TDTGNL+H S +      +S+ PPYGETFFH PTGR+S+GRLIIDFIA+
Sbjct  35   FKSIIIFGDSITDTGNLLHLSDL--NNLPQSAFPPYGETFFHVPTGRFSNGRLIIDFIAE  92



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+ FGDS+TDTGNL+H S+       +S+ PPYGETFFH PTGR+S+GRLIIDFIA+
Sbjct  35   FKSIIIFGDSITDTGNLLHLSE--PNNLPQSAFPPYGETFFHVPTGRFSNGRLIIDFIAE  92



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  63   VLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPT  242
            + V+  S      GC+ +I SFGDS+TDTGNL+  S + S     S+ PP G TFFHHP+
Sbjct  19   LFVIIVSIIQPVNGCFTSIFSFGDSLTDTGNLLEISLLESNKLPPSAFPPNGRTFFHHPS  78

Query  243  GRYSDGRLIIDFIAQS  290
            GR  DGRL+IDF+A++
Sbjct  79   GRRCDGRLVIDFLAEA  94



>gb|AAX59709.1| lipase 1 [Brassica napus]
Length=373

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S        K + PPYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  27   FKSIISFGDSIADTGNLLGLSD--PNNLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAE  84



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 3/75 (4%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHP  239
            I++++F  T  V G CY++I SFGDS+TDTGNL+  S   +      + PPYGETFFH P
Sbjct  6    ILVLIFAHTQQVIG-CYESIFSFGDSLTDTGNLLLASP--AHNLPHFAKPPYGETFFHRP  62

Query  240  TGRYSDGRLIIDFIA  284
            TGR SDGRLIIDFIA
Sbjct  63   TGRCSDGRLIIDFIA  77


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            Y++I SFGDS+ DTGN +  S  L+   ++    PYGETFF H TGR SDGRLI+DFIA+
Sbjct  372  YESIFSFGDSLADTGNFL-LSGALAFPVIREL--PYGETFFRHATGRCSDGRLIVDFIAE  428

Query  288  S  290
            +
Sbjct  429  A  429



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +3

Query  81   STGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDG  260
            ST   AG CYK+I+SFGDS+ DTGNL+      S      S+PPYGE+FFH PTGR+S+G
Sbjct  27   STRASAGICYKSIISFGDSIADTGNLLRLCP--SNYPPHFSLPPYGESFFHRPTGRFSNG  84

Query  261  RLIIDFIAQS  290
            RL+IDF A+S
Sbjct  85   RLVIDFFAES  94



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 4/74 (5%)
 Frame = +3

Query  72   VFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTG  245
            +F + G     C  +++I+SFGDS+ DTGNL+  S   +     S+ PPYGETFFHHPTG
Sbjct  20   LFVTIGSSESQCQNFESIISFGDSIADTGNLLSLSDRYN--LPMSAFPPYGETFFHHPTG  77

Query  246  RYSDGRLIIDFIAQ  287
            R+SDGRLIIDFIA+
Sbjct  78   RFSDGRLIIDFIAE  91



>emb|CDX94632.1| BnaC07g10260D [Brassica napus]
Length=382

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S        K + PPYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  36   FKSIISFGDSIADTGNLLGLSD--PNDLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAE  93



>gb|KJB63192.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=264

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  99   GGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDF  278
             GC+ +I SFGDS+TDTGNL+  S   S     S+  PYG TFFHHPTGR+ DGRL+IDF
Sbjct  31   NGCFTSIFSFGDSLTDTGNLLEISLSDSTNPPHSAFLPYGRTFFHHPTGRFCDGRLVIDF  90

Query  279  IAQS  290
            IA++
Sbjct  91   IAEA  94



>gb|EYU28066.1| hypothetical protein MIMGU_mgv1a009376mg [Erythranthe guttata]
Length=344

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
             C+K+I+SFGDS+ DTGNL+H S   +     +S PPYGET+FH PTGR+SDGRLIIDFI
Sbjct  34   ACFKSIISFGDSIADTGNLLHLSPPSNPPPNFAS-PPYGETYFHLPTGRFSDGRLIIDFI  92

Query  282  AQS  290
            A+ 
Sbjct  93   AEE  95



>ref|XP_010540489.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Tarenaya 
hassleriana]
Length=366

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            +T + ++L       H    CY++I+SFGDS+ DTGNL+  S          ++PPYGET
Sbjct  13   LTSFLLILFAVPIDSHRPRRCYESIISFGDSIADTGNLLILSD--PNHLPHFALPPYGET  70

Query  225  FFHHPTGRYSDGRLIIDFI  281
            FFH PTGR+SDGRLIIDFI
Sbjct  71   FFHFPTGRHSDGRLIIDFI  89



>ref|NP_174440.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAT99799.1| At1g31550 [Arabidopsis thaliana]
 gb|AAU45217.1| At1g31550 [Arabidopsis thaliana]
 gb|AEE31371.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=391

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGR+SDGRLIIDFIA+
Sbjct  34   FESIISFGDSIADTGNLLGLSD--HNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAE  91



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGR+SDGRLIIDFIA+
Sbjct  34   FESIISFGDSIADTGNLLGLSD--HNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAE  91



>gb|KHG00751.1| hypothetical protein F383_21550 [Gossypium arboreum]
Length=386

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    S     GFV  S PPYG TFFHHPT RYSDGRL+IDF+AQ
Sbjct  43   FKKIYAFGDSFTDTGNT--GSLTGPNGFVHVSNPPYGTTFFHHPTNRYSDGRLVIDFVAQ  100

Query  288  S  290
            S
Sbjct  101  S  101



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGR+SDGRLIIDFIA+
Sbjct  34   FESIISFGDSIADTGNLLGLSD--HNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAE  91



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGR+SDGRLIIDFIA+
Sbjct  34   FESIISFGDSIADTGNLLGLSD--HNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAE  91



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +3

Query  54   YCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKG---FVKSSVPPYGET  224
            + I++V+  +   +A  CY +I +FGDS++D GN IH  + +  G     + + PPYGET
Sbjct  11   FAILVVLLLTPLQIASACYTSIYAFGDSLSDAGNYIHIYQQMFPGTHKLPRYASPPYGET  70

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            +FHHPTGR SDGR IIDF+A+
Sbjct  71   YFHHPTGRTSDGRTIIDFMAE  91



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 3/62 (5%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY +I++FGDS+TDTGNL +     S  F     PPYG+T+FHHPTGR SDGRL+IDFI
Sbjct  533  GCYNSIIAFGDSLTDTGNLYNSYPNKSLNFFH---PPYGQTYFHHPTGRCSDGRLVIDFI  589

Query  282  AQ  287
            A+
Sbjct  590  AE  591


 Score = 80.1 bits (196),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            G Y +I+SFGDS+TDTGN  +     S  F     PPYG+T+FHHPTGR SDGRL+IDFI
Sbjct  32   GRYNSIISFGDSLTDTGNFYNSYPNKSLNFFH---PPYGQTYFHHPTGRCSDGRLVIDFI  88

Query  282  AQ  287
            A+
Sbjct  89   AE  90



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNLI  S        +S+ PPYGETFFHHPTGR+SDGRL+IDFIA+
Sbjct  37   FESIISFGDSIADTGNLIGLSS--PNQLPESAFPPYGETFFHHPTGRFSDGRLVIDFIAE  94


 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFFHHPTGR+S+GRL+IDFIA+
Sbjct  396  FKSIISFGDSIADTGNLVGLSD--PNDLPHVAFPPYGETFFHHPTGRFSNGRLVIDFIAE  453



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            G +K+I+SFGDS+TDTGNL+  S   +     S+ PPYGETFFH PTGRYS+GRLIIDFI
Sbjct  34   GKFKSIISFGDSITDTGNLLALSDADNP--PHSAFPPYGETFFHFPTGRYSNGRLIIDFI  91

Query  282  AQ  287
            A+
Sbjct  92   AE  93



>gb|KJB63193.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=399

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  99   GGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDF  278
             GC+ +I SFGDS+TDTGNL+  S   S     S+  PYG TFFHHPTGR+ DGRL+IDF
Sbjct  31   NGCFTSIFSFGDSLTDTGNLLEISLSDSTNPPHSAFLPYGRTFFHHPTGRFCDGRLVIDF  90

Query  279  IAQS  290
            IA++
Sbjct  91   IAEA  94



>ref|XP_010327054.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Solanum 
lycopersicum]
Length=356

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A  CY +I  FGDS+TDTGNL+H     +K  +    PPYGET+FHHPTGR SDGRL+ID
Sbjct  23   ATSCYTSIFGFGDSLTDTGNLVHFYPNGNKPHM--YFPPYGETYFHHPTGRCSDGRLLID  80

Query  276  FIAQ  287
             IAQ
Sbjct  81   LIAQ  84



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   VLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPT  242
            V +   ST  V   CY +I SFGDS+ DTGNL+       K + + S  PYGET+FH PT
Sbjct  17   VFLALASTNQVLS-CYTSIFSFGDSLADTGNLLILQAQEHKPYSRISRVPYGETYFHRPT  75

Query  243  GRYSDGRLIIDFIAQS  290
            GR S+GRL+IDFIAQS
Sbjct  76   GRSSNGRLVIDFIAQS  91



>emb|CDX94633.1| BnaC07g10250D [Brassica napus]
Length=396

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHP  239
            + L +  S  H     +K+I+SFGDS  DTGNLI  S         ++ PPYGETFFHHP
Sbjct  21   LFLTIVNSEAHCRN--FKSIISFGDSTADTGNLIGLSD--PDDLPAAAFPPYGETFFHHP  76

Query  240  TGRYSDGRLIIDFIAQ  287
            TGR+S+GRLIIDFIA+
Sbjct  77   TGRFSNGRLIIDFIAE  92



>ref|XP_008647410.1| PREDICTED: uncharacterized protein LOC100193666 isoform X1 [Zea 
mays]
Length=322

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  24   GFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSS  203
            G + G+A  + C VL VF      A G Y+A+ SFGDS+ D GNL+ +       ++ ++
Sbjct  19   GGAAGSA-RWVCAVLSVFPLLAAAAQGRYRAVFSFGDSLVDAGNLVTEG---IPDYLATA  74

Query  204  VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             PPYG+T+F +PTGR SDGRL++DFIAQ
Sbjct  75   RPPYGQTYFGYPTGRCSDGRLVVDFIAQ  102



>dbj|BAJ92568.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93124.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +3

Query  27   FSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSV  206
            FSL  A+++  +VL +   +G  A  CY  I SFGDS+TDTGN +   ++ +K       
Sbjct  8    FSLALAVSHALLVLGL--GSGSSALSCYSRIFSFGDSLTDTGNYV---RLTAKNPSPYGA  62

Query  207  PPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            PPYG TFF  PTGR SDGRL+IDFIAQ
Sbjct  63   PPYGTTFFGRPTGRASDGRLVIDFIAQ  89



>ref|XP_010540487.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Tarenaya hassleriana]
Length=402

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY +I+SFGDS+ DTGNL+  S+       + + PPYGETFFH PTGR+SDGRL+IDFIA
Sbjct  40   CYDSIISFGDSIADTGNLLSLSE--PSHVPQVAFPPYGETFFHRPTGRFSDGRLVIDFIA  97

Query  285  QS  290
             S
Sbjct  98   DS  99



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            AG CYK+I+ FGDS+TDTGNL+               PPYGETFF HPTGR  DGRLIID
Sbjct  32   AGSCYKSIIGFGDSLTDTGNLVQLFP--PDNPTHCYRPPYGETFFKHPTGRCCDGRLIID  89

Query  276  FIAQS  290
            FIA+S
Sbjct  90   FIAES  94



>ref|XP_004958488.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=398

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
             GGCYK   +FGDS+ DTGN IH S   + G V  S  PYGETFFH PTGR+SDGRLI+D
Sbjct  46   GGGCYKRFFAFGDSLIDTGNFIHYST--APGPVARS--PYGETFFHRPTGRWSDGRLIVD  101

Query  276  FIAQ  287
            F+ +
Sbjct  102  FVVE  105



>ref|XP_010232089.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Brachypodium 
distachyon]
Length=370

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +3

Query  27   FSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSV  206
            FSL  A++  C +L + ++    A GCY  + SFGDS+TDTGN +   ++ +K       
Sbjct  8    FSLALAVS--CALLGLGDAASS-ALGCYSRVFSFGDSLTDTGNYV---RLTAKNPSPYGA  61

Query  207  PPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            PPYG TFF HPTGR SDGRL+IDFIAQ
Sbjct  62   PPYGRTFFGHPTGRASDGRLVIDFIAQ  88



>ref|XP_003569463.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Brachypodium 
distachyon]
Length=369

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +3

Query  27   FSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSV  206
            FSL  A++  C +L + ++    A GCY  + SFGDS+TDTGN +   ++ +K       
Sbjct  8    FSLALAVS--CALLGLGDAASS-ALGCYSRVFSFGDSLTDTGNYV---RLTAKNPSPYGA  61

Query  207  PPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            PPYG TFF HPTGR SDGRL+IDFIAQ
Sbjct  62   PPYGRTFFGHPTGRASDGRLVIDFIAQ  88



>ref|XP_010499708.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=379

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGR+SDG LIIDFIA+
Sbjct  36   FESIISFGDSIADTGNLLGLSD--RNNLPMSAFPPYGETFFHHPTGRFSDGHLIIDFIAE  93



>emb|CDX90162.1| BnaA08g18220D [Brassica napus]
Length=390

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 59/94 (63%), Gaps = 10/94 (11%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG-----CYKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M FSL   I+ +   L +F ST  V         YK+I+SFGDS  DTGN +H S V   
Sbjct  1    MAFSLKKLISTF---LFIFSSTITVDSSEPSCRSYKSIISFGDSGADTGNYLHLSDVNHP  57

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +++ PPYGETFFH PTGR SDGRLIIDFIA+
Sbjct  58   --PQAAFPPYGETFFHAPTGRNSDGRLIIDFIAE  89



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+TDTGNL+  S   +    +++ PPYGETFFH PTGR+S+GRLIIDFIA+
Sbjct  35   FKSIISFGDSITDTGNLLGLSD--ANDLPQAAFPPYGETFFHVPTGRFSNGRLIIDFIAE  92



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 6/81 (7%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            ++ +C+  V  E   H     +K+I+SFGDS+ DTGNL+  S        K +  PYGET
Sbjct  15   LSTFCLTTVNSEPQCH----NFKSIISFGDSIADTGNLLALSD--PTNLPKVAFLPYGET  68

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            FFHHPTGR+S+GRLIIDFIA+
Sbjct  69   FFHHPTGRFSNGRLIIDFIAE  89



>gb|AFW76565.1| hypothetical protein ZEAMMB73_187768 [Zea mays]
Length=390

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  24   GFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSS  203
            G + G+A  + C VL VF      A G Y+A+ SFGDS+ D GNL+ +       ++ ++
Sbjct  19   GGAAGSA-RWVCAVLSVFPLLAAAAQGRYRAVFSFGDSLVDAGNLVTEG---IPDYLATA  74

Query  204  VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             PPYG+T+F +PTGR SDGRL++DFIAQ
Sbjct  75   RPPYGQTYFGYPTGRCSDGRLVVDFIAQ  102



>ref|NP_001132231.1| uncharacterized protein LOC100193666 precursor [Zea mays]
 gb|ACF80999.1| unknown [Zea mays]
Length=376

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  24   GFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSS  203
            G + G+A  + C VL VF      A G Y+A+ SFGDS+ D GNL+ +       ++ ++
Sbjct  5    GGAAGSA-RWVCAVLSVFPLLAAAAQGRYRAVFSFGDSLVDAGNLVTEG---IPDYLATA  60

Query  204  VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             PPYG+T+F +PTGR SDGRL++DFIAQ
Sbjct  61   RPPYGQTYFGYPTGRCSDGRLVVDFIAQ  88



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A  CY +I  FGDS+TDTGNL+H     +K  +    PPYGET+FHHPTGR SDGRL+ID
Sbjct  23   ATSCYTSIFGFGDSLTDTGNLVHFYPNGNKPHM--YFPPYGETYFHHPTGRCSDGRLLID  80

Query  276  FIAQ  287
             IAQ
Sbjct  81   LIAQ  84



>gb|EYU28061.1| hypothetical protein MIMGU_mgv11b014990mg [Erythranthe guttata]
Length=451

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY++I+SFGDS+ DTGN++  S    K      +PPYG TFFH PTGR+SDGRL+IDFI
Sbjct  30   GCYESIISFGDSLADTGNVLLLSPSDKK--PHGGLPPYGRTFFHRPTGRFSDGRLVIDFI  87

Query  282  AQ  287
            AQ
Sbjct  88   AQ  89



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +3

Query  84   TGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGR  263
            T H A  CY +I SFGDS+ DTGNL+H    + K  +     PYGET+F  PTGR+SDGR
Sbjct  25   TSHAAITCYTSIFSFGDSLADTGNLLHD---VGKNNIHVGRLPYGETYFRRPTGRFSDGR  81

Query  264  LIIDFIAQS  290
            L++DF+AQ+
Sbjct  82   LVVDFLAQA  90



>ref|XP_010499707.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYGETFFHHPTGR+SDG LIIDFIA+
Sbjct  36   FESIISFGDSIADTGNLLGLSD--RNNLPMSAFPPYGETFFHHPTGRFSDGHLIIDFIAE  93



>ref|NP_174186.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q3E7I6.1|GDL11_ARATH RecName: Full=GDSL esterase/lipase At1g28650; AltName: Full=Extracellular 
lipase At1g28650; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE31009.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 8/91 (9%)
 Frame = +3

Query  15   LIMGFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFV  194
            LI+ F L   I YY  ++V   ++       YK+I+SFGDS+ DTGN +H S V      
Sbjct  10   LIVSFLL---ILYYTTIVV---ASSESRCRRYKSIISFGDSIADTGNYVHLSNV--NNLP  61

Query  195  KSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++  PYGE+FFH P+GRYSDGRL+IDFIA+
Sbjct  62   QAAFLPYGESFFHPPSGRYSDGRLVIDFIAE  92



>ref|XP_009102894.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
Length=397

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   VVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGR  248
            +V  S  H     +K+I+SFGDS  DTGNLI  S         ++ PPYGETFFHHPTGR
Sbjct  25   IVVNSETHCRN--FKSIISFGDSTADTGNLIGLSD--PDDLPAAAFPPYGETFFHHPTGR  80

Query  249  YSDGRLIIDFIAQ  287
            +S+GRLIIDFIA+
Sbjct  81   FSNGRLIIDFIAE  93



>emb|CDY15657.1| BnaA07g08280D [Brassica napus]
Length=397

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   VVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGR  248
            +V  S  H     +K+I+SFGDS  DTGNLI  S         ++ PPYGETFFHHPTGR
Sbjct  25   IVVNSETHCRN--FKSIISFGDSTADTGNLIGLSD--PDDLPAAAFPPYGETFFHHPTGR  80

Query  249  YSDGRLIIDFIAQ  287
            +S+GRLIIDFIA+
Sbjct  81   FSNGRLIIDFIAE  93



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+TDTGNL+  S   +     S+ PPYGETFFH PTGR+S+GRLIIDFIA+
Sbjct  36   FKSIISFGDSITDTGNLLGLSD--ADNLPHSAFPPYGETFFHFPTGRFSNGRLIIDFIAE  93



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHP  239
            ++ +V   + H    CY +I SFGDS+ DTGN++  S   S G V  S  PYGET+FH P
Sbjct  11   VITIVLLLSVHRVTSCYSSIFSFGDSLADTGNIL-ASDGDSAGAV--SRLPYGETYFHRP  67

Query  240  TGRYSDGRLIIDFIAQS  290
            TGRYSDGRLIIDFIAQ+
Sbjct  68   TGRYSDGRLIIDFIAQA  84



>gb|EAY75193.1| hypothetical protein OsI_03085 [Oryza sativa Indica Group]
Length=379

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = +3

Query  24   GFSLGTAIT-YYCIVLVVFESTG-HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVK  197
            GF    A+   YC  LVV    G     GCY  I SFGDS+TDTGN +     L+ G   
Sbjct  7    GFGFSPAVAALYCAALVVAGGLGSRPVLGCYSRIFSFGDSLTDTGNYVR----LTAGRKP  62

Query  198  SS---VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            SS    PPYG TFF  PTGR SDGRL+IDFIAQ
Sbjct  63   SSPYGAPPYGRTFFGRPTGRASDGRLVIDFIAQ  95



>gb|EAZ12915.1| hypothetical protein OsJ_02838 [Oryza sativa Japonica Group]
Length=307

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = +3

Query  24   GFSLGTAIT-YYCIVLVVFESTG-HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVK  197
            GF    A+   YC  LVV    G     GCY  I SFGDS+TDTGN +     L+ G   
Sbjct  7    GFGFSPAVAALYCAALVVAGGLGSRPVLGCYSRIFSFGDSLTDTGNYVR----LTAGRKP  62

Query  198  SS---VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            SS    PPYG TFF  PTGR SDGRL+IDFIAQ
Sbjct  63   SSPYGAPPYGRTFFGRPTGRASDGRLVIDFIAQ  95



>gb|KCW45468.1| hypothetical protein EUGRSUZ_L00817 [Eucalyptus grandis]
Length=398

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  81   STGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDG  260
            S+   A GCY +I+SFGDS+ DTGN +H S+   +     S+P YGET+F  PTGR+SDG
Sbjct  29   SSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLP-YGETYFRRPTGRFSDG  87

Query  261  RLIIDFIAQ  287
            RL+IDFIA+
Sbjct  88   RLVIDFIAE  96



>gb|EMT29920.1| GDSL esterase/lipase [Aegilops tauschii]
Length=98

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +3

Query  27   FSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSV  206
            FSL  A+ +  +VL +   +G  A  CY  I SFGDS+TDTGN +   ++ +K       
Sbjct  8    FSLALAVWHALLVLGL--GSGSSALSCYSRIFSFGDSLTDTGNYV---RLTAKNPSPYGA  62

Query  207  PPYGETFFHHPTGRYSDGRLIIDFIA  284
            PPYG TFF  PTGR SDGRL+IDFIA
Sbjct  63   PPYGTTFFGRPTGRASDGRLVIDFIA  88



>ref|NP_973930.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30995.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=317

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 6/79 (8%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            ++ +C+  V  E   H     +K+I+SFGDS+ DTGNL+  S        K +  PYGET
Sbjct  15   LSTFCLTTVNSEPQCH----NFKSIISFGDSIADTGNLLALSD--PTNLPKVAFLPYGET  68

Query  225  FFHHPTGRYSDGRLIIDFI  281
            FFHHPTGR+S+GRLIIDFI
Sbjct  69   FFHHPTGRFSNGRLIIDFI  87



>dbj|BAF02148.1| putative lipase [Arabidopsis thaliana]
Length=353

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YK+I+SFGDS+ DTGN +H S V      +++  PYGE+FFH P+GRYSDGRL+IDFIA+
Sbjct  3    YKSIISFGDSIADTGNYVHLSNV--NNLPQAAFLPYGESFFHPPSGRYSDGRLVIDFIAE  60



>ref|XP_010057069.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Eucalyptus grandis]
 gb|KCW74053.1| hypothetical protein EUGRSUZ_E02673 [Eucalyptus grandis]
Length=400

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  81   STGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDG  260
            S+   A GCY +I+SFGDS+ DTGN +H S+   +     S+P YGET+F  PTGR+SDG
Sbjct  31   SSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLP-YGETYFRRPTGRFSDG  89

Query  261  RLIIDFIAQ  287
            RL+IDFIA+
Sbjct  90   RLVIDFIAE  98



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S    K     + PPYGE FFHHPTGR+S+GRLIIDFIA+
Sbjct  35   FKSIISFGDSIADTGNLLGLSD--PKDLPHMAFPPYGENFFHHPTGRFSNGRLIIDFIAE  92



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         +  PPYGETFFHHPTGR SDGRLIIDFIA+
Sbjct  36   FQSIISFGDSIADTGNLLGLSD--RNNLSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAE  93



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S          + PPYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  35   FRSIISFGDSIADTGNLLGLSD--PNDLPHMAFPPYGETFFHHPTGRFSNGRLIIDFIAE  92



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +3

Query  63   VLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPT  242
            V+ V       A GC+ AI SFGDS+ DTGN +     L      S  PPYG TFF  PT
Sbjct  16   VIAVLPGARRPASGCFTAIFSFGDSIADTGNAVR----LGSLGASSGSPPYGRTFFDRPT  71

Query  243  GRYSDGRLIIDFIAQ  287
            GR+SDGR+IIDFIAQ
Sbjct  72   GRFSDGRVIIDFIAQ  86



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 12/89 (13%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLI---HKSKVLSKGFVKS  200
            SL  +  +  I +V  ES        +++I+SFGDS+ DTGNL+    ++ +   GF   
Sbjct  14   SLSFSTLFIMITMVNTESQRQN----FQSIISFGDSIADTGNLLGLSDRNNLSLNGF---  66

Query  201  SVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
              PPYGETFFHHPTGR SDGRLIIDFIA+
Sbjct  67   --PPYGETFFHHPTGRSSDGRLIIDFIAE  93



>ref|XP_009109702.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X3 [Brassica 
rapa]
Length=387

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +3

Query  66   LVVFESTGHVAGG-----CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFF  230
            L++F ST  V         YK+I+SFGDS  DTGN +H S V      +++ PPYGETFF
Sbjct  13   LLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLSDVNHP--PQAAFPPYGETFF  70

Query  231  HHPTGRYSDGRLIIDFIAQ  287
            H PTGR SDGRLIIDFIA+
Sbjct  71   HTPTGRNSDGRLIIDFIAE  89



>ref|XP_009109701.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X2 [Brassica 
rapa]
Length=387

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +3

Query  66   LVVFESTGHVAGG-----CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFF  230
            L++F ST  V         YK+I+SFGDS  DTGN +H S V      +++ PPYGETFF
Sbjct  13   LLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLSDVNHP--PQAAFPPYGETFF  70

Query  231  HHPTGRYSDGRLIIDFIAQ  287
            H PTGR SDGRLIIDFIA+
Sbjct  71   HTPTGRNSDGRLIIDFIAE  89



>ref|XP_011096420.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g27360-like 
[Sesamum indicum]
Length=408

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +3

Query  54   YCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFH  233
            Y I+ ++  ST   A  C+++I+SFGDS+ DTGN    S      +   + PPYG TFFH
Sbjct  29   YAIISILVASTAASASQCFESIISFGDSLADTGNFFLLSPPNKPPYC--ARPPYGRTFFH  86

Query  234  HPTGRYSDGRLIIDFIAQS  290
             PTGR SDGRL+IDFIA++
Sbjct  87   LPTGRSSDGRLVIDFIAEA  105



>ref|XP_009109700.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X1 [Brassica 
rapa]
Length=390

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +3

Query  66   LVVFESTGHVAGG-----CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFF  230
            L++F ST  V         YK+I+SFGDS  DTGN +H S V      +++ PPYGETFF
Sbjct  13   LLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLSDVNHP--PQAAFPPYGETFF  70

Query  231  HHPTGRYSDGRLIIDFIAQ  287
            H PTGR SDGRLIIDFIA+
Sbjct  71   HTPTGRNSDGRLIIDFIAE  89



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 12/89 (13%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLI---HKSKVLSKGFVKS  200
            SL  +  +  I +V  ES        +++I+SFGDS+ DTGNL+    ++ +   GF   
Sbjct  14   SLSFSTLFIMITMVNTESQRQN----FQSIISFGDSIADTGNLLGLSDRNNLSLNGF---  66

Query  201  SVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
              PPYGETFFHHPTGR SDGRLIIDFIA+
Sbjct  67   --PPYGETFFHHPTGRSSDGRLIIDFIAE  93



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY +I+SFGDS+ DTGN ++ S        +    PYGET+FH PTGR+SDGRLIIDFIA
Sbjct  31   CYTSIISFGDSLADTGNFLYSSNNSPGAIARL---PYGETYFHRPTGRFSDGRLIIDFIA  87

Query  285  Q  287
            Q
Sbjct  88   Q  88



>sp|P0C8Z7.1|GDL91_ARATH RecName: Full=GDSL esterase/lipase At1g28640; AltName: Full=Extracellular 
lipase At1g28640; Flags: Precursor [Arabidopsis 
thaliana]
Length=390

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ +  +LV++ +T  VA     C  +K+I+SFGDS+ DTGN +H S V   
Sbjct  1    MASSLEKLISSF--LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLSDV--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +S+  PYGE+FFH P+GRYSDGRLIIDFIA+
Sbjct  57   HLPQSAFLPYGESFFHPPSGRYSDGRLIIDFIAE  90



>ref|XP_007037866.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY22367.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=381

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    S     GFV  S PPYG TFFHHPT RYSDGRL+IDF+AQ
Sbjct  37   FKKIYAFGDSFTDTGNT--GSLTGPTGFVHVSNPPYGTTFFHHPTNRYSDGRLVIDFVAQ  94

Query  288  S  290
            S
Sbjct  95   S  95



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 6/83 (7%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYG  218
            ++++   L+V  +T +    C  +K+I+SFGDS+ DTGNL+  S          + PPYG
Sbjct  10   VSFFLFTLLV--TTVYSESQCRNFKSIISFGDSIADTGNLVGLSD--PNDLPHVAFPPYG  65

Query  219  ETFFHHPTGRYSDGRLIIDFIAQ  287
            ETFFHHPTGR+S+GRL+IDF+A+
Sbjct  66   ETFFHHPTGRFSNGRLVIDFMAE  88


 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = +3

Query  168  SKVLSKG--FVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            S++ +KG     ++ PPYGETFFH+PTGR+S+GRLIIDFIA+
Sbjct  376  SEIKNKGNELPPAAFPPYGETFFHNPTGRFSNGRLIIDFIAE  417



>ref|XP_010912621.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Elaeis guineensis]
Length=175

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY +I SFGDS+TDTGN ++ +    +  +     PYG+T+FHHPTGR+SDGR+IIDFIA
Sbjct  30   CYTSIFSFGDSITDTGNFLNYTNCGPEARL-----PYGKTYFHHPTGRFSDGRIIIDFIA  84

Query  285  QS  290
            Q+
Sbjct  85   QA  86



>ref|NP_174185.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31008.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ +  +LV++ +T  VA     C  +K+I+SFGDS+ DTGN +H S V   
Sbjct  1    MASSLEKLISSF--LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLSDV--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +S+  PYGE+FFH P+GRYSDGRLIIDFIA+
Sbjct  57   HLPQSAFLPYGESFFHPPSGRYSDGRLIIDFIAE  90



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFFHHPTGR+S+GRLIIDFIA
Sbjct  53   FKSIISFGDSIADTGNLLGLSD--PNELPHVAFPPYGETFFHHPTGRFSNGRLIIDFIA  109



>ref|XP_002456059.1| hypothetical protein SORBIDRAFT_03g029650 [Sorghum bicolor]
 gb|EES01179.1| hypothetical protein SORBIDRAFT_03g029650 [Sorghum bicolor]
Length=391

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +3

Query  69   VVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGR  248
            V+  S   V  GCY  I SFGDS+TDTGN +H +      +     PPYG TFF  PTGR
Sbjct  32   VIGSSGSPVLAGCYTRIFSFGDSLTDTGNYVHLTATSHSPY---GAPPYGRTFFGKPTGR  88

Query  249  YSDGRLIIDFIAQ  287
             SDGRL+IDFIA+
Sbjct  89   ASDGRLVIDFIAE  101



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY +I+SFGDS+ DTGN ++ S        +    PYGET+FH PTGR+SDGRLIIDFIA
Sbjct  31   CYTSIISFGDSLADTGNFLYSSNNSPGAIARL---PYGETYFHRPTGRFSDGRLIIDFIA  87

Query  285  Q  287
            Q
Sbjct  88   Q  88



>ref|XP_002461107.1| hypothetical protein SORBIDRAFT_02g040890 [Sorghum bicolor]
 gb|EER97628.1| hypothetical protein SORBIDRAFT_02g040890 [Sorghum bicolor]
Length=395

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 4/63 (6%)
 Frame = +3

Query  99   GGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDF  278
            GGCY    +FGDS+ DTGN IH S   + G V  S  PYGETFFH PTGR+SDGRLI+DF
Sbjct  38   GGCYSHFFAFGDSLIDTGNFIHYST--APGPVAHS--PYGETFFHRPTGRWSDGRLIVDF  93

Query  279  IAQ  287
            I +
Sbjct  94   IVE  96



>ref|XP_008777732.1| PREDICTED: GDSL esterase/lipase At1g28570-like, partial [Phoenix 
dactylifera]
Length=251

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +3

Query  93   VAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLII  272
             A  CY +I SFGDS+ DTGN +H +    +  +     PYGET+F HPTGR+SDGRLII
Sbjct  75   AATSCYTSIFSFGDSLADTGNFLHYANQGPEARL-----PYGETYFQHPTGRFSDGRLII  129

Query  273  DFIAQS  290
            DFIAQ+
Sbjct  130  DFIAQA  135



>gb|AAF24544.2|AC007508_7 F1K23.13 [Arabidopsis thaliana]
Length=1411

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 65/97 (67%), Gaps = 9/97 (9%)
 Frame = +3

Query  12    VLIMGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKV  176
             +L M  SL   I+ +  +LV++ +T  VA     C  +K+I+SFGDS+ DTGN +H S V
Sbjct  1019  ILPMASSLEKLISSF--LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLSDV  1076

Query  177   LSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
                   +S+  PYGE+FFH P+GRYSDGRLIIDFIA+
Sbjct  1077  --NHLPQSAFLPYGESFFHPPSGRYSDGRLIIDFIAE  1111


 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YK+I+SFGDS+ DTGN +H S V      +++  PYGE+FFH P+GRYSDGRL+IDFIA+
Sbjct  683  YKSIISFGDSIADTGNYVHLSNV--NNLPQAAFLPYGESFFHPPSGRYSDGRLVIDFIAE  740


 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ +  +LV++ +T  VA     C  +K+I+SFGDS+ DTGN +H S V   
Sbjct  1    MASSLKKLISSF--LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLSDV--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +S+  PYGE+FFH P+GR S+GRLIIDFIA+
Sbjct  57   HLPQSAFLPYGESFFHPPSGRASNGRLIIDFIAE  90


 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = +3

Query  141  TDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +DTGN++H S V      +++  PYGE+FFH P+GR SDGRLIIDFIA+
Sbjct  379  SDTGNILHLSDV--NHLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAE  425



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  442  FKSIISFGDSLADTGNLLGLSD--PNELPHVAFPPYGETFFHHPTGRFSNGRLIIDFIAE  499


 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DT NL+  S         S+ PPYGE+F +HPTGR+SDGRLIIDFIA+
Sbjct  34   FRSIISFGDSIADTENLLSLSD--PNDLPGSAFPPYGESFLNHPTGRFSDGRLIIDFIAE  91



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S  PPYGETFFH PTGR+SDGRLIIDFIA+
Sbjct  35   FESIISFGDSIGDTGNLLGLSDD-PNNLALSGYPPYGETFFHQPTGRFSDGRLIIDFIAE  93



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFFHHPTGR+S+GRLIIDF+A+
Sbjct  444  FKSIISFGDSIADTGNLLGLSD--PNELPHVAFPPYGETFFHHPTGRFSNGRLIIDFLAE  501


 Score = 76.6 bits (187),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S         S+ PPYG++F +HPTGR+SDGRLIIDFIA+
Sbjct  34   FRSIISFGDSIADTGNLL--SLADPSDLPGSAFPPYGKSFLNHPTGRFSDGRLIIDFIAE  91



>ref|XP_006651412.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Oryza brachyantha]
Length=375

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 5/65 (8%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
             G CY ++ SFGDS+TDTGN +            ++ PPYGETFF HPTGRYSDGRL++D
Sbjct  25   GGYCYTSMFSFGDSITDTGNQVSFFPT-----APAASPPYGETFFGHPTGRYSDGRLVVD  79

Query  276  FIAQS  290
            F+A++
Sbjct  80   FLAEA  84



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY +I+SFGDS+ DTGN ++ S        +    PYGET+FH PTGR+SDGRLIIDFIA
Sbjct  31   CYTSIISFGDSLADTGNFLYSSNNSPGAIARL---PYGETYFHRPTGRFSDGRLIIDFIA  87

Query  285  Q  287
            Q
Sbjct  88   Q  88



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            ++ I+SFGDS+ DTGNLI  S        +S+ PPYGETFFH+P+GR+SDGRL+IDFIA+
Sbjct  31   FEWIISFGDSLADTGNLIGLST--PNDLPESAFPPYGETFFHYPSGRFSDGRLVIDFIAE  88



>emb|CDP22023.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 11/79 (14%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKS--KVLSKGFVKSSVPPYGETFFH  233
            I+L++ +S    A GCY +I +FGDS+TD GNL+  S  +++ +G +     P GET+FH
Sbjct  12   ILLIIAQS----AEGCYTSIFAFGDSLTDNGNLLALSAPRIIHQGRL-----PNGETYFH  62

Query  234  HPTGRYSDGRLIIDFIAQS  290
            HPTGR  DGRLI+DF+AQ 
Sbjct  63   HPTGRCCDGRLIVDFLAQQ  81



>ref|XP_009352806.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Pyrus x bretschneideri]
Length=373

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A  CY +I+ FGDS+ DTGN+   +    KG      PPYGET+FHHPTGR  DGRLIID
Sbjct  16   ANCCYTSIIGFGDSLADTGNIYVDALDHHKGPYHFFFPPYGETYFHHPTGRCCDGRLIID  75

Query  276  FIAQS  290
             IA+S
Sbjct  76   LIAES  80



>gb|KEH36573.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=342

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A  CY +I SFGDS+TDTGNL   S+  S   +   +PPYG+T FHHP GR SDGRLI+D
Sbjct  25   ATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCL---LPPYGKTHFHHPNGRCSDGRLIVD  81

Query  276  FIAQ  287
            FIA+
Sbjct  82   FIAE  85



>ref|NP_001043731.1| Os01g0651300 [Oryza sativa Japonica Group]
 dbj|BAD68803.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05645.1| Os01g0651300 [Oryza sativa Japonica Group]
 dbj|BAG99213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=178

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 53/92 (58%), Gaps = 9/92 (10%)
 Frame = +3

Query  24   GFSLGTAITYYCIVLVVFESTG-HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKS  200
            GFS   A   YC  LVV    G     GCY  I SFGDS+TDTGN +     L+ G   S
Sbjct  9    GFSPAVA-ALYCAALVVAGGLGSRPVLGCYSRIFSFGDSLTDTGNYVR----LTAGRKPS  63

Query  201  S---VPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            S    PPYG TFF  PTGR SDGRL+IDFI +
Sbjct  64   SPYGAPPYGRTFFGRPTGRASDGRLVIDFIGE  95



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = +3

Query  87   GHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRL  266
            G     CY  I SFGDS+ DTGNLI   +V      ++  PPYG T+FH PTGR+SDGRL
Sbjct  18   GSSTTACYSTIFSFGDSLADTGNLI---RVPGHADCQAGRPPYGMTYFHSPTGRFSDGRL  74

Query  267  IIDFIAQS  290
            I+D+IA++
Sbjct  75   IVDYIAEA  82



>ref|XP_009382515.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 4/61 (7%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            Y AI SFGDS+ DTGNL       S G  +++ PPYGET+FH P GRYSDGR+I+DFIAQ
Sbjct  31   YSAIFSFGDSLADTGNL----AFFSGGKDQANRPPYGETYFHRPNGRYSDGRIILDFIAQ  86

Query  288  S  290
            +
Sbjct  87   T  87



>gb|ADN33970.1| lipase [Cucumis melo subsp. melo]
Length=354

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 51/87 (59%), Gaps = 10/87 (11%)
 Frame = +3

Query  54   YC----IVLVVFESTGHVA----GGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVP  209
            YC    I+L  F S    A       +  I +FGDS TDTGN   +S     GF   S P
Sbjct  7    YCSAIFILLFAFASASPTAIETHPRLFNKIYAFGDSFTDTGNT--RSASGPAGFGHVSDP  64

Query  210  PYGETFFHHPTGRYSDGRLIIDFIAQS  290
            PYG TFFHHPT RYSDGRL+IDF+AQS
Sbjct  65   PYGSTFFHHPTNRYSDGRLVIDFVAQS  91



>ref|XP_010480704.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Camelina sativa]
Length=352

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S         S+ PPYGE+F  HPTGR+SDGRLIIDFIA+
Sbjct  34   FKSIISFGDSIADTGNLL--SLADPNDLPGSAFPPYGESFLKHPTGRFSDGRLIIDFIAE  91



>ref|XP_010455497.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 8/63 (13%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLI---HKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDF  278
            ++ I+SFGDS+ DTGNL+    ++ +   GF     PPYGETFFHHPTGR SDGRLIIDF
Sbjct  36   FEYIISFGDSIADTGNLLCLSDRNNLSLNGF-----PPYGETFFHHPTGRSSDGRLIIDF  90

Query  279  IAQ  287
            IA+
Sbjct  91   IAE  93



>ref|XP_008812182.1| PREDICTED: GDSL esterase/lipase At1g28570-like, partial [Phoenix 
dactylifera]
Length=319

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY +I SFGDS+ DTGN +H +    +  +     PYGET+F HPTGR+SDGRLIIDFIA
Sbjct  31   CYTSIFSFGDSLADTGNFLHYANQGPEARL-----PYGETYFQHPTGRFSDGRLIIDFIA  85

Query  285  QS  290
            Q+
Sbjct  86   QA  87



>ref|XP_002305753.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
 gb|EEE86264.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
Length=424

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 10/97 (10%)
 Frame = +3

Query  15   LIMGFSLGTAITYYCIVLVVFE----STGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLS  182
            +++ FS+    +++   + +F     ST     GCY +I SFGDS+ DTGN    S+ LS
Sbjct  39   ILIQFSMAPYSSHFLWNMFLFNVLILSTVSCTTGCYTSIFSFGDSLADTGN----SRNLS  94

Query  183  --KGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
                    S  PYGETFFHHPTGR SDGRL+IDFIA+
Sbjct  95   PPDNLPHYSFLPYGETFFHHPTGRCSDGRLVIDFIAE  131



>ref|XP_008364168.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Malus domestica]
Length=311

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 45/70 (64%), Gaps = 10/70 (14%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGN-----LIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDG  260
            A GCY +I+ FGDS+ DTGN     L H  K     F     PPYGE FFHHPTGR  DG
Sbjct  26   ALGCYTSIIGFGDSLADTGNSYLNALDHHDKPFHFFF-----PPYGEDFFHHPTGRCCDG  80

Query  261  RLIIDFIAQS  290
            RLIIDFIA+S
Sbjct  81   RLIIDFIAES  90



>ref|XP_010040115.1| PREDICTED: uncharacterized protein LOC104428890 [Eucalyptus grandis]
Length=814

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  81   STGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDG  260
            S+   A GCY +I+SFGDS+ DTGN +H S+   +     S+P YGET+F  PTGR+SDG
Sbjct  29   SSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLP-YGETYFRRPTGRFSDG  87

Query  261  RLIIDFIAQ  287
            RL+IDFIA+
Sbjct  88   RLVIDFIAE  96


 Score = 77.4 bits (189),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY++I+SFGDS+ DTGN +H ++   +     S+P YG+T F  PTGR+SDGRL+IDF+
Sbjct  441  GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLP-YGQTHFRRPTGRFSDGRLVIDFV  499

Query  282  AQ  287
            A+
Sbjct  500  AE  501



>ref|XP_002893540.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1392

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = +3

Query  51   YYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPY  215
            Y   +L+++ +T  VA     C  YK+I+SFGDS+ DTGN +  S V  K   +++  PY
Sbjct  662  YVSFLLILYSTTIVVASSESRCRRYKSIISFGDSIADTGNYLRLSNV--KNLPQAAFLPY  719

Query  216  GETFFHHPTGRYSDGRLIIDFIAQ  287
            GE+FFH P+GRYSDGRL+IDFIA+
Sbjct  720  GESFFHPPSGRYSDGRLVIDFIAE  743


 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKGFV  194
            M +SL   I+ + +VL            C  +K+I+SFGDS+ DTGN +H S V      
Sbjct  384  MAYSLKKLISSFLLVLYSTIIVASSESRCRRFKSIISFGDSIADTGNYLHLSDV--NHLP  441

Query  195  KSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++  PYGE+FFH P+GR SDGRLIIDFIA+
Sbjct  442  QTAFFPYGESFFHPPSGRASDGRLIIDFIAE  472


 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 8/93 (9%)
 Frame = +3

Query  9    KVLIMGFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKG  188
            K LI  F L   + YY  ++V   ++       +K+I+SFGDS+ DTGN +H S V    
Sbjct  6    KKLISSFLL---VLYYTTIIV---ASSESRCRRFKSIISFGDSIADTGNYLHLSDV--NH  57

Query  189  FVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
              +++  PYGE+FFH P+GR SDGRLIIDFIA+
Sbjct  58   LPQTAFLPYGESFFHLPSGRASDGRLIIDFIAE  90


 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +3

Query  123   SFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
             +FGDS  DTGN +H S V      +S+  PYGETFFH P+GRYSDGRLIIDFIA+
Sbjct  1040  NFGDSSADTGNYLHLSDV--NHLPQSAFLPYGETFFHPPSGRYSDGRLIIDFIAE  1092



>gb|KJB62810.1| hypothetical protein B456_009G437600 [Gossypium raimondii]
Length=391

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GC+ +I SFGDS+TDTGNL   S   SK       PPYG TFF +PTGR SDGRL+IDFI
Sbjct  32   GCFTSIFSFGDSLTDTGNLHQLSLSESKKLSHFDFPPYGRTFFGYPTGRCSDGRLVIDFI  91

Query  282  AQ  287
            A+
Sbjct  92   AE  93



>ref|XP_008439284.1| PREDICTED: GDSL esterase/lipase At3g48460 [Cucumis melo]
Length=378

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 51/87 (59%), Gaps = 10/87 (11%)
 Frame = +3

Query  54   YC----IVLVVFESTGHVA----GGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVP  209
            YC    I+L  F S    A       +  I +FGDS TDTGN   +S     GF   S P
Sbjct  7    YCSAIFILLFAFASASPTAIETHPRLFNKIYAFGDSFTDTGNT--RSASGPAGFGHVSDP  64

Query  210  PYGETFFHHPTGRYSDGRLIIDFIAQS  290
            PYG TFFHHPT RYSDGRL+IDF+AQS
Sbjct  65   PYGSTFFHHPTNRYSDGRLVIDFVAQS  91



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFFHHPTGR+S+GR+IIDFIA+
Sbjct  32   FKSIISFGDSIADTGNLLGLSD--PNNLPHFAFPPYGETFFHHPTGRFSNGRVIIDFIAE  89


 Score = 77.0 bits (188),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDSV DTGN +  S          + PPYGETFFHH TGR+S+GRLIIDFIA+
Sbjct  456  FKSIISFGDSVADTGNFLGLSD--RNNLPHFAFPPYGETFFHHATGRFSNGRLIIDFIAE  513



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 8/63 (13%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLI---HKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDF  278
            ++ I+SFGDS+ DTGNL+    ++ +   GF     PPYGETFFHHPTGR SDGRLIIDF
Sbjct  36   FEYIISFGDSIADTGNLLCLSDRNNLSLNGF-----PPYGETFFHHPTGRSSDGRLIIDF  90

Query  279  IAQ  287
            IA+
Sbjct  91   IAE  93



>ref|XP_006844514.1| hypothetical protein AMTR_s00016p00146420, partial [Amborella 
trichopoda]
 gb|ERN06189.1| hypothetical protein AMTR_s00016p00146420, partial [Amborella 
trichopoda]
Length=150

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 53/96 (55%), Gaps = 21/96 (22%)
 Frame = +3

Query  15   LIMGFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFV  194
            LI GFSL     Y C+     ES        Y A+ SFGDS+ DTGN++           
Sbjct  8    LIFGFSL-----YSCLFAAEAESNTS----SYAALFSFGDSLADTGNMLS--------LQ  50

Query  195  KSSVP----PYGETFFHHPTGRYSDGRLIIDFIAQS  290
              S P    PYGETFFH PTGR+SDGRL++DF AQ+
Sbjct  51   GQSSPIGRLPYGETFFHRPTGRFSDGRLVVDFFAQA  86



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YK+I+SFGDS+ DTGN +  S V      +++  PYGETFFH P+GRYSDGRLIIDFIA+
Sbjct  33   YKSIISFGDSIADTGNYLRLSDV--NHLPQAAFLPYGETFFHPPSGRYSDGRLIIDFIAE  90



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 59/94 (63%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVL-----VVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ + +VL     +V  S  H     +K+I+SFGDS+ DTGN +H S +   
Sbjct  1    MASSLRKLISSFVLVLYSTTIIVVSSESHCRR--FKSIISFGDSIADTGNYLHLSDI--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +++  PYGE+FFH PTGR SDGRLIIDFIA+
Sbjct  57   HLPQTAFLPYGESFFHPPTGRASDGRLIIDFIAE  90



>ref|XP_004248142.1| PREDICTED: GDSL esterase/lipase At1g28610 [Solanum lycopersicum]
Length=388

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +3

Query  42   AITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGE  221
            A   + ++L   E    ++  C+ +I+SFGDS+TDTGN  + ++  +     + +P YGE
Sbjct  9    AFIIFLVLLNSIEGQRLISLRCFNSIISFGDSLTDTGNEFYLTRYRNPSPYFARLP-YGE  67

Query  222  TFFHHPTGRYSDGRLIIDFIAQS  290
            TFFH PTGR+S+GRLIIDFIA+S
Sbjct  68   TFFHRPTGRFSNGRLIIDFIAES  90



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGN +  S          + PPYGETFFHHPTGR+S+GR+IIDFIA+
Sbjct  35   FKSIISFGDSIADTGNFLGLSD--PNNLPHFAFPPYGETFFHHPTGRFSNGRVIIDFIAE  92



>emb|CDM83767.1| unnamed protein product [Triticum aestivum]
Length=344

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGN-LIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            CYK + SFGDS+TDTGN +IH S   + G V +   PYGETFF HPTGR+SDGRLIIDFI
Sbjct  37   CYKRLFSFGDSLTDTGNYIIHYSN--ASGPVLAL--PYGETFFGHPTGRWSDGRLIIDFI  92

Query  282  AQ  287
             +
Sbjct  93   VE  94



>ref|XP_004134933.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
 ref|XP_004155633.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=397

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVV---FESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGF  191
            M  SL   +  + I+  V   F  + +V   C+ +I +FGDS++DTGNL       S   
Sbjct  1    MDSSLILCLNRWFIIFFVATPFSPSTNVLANCFNSIFNFGDSLSDTGNLFINCN--SNNP  58

Query  192  VKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQS  290
                  PYG+TFFH PTGR+SDGRLIIDFIAQS
Sbjct  59   PNFCFTPYGDTFFHRPTGRFSDGRLIIDFIAQS  91



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +3

Query  93   VAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLII  272
             A  CY +I SFGDS+TDTGNL   S+  S   +   +PPYG+T FHHP GR SDGRLI+
Sbjct  24   AATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCL---LPPYGKTHFHHPNGRCSDGRLIV  80

Query  273  DFIAQ  287
            DFIA+
Sbjct  81   DFIAE  85



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +3

Query  93   VAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLII  272
             A  CY +I SFGDS+TDTGNL   S+  S   +   +PPYG+T FHHP GR SDGRLI+
Sbjct  24   AATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCL---LPPYGKTHFHHPNGRCSDGRLIV  80

Query  273  DFIAQ  287
            DFIA+
Sbjct  81   DFIAE  85



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YK+I+SFGDS+ DTGN +  S V      +++  PYGETFFH P+GRYSDGRLIIDFIA+
Sbjct  33   YKSIISFGDSIADTGNYLRLSDV--NHLPQAAFLPYGETFFHPPSGRYSDGRLIIDFIAE  90



>ref|XP_004152509.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Cucumis sativus]
 ref|XP_004157767.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Cucumis sativus]
 gb|KGN64371.1| hypothetical protein Csa_1G050100 [Cucumis sativus]
Length=406

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 58/104 (56%), Gaps = 11/104 (11%)
 Frame = +3

Query  3    KNKVLIMGFSLGTAITYYC----IVLVVFESTGHVAGGC----YKAIVSFGDSVTDTGNL  158
            K++V      +   +TY C    I+L  F S    A       +  I +FGDS TDTGN 
Sbjct  21   KSRVKQKNLEMMVTLTY-CSAIFILLFAFASASPTATETHPRLFNKIYAFGDSFTDTGNT  79

Query  159  IHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQS  290
              +S     GF   S PPYG TFFHHPT RYSDGRL+IDF+AQS
Sbjct  80   --RSVSGPSGFGHVSNPPYGSTFFHHPTNRYSDGRLVIDFVAQS  121



>ref|NP_001031103.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31000.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=298

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S         ++ PPYGETFFHHPTGR  DGR+I+DFIA+
Sbjct  29   FKSIISFGDSIADTGNLVGLSD--RNQLPVTAFPPYGETFFHHPTGRSCDGRIIMDFIAE  86



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFFH PTGR+S+GRLIIDFIA+
Sbjct  35   FKSIISFGDSIADTGNLLGLSG--PNELPHVAFPPYGETFFHRPTGRFSNGRLIIDFIAE  92



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGN +  S          + PPYGETFFHHPTGR+S+GR+IIDFIA+
Sbjct  35   FKSIISFGDSIADTGNFLGLSD--PNNLPHFAFPPYGETFFHHPTGRFSNGRVIIDFIAE  92



>ref|XP_007214461.1| hypothetical protein PRUPE_ppa023988mg [Prunus persica]
 gb|EMJ15660.1| hypothetical protein PRUPE_ppa023988mg [Prunus persica]
Length=458

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            C+ +++SFGDS+TDTGNL + S   S  F     PPYGET+FHHP G   DGRL+IDFIA
Sbjct  155  CFNSVISFGDSLTDTGNLYYSSPNKSLNFF---YPPYGETYFHHPMGGCLDGRLVIDFIA  211

Query  285  QS  290
            +S
Sbjct  212  ES  213


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 3/50 (6%)
 Frame = +3

Query  90   HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHP  239
            H  G C+ +I SF DS+ DTGNL   S      F     PPYGET+FHHP
Sbjct  23   HALGDCFSSIFSFRDSLADTGNLYISSHDKPFHFF---FPPYGETYFHHP  69



>gb|EAZ27028.1| hypothetical protein OsJ_10957 [Oryza sativa Japonica Group]
Length=392

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY  + SFGDS+TDTGN +            ++ PPYGETFF HPTGRYSDGRL++DF+A
Sbjct  47   CYTRMFSFGDSITDTGNQVSFFPT-----APAARPPYGETFFGHPTGRYSDGRLVVDFLA  101

Query  285  QS  290
            ++
Sbjct  102  EA  103



>gb|EAZ04881.1| hypothetical protein OsI_27063 [Oryza sativa Indica Group]
Length=391

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            +GGCY  + +FG+S+ DTGN IH S   S G V  S  PYGETFF  PTGR+SDGRLI+D
Sbjct  42   SGGCYSHLFTFGNSLIDTGNFIHYST--SPGPVARS--PYGETFFRRPTGRWSDGRLIVD  97

Query  276  FIAQ  287
            FI +
Sbjct  98   FIVE  101



>ref|NP_001060434.1| Os07g0642200 [Oryza sativa Japonica Group]
 dbj|BAC16480.1| lipase-like protein [Oryza sativa Japonica Group]
 dbj|BAD30249.1| lipase-like protein [Oryza sativa Japonica Group]
 dbj|BAF22348.1| Os07g0642200 [Oryza sativa Japonica Group]
 dbj|BAG86694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            +GGCY  + +FG+S+ DTGN IH S   S G V  S  PYGETFF  PTGR+SDGRLI+D
Sbjct  42   SGGCYSHLFTFGNSLIDTGNFIHYST--SPGPVARS--PYGETFFRRPTGRWSDGRLIVD  97

Query  276  FIAQ  287
            FI +
Sbjct  98   FIVE  101



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +3

Query  111  KAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            ++I+SFGDS  DTGNL+  S        + ++PPYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  463  RSIISFGDSTADTGNLLGLSD--PNDHPQVALPPYGETFFHHPTGRFSNGRLIIDFIAE  519


 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDSV+DTGN +  S          +  PYGETFFHHPTGR+S+GRLIIDFIA+
Sbjct  34   FKSIISFGDSVSDTGNFLGLSD--PNNLPHFAFLPYGETFFHHPTGRFSNGRLIIDFIAE  91



>emb|CDY43308.1| BnaC03g58800D [Brassica napus]
Length=399

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YK+I+SF DS  DTGN +H S V      +++ PPYGETFFH PTGR SDGRLIIDFIA+
Sbjct  32   YKSIISFSDSGADTGNYLHLSDVNHP--PQAAFPPYGETFFHAPTGRNSDGRLIIDFIAE  89



>gb|EAY90132.1| hypothetical protein OsI_11698 [Oryza sativa Indica Group]
Length=391

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY  + SFGDS+TDTGN +            ++ PPYGETFF HPTGRYSDGRL++DF+A
Sbjct  46   CYTRMFSFGDSITDTGNQVSFFPT-----APAARPPYGETFFGHPTGRYSDGRLVVDFLA  100

Query  285  QS  290
            ++
Sbjct  101  EA  102



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            I  Y    + F S       CYK+I  FGDS+TD GNL+H      K  +    PPYG+T
Sbjct  13   IIIYFFTCIFFASAKIATSNCYKSIFGFGDSLTDAGNLVHLYPPGRKPHM--YFPPYGKT  70

Query  225  FFHHPTGRYSDGRLIIDFIAQ  287
            +F+ PTGR SDGRL+ID IAQ
Sbjct  71   YFNRPTGRCSDGRLLIDLIAQ  91



>gb|KJB62806.1| hypothetical protein B456_009G437200 [Gossypium raimondii]
Length=399

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  99   GGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDF  278
             GC+ +I SFGDS+TDTGNL+  S   S     S+  PYG TFFH PTGR+ DGRL+IDF
Sbjct  31   NGCFTSIFSFGDSLTDTGNLLELSISESTKPPHSAFLPYGCTFFHRPTGRFCDGRLVIDF  90

Query  279  IAQS  290
            +A++
Sbjct  91   LAEA  94



>gb|KJB62808.1| hypothetical protein B456_009G437400 [Gossypium raimondii]
Length=343

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHP  239
            ++  V  S      GC+ +I SFGDS++DTGN I  S + +      + PP G TFFH P
Sbjct  21   LLFAVISSISSPVNGCFTSIFSFGDSMSDTGNSIEISVLETGKLPHGAFPPNGCTFFHRP  80

Query  240  TGRYSDGRLIIDFIAQS  290
            TGR+ DGRL+IDF+A++
Sbjct  81   TGRFCDGRLVIDFLAEA  97



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 52/78 (67%), Gaps = 6/78 (8%)
 Frame = +3

Query  66   LVVFESTGHVAGGC---YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHH  236
            LV   +T   AG C   Y +I SFGDS+TDTGNL   S  LS   +   +PP+G+T FHH
Sbjct  4    LVFLVTTLVFAGTCRAYYTSIFSFGDSLTDTGNLNFISPPLSPDCM---LPPFGQTHFHH  60

Query  237  PTGRYSDGRLIIDFIAQS  290
            P GR SDGRLIIDFIA+S
Sbjct  61   PNGRCSDGRLIIDFIAES  78



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFH  233
            ++LV+  S       C  Y +I SFGDS+ DTGNL   S+  S        PPYG+T+FH
Sbjct  27   LLLVITVSAPLFTAACSSYSSIFSFGDSIADTGNLYLSSQPPSD---HCFFPPYGQTYFH  83

Query  234  HPTGRYSDGRLIIDFIAQS  290
            HP+GR SDGRLIIDFIA+S
Sbjct  84   HPSGRCSDGRLIIDFIAES  102



>ref|NP_001151904.1| alpha-L-fucosidase 2 precursor [Zea mays]
 ref|XP_008673014.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Zea mays]
 gb|ACF88251.1| unknown [Zea mays]
 gb|ACG44875.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACR36958.1| unknown [Zea mays]
 tpg|DAA58327.1| TPA: alpha-L-fucosidase 2 [Zea mays]
Length=377

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY  I SFGDS+TDTGN +H   + +        PPYG TFF  PTGR SDGRL+IDFI
Sbjct  32   GCYTRIFSFGDSLTDTGNYVH---LTASSHSPYGAPPYGRTFFGKPTGRASDGRLVIDFI  88

Query  282  AQ  287
            A+
Sbjct  89   AE  90



>ref|XP_002511260.1| Esterase precursor, putative [Ricinus communis]
 gb|EEF51862.1| Esterase precursor, putative [Ricinus communis]
Length=387

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    S     G+   S PPYG TFFHHP+ RYSDGRL+IDF+A+
Sbjct  39   FKKIYAFGDSFTDTGNTRSVSGPTPSGYGHVSNPPYGSTFFHHPSNRYSDGRLMIDFVAE  98

Query  288  S  290
            +
Sbjct  99   T  99



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY +I SFGDS+ DTGNL++     +    +    PYGET+FH PTGR+SDGRLIIDFIA
Sbjct  31   CYTSIFSFGDSLADTGNLLYSPSNNAGAIARL---PYGETYFHRPTGRFSDGRLIIDFIA  87

Query  285  Q  287
            Q
Sbjct  88   Q  88



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S         ++ PPYGETFFHHPTGR  DGR+I+DFIA+
Sbjct  29   FKSIISFGDSIADTGNLVGLSD--RNQLPVTAFPPYGETFFHHPTGRSCDGRIIMDFIAE  86



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S         ++ PPYGETFFHHPTGR  DGR+I+DFIA+
Sbjct  29   FKSIISFGDSIADTGNLVGLSD--RNQLPVTAFPPYGETFFHHPTGRSCDGRIIMDFIAE  86



>ref|XP_009791093.1| PREDICTED: GDSL esterase/lipase At3g48460 [Nicotiana sylvestris]
Length=381

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    +   S  +V S  PPYG TFFHHPT RYSDGRL+IDF+A+
Sbjct  38   FKKIYAFGDSYTDTGNTHSATGPSSFNYVSS--PPYGRTFFHHPTNRYSDGRLVIDFVAE  95

Query  288  S  290
            S
Sbjct  96   S  96



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +3

Query  90   HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLI  269
            H   G Y A+ SFGDS+ DTGNL+         F++ + PP+GETFFH PTGR SDGRL+
Sbjct  28   HSKKGNYSALFSFGDSLADTGNLLLSGH---SPFIRIAHPPFGETFFHKPTGRCSDGRLV  84

Query  270  IDFIAQS  290
            +DF+A++
Sbjct  85   VDFVAEA  91



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHP  239
            I+LV  ES        +K+I+SFGDS+ DTGN +H S V      +++  PYGE+FFH P
Sbjct  21   IILVSSESRCRR----FKSIISFGDSIADTGNYLHLSDV--NHLPQTAFLPYGESFFHPP  74

Query  240  TGRYSDGRLIIDFIAQ  287
            TGR SDGRLIIDFIA+
Sbjct  75   TGRASDGRLIIDFIAE  90



>ref|XP_004296391.1| PREDICTED: GDSL esterase/lipase At5g45910 [Fragaria vesca subsp. 
vesca]
Length=366

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +3

Query  51   YYCIVLVVFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGET  224
            ++ +  + F + G V+ G   Y+AI +FGDS++DTGN +    + S+   K    PYGET
Sbjct  4    FFLLATLCFFTLGRVSSGLPKYEAIFNFGDSLSDTGNFLLSDPLASQVIAKL---PYGET  60

Query  225  FFHHPTGRYSDGRLIIDFIAQS  290
            FFHH TGR SDGRLI+DFIA++
Sbjct  61   FFHHATGRSSDGRLIVDFIAEA  82



>ref|XP_009411653.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=367

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 4/66 (6%)
 Frame = +3

Query  93   VAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLII  272
            V    Y AI  FG+S+TDTGNL       S G V +S  PYGET+F HP+GR+SDGRL+I
Sbjct  19   VRSSSYPAIFGFGNSLTDTGNL----DFFSGGTVAASRLPYGETYFGHPSGRFSDGRLVI  74

Query  273  DFIAQS  290
            DFIAQ+
Sbjct  75   DFIAQA  80



>dbj|BAC41872.1| unknown protein [Arabidopsis thaliana]
Length=245

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ +  +LV++ +T  VA     C  + +I+SFGDS+ DTGN++H S V   
Sbjct  1    MASSLKKLISSF--LLVLYSTTIIVASSESRCRRFTSIISFGDSIADTGNILHLSDV--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +++  PYGE+FFH P+GR SDGRLIIDFIA+
Sbjct  57   HLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAE  90



>ref|XP_009353234.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Pyrus x bretschneideri]
Length=368

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 44/70 (63%), Gaps = 10/70 (14%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGN-----LIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDG  260
            A GCY +I+ FGDS  DTGN     L H  +     F     PPYGE FFHHPTGR  DG
Sbjct  26   ALGCYTSIIGFGDSTADTGNSYLNALYHHDEPFHFFF-----PPYGEDFFHHPTGRCCDG  80

Query  261  RLIIDFIAQS  290
            RLIIDFIA+S
Sbjct  81   RLIIDFIAES  90



>ref|XP_010499397.1| PREDICTED: GDSL esterase/lipase At1g28670 [Camelina sativa]
Length=389

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGN +H S V      +++  PYGE+FFH PTGR SDGRLIIDFIA+
Sbjct  33   FKSIISFGDSIADTGNYLHLSDV--NHLPQTAFLPYGESFFHPPTGRASDGRLIIDFIAE  90



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            C  +I SFGDS+ DTGN ++ S+   +   +    PYGET+FH PTGRY+DGRLIIDFIA
Sbjct  31   CCTSIFSFGDSLADTGNFLYSSRDNPRAIARL---PYGETYFHRPTGRYTDGRLIIDFIA  87

Query  285  Q  287
            Q
Sbjct  88   Q  88



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 49/75 (65%), Gaps = 6/75 (8%)
 Frame = +3

Query  69   VVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLS--KGFVKSSVPPYGETFFHHPT  242
            V+  ST     GCY +I SFGDS+ DTGN    S+ LS        S  PYGETFFHHPT
Sbjct  17   VLILSTISCTIGCYTSIFSFGDSLADTGN----SRNLSPPDNLPHFSFLPYGETFFHHPT  72

Query  243  GRYSDGRLIIDFIAQ  287
            GR SDGRL+IDFIA+
Sbjct  73   GRCSDGRLVIDFIAE  87



>gb|KCW45467.1| hypothetical protein EUGRSUZ_L00816 [Eucalyptus grandis]
Length=402

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY++I+SFGDS+ DTGN +H ++   +     S+P YG+T F  PTGR+SDGRL+IDF+
Sbjct  29   GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLP-YGQTHFRRPTGRFSDGRLVIDFV  87

Query  282  AQ  287
            A+
Sbjct  88   AE  89



>ref|XP_007209226.1| hypothetical protein PRUPE_ppa006897mg [Prunus persica]
 gb|EMJ10425.1| hypothetical protein PRUPE_ppa006897mg [Prunus persica]
Length=391

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN   +S     GF   S PPYG TFFH PT RYSDGRL+IDFIA+
Sbjct  45   FKKIYAFGDSFTDTGNT--RSATGPSGFGHVSNPPYGTTFFHRPTNRYSDGRLVIDFIAE  102

Query  288  S  290
            S
Sbjct  103  S  103



>ref|XP_010057068.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Eucalyptus grandis]
 gb|KCW74054.1| hypothetical protein EUGRSUZ_E02674 [Eucalyptus grandis]
Length=402

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY++I+SFGDS+ DTGN +H ++   +     S+P YG+T F  PTGR+SDGRL+IDF+
Sbjct  29   GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLP-YGQTHFRRPTGRFSDGRLVIDFV  87

Query  282  AQ  287
            A+
Sbjct  88   AE  89



>dbj|BAK04206.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 11/90 (12%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKS  200
            MG  +  A+ +   V+++    G  + GC+K I +FGDS+ DTGN    S  +       
Sbjct  1    MGSIISMALLFVFGVMLLNADVG--SCGCFKRIFAFGDSIIDTGNFRTGSMWM-------  51

Query  201  SVPPYGETFFHHPTGRYSDGRLIIDFIAQS  290
              PPYG T+FHHPTGR SDGRLIIDF AQ+
Sbjct  52   --PPYGGTYFHHPTGRCSDGRLIIDFYAQA  79



>ref|XP_006658887.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=385

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY  + +FG+S+ DTGN IH S   + G V  ++ PYGETFFH PTGR+SDGRLI+DFI
Sbjct  37   GCYSHLFTFGNSLIDTGNFIHYST--APGPV--ALSPYGETFFHRPTGRWSDGRLIVDFI  92

Query  282  AQ  287
             +
Sbjct  93   VE  94



>ref|XP_008239404.1| PREDICTED: GDSL esterase/lipase At3g48460 [Prunus mume]
Length=391

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN   KS     GF   S PPYG TFFH PT RYSDGRL+IDFIA+
Sbjct  45   FKKIYAFGDSFTDTGNT--KSATGPSGFGHVSNPPYGITFFHRPTNRYSDGRLVIDFIAE  102

Query  288  S  290
            S
Sbjct  103  S  103



>ref|XP_006351456.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Solanum tuberosum]
Length=381

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    +   S  +V  S PPYG TFFHHPT RYSDGRL+IDF+A+
Sbjct  38   FKKIYAFGDSYTDTGNTHSATGPSSFNYV--SNPPYGNTFFHHPTNRYSDGRLVIDFVAE  95

Query  288  S  290
            S
Sbjct  96   S  96



>ref|XP_009596313.1| PREDICTED: GDSL esterase/lipase At3g48460 [Nicotiana tomentosiformis]
Length=381

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    +   S  +V  S PPYG TFFHHPT RYSDGRL+IDF+A+
Sbjct  38   FKKIYAFGDSYTDTGNTHSATGPSSFNYV--SNPPYGRTFFHHPTNRYSDGRLVIDFVAE  95

Query  288  S  290
            S
Sbjct  96   S  96



>ref|XP_010026792.1| PREDICTED: GDSL esterase/lipase At3g48460 [Eucalyptus grandis]
 gb|KCW83214.1| hypothetical protein EUGRSUZ_B00158 [Eucalyptus grandis]
Length=389

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    S     G V S  PPYG TFFH PT RYSDGRL+IDF+AQ
Sbjct  43   FKKIYAFGDSFTDTGNTHSDSGPSGYGHVSS--PPYGVTFFHRPTNRYSDGRLVIDFVAQ  100

Query  288  S  290
            S
Sbjct  101  S  101



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFF+H TGR+S+GRLIIDFIA+
Sbjct  30   FKSIISFGDSIADTGNLLGLSD--PNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAE  87



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFGDS+ DTGNL+  S          + PPYGETFFHHPTGR  DGR+IIDFIA+
Sbjct  43   FESIISFGDSIADTGNLVALSD--HNHLPGPAFPPYGETFFHHPTGRSCDGRIIIDFIAE  100



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGN IH S  ++    +++  PYGETFF  P+GRYSDGRLIIDFIA+
Sbjct  34   FKSIISFGDSIADTGNYIHLSSDVNHP-PQAAFLPYGETFFRSPSGRYSDGRLIIDFIAE  92



>ref|XP_004236316.1| PREDICTED: GDSL esterase/lipase At3g48460 [Solanum lycopersicum]
Length=381

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN    +   S  +V  S PPYG TFFHHPT RYSDGRL+IDF+A+
Sbjct  38   FKKIYAFGDSYTDTGNTHSATGPSSFNYV--SNPPYGNTFFHHPTNRYSDGRLVIDFVAE  95

Query  288  S  290
            S
Sbjct  96   S  96



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  66   LVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTG  245
            +VVF S   +A   YK+I SFGDS  DTGNL   S   S        PPYG+TFFH  TG
Sbjct  16   VVVFSSATILAACPYKSIFSFGDSFADTGNLYFSSHPPSH---HCFFPPYGQTFFHRVTG  72

Query  246  RYSDGRLIIDFIAQS  290
            R SDGRLIIDFIA+S
Sbjct  73   RCSDGRLIIDFIAES  87



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YK+I+SFGDS+ DTGN +  S V      +++  PYGETFF  P+GRYSDGRLIIDFIA+
Sbjct  33   YKSIISFGDSIADTGNYLRLSDV--NHLPQAAFLPYGETFFQPPSGRYSDGRLIIDFIAE  90



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY AI SFGDS+ DTGN +H S   S    +    PYGET+FH  TGR+SDGRLIIDFIA
Sbjct  46   CYTAIFSFGDSLADTGNFLHYSGNNSGPVAQL---PYGETYFHRATGRFSDGRLIIDFIA  102

Query  285  QS  290
            Q+
Sbjct  103  QA  104



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +3

Query  33   LGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPP  212
            LGT +       ++  +       C+ +I SFGDS+ DTGNL+H    L       +  P
Sbjct  20   LGTHLVTLYDTSILRSTFAATTASCFASIFSFGDSLADTGNLLH---YLGDDAGALAQLP  76

Query  213  YGETFFHHPTGRYSDGRLIIDFIAQS  290
            YGET+FHH TGR SDGRLIIDFIAQ+
Sbjct  77   YGETYFHHATGRLSDGRLIIDFIAQA  102



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS  DTGNL+  S          + PPYGETFFHHPTGR+S+GR+IIDF+A+
Sbjct  37   FKSIISFGDSHADTGNLLGLSD--PNNLPHFAFPPYGETFFHHPTGRFSNGRVIIDFMAE  94



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++I+SFG+S+ DTGNL+  S         S  PPYGETFFH PTGR+SDGRLIIDFI +
Sbjct  35   FESIISFGNSIGDTGNLLGLSDD-PNNLALSGYPPYGETFFHQPTGRFSDGRLIIDFITE  93



>ref|XP_004980345.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Setaria italica]
Length=370

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 55/95 (58%), Gaps = 14/95 (15%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFES-TGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVK  197
            M  SL   + ++ +V+  + + +   A  CYK + S GDS+TD GNL           V 
Sbjct  1    MASSLMLVLPFFLLVVCPYAAASARQAPCCYKRLFSLGDSITDAGNL---------AIVA  51

Query  198  SSVP----PYGETFFHHPTGRYSDGRLIIDFIAQS  290
             ++P    PYGETFFH P GR+ DGRLI+DFIA++
Sbjct  52   PNIPAMAFPYGETFFHRPNGRFCDGRLIVDFIAEA  86



>dbj|BAD44794.1| lipase-like [Oryza sativa Japonica Group]
 gb|EAZ35697.1| hypothetical protein OsJ_19986 [Oryza sativa Japonica Group]
Length=181

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YKA+ SFGDS+TDTGN+      +++  +  + PPYG TFF HPT R SDGRL++DF+A+
Sbjct  42   YKAMFSFGDSLTDTGNICVNMSAVNRTELTMAQPPYGITFFGHPTCRCSDGRLVVDFLAE  101



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFF+H TGR+S+GRLIIDFIA+
Sbjct  30   FKSIISFGDSIADTGNLLGLSD--PNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAE  87



>ref|NP_564313.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAK50088.1|AF372948_1 At1g28610/F1K23_5 [Arabidopsis thaliana]
 gb|AAM91420.1| At1g28610/F1K23_5 [Arabidopsis thaliana]
 gb|AEE31001.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=250

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVP  209
            SL + ++++   L V   +        ++I+SFGDS+TDTGNL+  S         ++  
Sbjct  3    SLDSLVSFFLSTLFVTIVSSQTQCRNLESIISFGDSITDTGNLVGLSD--RNHLPVTAFL  60

Query  210  PYGETFFHHPTGRYSDGRLIIDFIAQ  287
            PYGETFFHHPTGR  +GR+IIDFIA+
Sbjct  61   PYGETFFHHPTGRSCNGRIIIDFIAE  86



>ref|XP_010912585.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=396

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A  CY +I+SFGDS+ DTGN +     L +     + PPYG T+F  PTGR+SDGR+IID
Sbjct  37   ATSCYNSIISFGDSIADTGNYL---VALGEKAGPVAHPPYGNTYFRRPTGRFSDGRVIID  93

Query  276  FIAQS  290
            FIAQ+
Sbjct  94   FIAQA  98



>ref|XP_009414901.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 9/79 (11%)
 Frame = +3

Query  60   IVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSV--PPYGETFFH  233
            IV+++  +  H  G C+ A+ SFGDS+ DTGN ++        +  +SV  PP+G T+FH
Sbjct  11   IVILLLLNIHHANGSCFPAMFSFGDSLQDTGNFVNT-------YANTSVSKPPWGLTYFH  63

Query  234  HPTGRYSDGRLIIDFIAQS  290
              TGR+S+GRLI+DFIAQ+
Sbjct  64   RATGRFSNGRLILDFIAQA  82



>gb|EMT29449.1| GDSL esterase/lipase [Aegilops tauschii]
Length=317

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 13/66 (20%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGN-LIHKSKVLSKGFVKSSVP----PYGETFFHHPTGRYSDGRLI  269
            CYK + SFGDS+TDTGN +IH        +  +S P    PYGETFF  PTGR+SDGRLI
Sbjct  37   CYKRLFSFGDSLTDTGNYIIH--------YANASGPVLALPYGETFFGRPTGRWSDGRLI  88

Query  270  IDFIAQ  287
            IDFI +
Sbjct  89   IDFIVE  94



>ref|XP_008439761.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=384

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GCY +I +FGDS++DTGNL +     +   V     PYGETFFH PTGR+SDGRL++DF+
Sbjct  22   GCYTSIFNFGDSLSDTGNLYYTCSFPNPPNV--CFFPYGETFFHRPTGRFSDGRLVLDFL  79

Query  282  AQS  290
            A S
Sbjct  80   AMS  82



>gb|EYU40122.1| hypothetical protein MIMGU_mgv1a007918mg [Erythranthe guttata]
Length=391

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +3

Query  57   CIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHH  236
            C+V    +ST H     ++++ +FGDS TDTGN   +S     GF+  S  PYG TFF  
Sbjct  26   CLVCAADQSTIHRPIRPFRSVYAFGDSYTDTGNT--RSDSGPSGFMFVSNLPYGRTFFRR  83

Query  237  PTGRYSDGRLIIDFIAQS  290
            PT RYSDGRL+IDF+AQ+
Sbjct  84   PTNRYSDGRLVIDFVAQT  101



>ref|XP_003566943.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=365

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GC+K I SFGDS+ DTGN  H +       ++    PYG TFFHHPTGR SDGR+I+DF 
Sbjct  23   GCFKRIFSFGDSIIDTGNFAHAAGNNPGPIIEW---PYGMTFFHHPTGRVSDGRVIVDFY  79

Query  282  AQS  290
             Q+
Sbjct  80   VQA  82



>ref|XP_007020866.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12391.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=789

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GC+ +I SFGDS+TDTGNL+  S + S        PPYG TFFH PTGR SDGRL+IDF+
Sbjct  61   GCFTSIFSFGDSLTDTGNLLQLSLLESSKLSHFDFPPYGRTFFHSPTGRCSDGRLVIDFV  120

Query  282  AQ  287
            A+
Sbjct  121  AE  122


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = +3

Query  45   ITYYCIVLVVFESTG----HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPP  212
            I   C+ L +FE       H A   + A      +  +T  ++ +S  L +    S+ PP
Sbjct  406  INSLCLPLTLFEQGKELLIHFAIDIHHACKRGATTPRNTRGVLFESSKLPQ----SAFPP  461

Query  213  YGETFFHHPTGRYSDGRLIIDFIAQ  287
            YG TFFHHPTGR SDGRL+IDFIA+
Sbjct  462  YGRTFFHHPTGRCSDGRLVIDFIAE  486



>ref|XP_002463272.1| hypothetical protein SORBIDRAFT_02g040950 [Sorghum bicolor]
 gb|EER99793.1| hypothetical protein SORBIDRAFT_02g040950 [Sorghum bicolor]
Length=390

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            Y    +FGDS+TDTGN IH S   + G V  S  PYGETFFH PTGR+SDGRLI+DFI +
Sbjct  39   YSHFFAFGDSLTDTGNFIHYST--APGPVAHS--PYGETFFHRPTGRWSDGRLIVDFIVE  94



>ref|XP_009411652.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 4/61 (7%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            Y AI  FG+S+TDTGNL+      S G   +S  PYGET+F HP+GR+SDGRL+IDFIAQ
Sbjct  61   YPAIFGFGNSLTDTGNLV----FFSGGTEAASGLPYGETYFGHPSGRFSDGRLVIDFIAQ  116

Query  288  S  290
            +
Sbjct  117  A  117



>ref|XP_006440021.1| hypothetical protein CICLE_v10020570mg [Citrus clementina]
 gb|ESR53261.1| hypothetical protein CICLE_v10020570mg [Citrus clementina]
Length=384

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +  I +FGDS TDTGN   K+     GF   S  PYG T+FHHPT RYSDGRL+IDF+ Q
Sbjct  38   FNKIYAFGDSFTDTGNT--KTATGPSGFGHVSTSPYGSTYFHHPTNRYSDGRLVIDFVTQ  95

Query  288  S  290
            S
Sbjct  96   S  96



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = +3

Query  45   ITYYCIVLVVFESTGHVAGGC-YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGE  221
            +T   + LV+  S   +   C Y +I SFGDS+ DTGNL       +   +    PPYGE
Sbjct  12   VTITTVALVIASSAPLLLAACPYTSIFSFGDSLADTGNLYFSPYPPTNHCL---FPPYGE  68

Query  222  TFFHHPTGRYSDGRLIIDFIAQS  290
            TFFHH TGR SDGRLIIDFIA+S
Sbjct  69   TFFHHVTGRCSDGRLIIDFIAES  91



>emb|CDO96752.1| unnamed protein product [Coffea canephora]
Length=385

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +3

Query  51   YYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFF  230
            Y CI+L +       A  CY ++ SFGDS++D GNL+  S   S   +    PP GET+F
Sbjct  5    YLCIILFILMIVSQSASECYTSMFSFGDSLSDNGNLLGFS---SPKTIHQGRPPNGETYF  61

Query  231  HHPTGRYSDGRLIIDFIAQS  290
              PTGR  DGRLI+D IAQ+
Sbjct  62   GQPTGRCCDGRLIVDMIAQN  81



>gb|ACU19966.1| unknown [Glycine max]
Length=224

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY ++ SFGDS+TDTGNL   S   S   +   +PPYG+T FH P GR SDGRLI+DF+A
Sbjct  34   CYTSLFSFGDSLTDTGNLYFISPRQSPDCL---LPPYGQTHFHRPNGRCSDGRLILDFLA  90

Query  285  QS  290
            +S
Sbjct  91   ES  92



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFGDS+ DTGNL+  S          + PPYGETFF HPTGR+S+GRLIIDFI +
Sbjct  36   FKSIISFGDSIADTGNLLGLSD--PNHLPHVAFPPYGETFFQHPTGRFSNGRLIIDFIVR  93



>ref|XP_006476962.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Citrus sinensis]
 gb|KDO69353.1| hypothetical protein CISIN_1g016679mg [Citrus sinensis]
Length=384

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +  I +FGDS TDTGN   K+     GF   S  PYG T+FHHPT RYSDGRL+IDF+ Q
Sbjct  38   FNKIYAFGDSFTDTGNT--KTATGPSGFGHVSTSPYGSTYFHHPTNRYSDGRLVIDFVTQ  95

Query  288  S  290
            S
Sbjct  96   S  96



>ref|XP_002442352.1| hypothetical protein SORBIDRAFT_08g018740 [Sorghum bicolor]
 gb|EES16190.1| hypothetical protein SORBIDRAFT_08g018740 [Sorghum bicolor]
Length=361

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CYK I SFGD   DTGN +H   ++ K   K    PYG TFF HPTGR SDGR++IDF A
Sbjct  30   CYKRIFSFGDDSMDTGNFVH---LIGKNASKYKEAPYGNTFFRHPTGRMSDGRVLIDFYA  86

Query  285  QS  290
            Q+
Sbjct  87   QA  88



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ +  +LV++ +T  VA     C  +K+I+SFGDS+ DTGN +H S V   
Sbjct  1    MASSLKKLISSF--LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLSDV--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +S+  PYGE+FFH P+GR S+GRLIIDFIA+
Sbjct  57   HLPQSAFLPYGESFFHPPSGRASNGRLIIDFIAE  90



>gb|EMT30305.1| GDSL esterase/lipase [Aegilops tauschii]
Length=429

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GC+K I +FGDS+TD GN  +  +  +K     SVPPYGET+FH PTGR  DGRLI+DF 
Sbjct  31   GCFKRIFTFGDSITDAGNFAYTGRN-NKNPGPPSVPPYGETYFHRPTGRAYDGRLIVDFY  89

Query  282  AQS  290
             ++
Sbjct  90   VRA  92



>ref|XP_002456055.1| hypothetical protein SORBIDRAFT_03g029610 [Sorghum bicolor]
 gb|EES01175.1| hypothetical protein SORBIDRAFT_03g029610 [Sorghum bicolor]
Length=365

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 11/94 (12%)
 Frame = +3

Query  18   IMGFSLG-TAITYYCIVLVVFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKG  188
            +MGFS    +I+ +  ++ V       AG C  YK I SFGDS+ DTGN      ++   
Sbjct  1    MMGFSCQHRSISLHIFLISVVLLLNAPAGRCGSYKRIFSFGDSLIDTGNYARSGPIMEY-  59

Query  189  FVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQS  290
                   PYG T+FHHPTGR SDGR++IDF AQ+
Sbjct  60   -------PYGMTYFHHPTGRISDGRVVIDFYAQA  86



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  66   LVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTG  245
            +VVF S   +A   YK+I SFGDS  DTGNL   S   S        PPYG+TFFH  TG
Sbjct  16   VVVFSSATILAACPYKSIFSFGDSFADTGNLYFSSHPPSH---HCFFPPYGQTFFHRVTG  72

Query  246  RYSDGRLIIDFIAQS  290
            R SDGRLIIDFIA+S
Sbjct  73   RCSDGRLIIDFIAES  87


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 5/67 (7%)
 Frame = +3

Query  90   HVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLI  269
            H+    Y+ I    DS+TDTGNL   S   S   +   +PPYG+T FH P GR SDGRLI
Sbjct  340  HLTEAAYRIIAQ--DSLTDTGNLYFISPRQSPDCL---LPPYGQTHFHRPNGRCSDGRLI  394

Query  270  IDFIAQS  290
            +DF+A+S
Sbjct  395  LDFLAES  401



>gb|EMT20589.1| GDSL esterase/lipase [Aegilops tauschii]
Length=341

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +3

Query  30   SLGTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVP  209
            S+  A+ +   VL++    G    GC+K I SFGDS+TDTGN  + S+    G       
Sbjct  9    SISLAVIFVFAVLLLNADIGSC--GCFKRIFSFGDSITDTGNFAYISRNSPPGPPSVPP-  65

Query  210  PYGETFFHHPTGRYSDGRLIIDFIAQS  290
             YGET+FH PTGR SDGRLIIDF AQ+
Sbjct  66   -YGETYFHRPTGRASDGRLIIDFYAQA  91



>ref|XP_003559896.2| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=387

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CYK + SFGDS+ DTGN I  S   + G V  S  PYGETFF  PTGR+SDGRLI+DFI 
Sbjct  43   CYKRLFSFGDSLIDTGNFIQYST--APGPVTRS--PYGETFFGRPTGRWSDGRLIVDFIV  98

Query  285  Q  287
            +
Sbjct  99   E  99



>ref|XP_010101939.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB90587.1| GDSL esterase/lipase [Morus notabilis]
Length=384

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN   +S     GF   S PPYG TFFH PT RYSDGRL+IDF+AQ
Sbjct  40   FKKIYAFGDSFTDTGNT--RSVSGPSGFGHVSNPPYGITFFHRPTNRYSDGRLVIDFVAQ  97

Query  288  S  290
            S
Sbjct  98   S  98



>ref|XP_004983111.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=395

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            Y  + SFGDS+TDTGN +H S     G   +S PPYGETFF  PTGR SDGRL++DFI +
Sbjct  37   YDRVFSFGDSLTDTGNALHLS---PSGGGPASRPPYGETFFRRPTGRASDGRLVVDFIVE  93

Query  288  S  290
            +
Sbjct  94   A  94



>dbj|BAJ88861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = +3

Query  36   GTAITYYCIVLVVFESTGHVAGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPY  215
            G  +    +++V   +    + G ++ + +FGDS+TDTGN    +   S G   +S PPY
Sbjct  9    GRLLPVVTLIVVSVAAAAPSSPGPFRTLYAFGDSLTDTGNTHSTTGPYSFG---ASHPPY  65

Query  216  GETFFHHPTGRYSDGRLIIDFIA  284
            G TFFHHPT RYSDGRL++DF+A
Sbjct  66   GATFFHHPTNRYSDGRLVVDFLA  88



>ref|XP_009411654.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 4/64 (6%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            +GGCY AI SFGDS+ DTGN I    +       +  PPYG TFF+ PTGR+SDGRLI+D
Sbjct  27   SGGCYSAIFSFGDSLADTGNAIRLGGLGGP----TGTPPYGRTFFNRPTGRFSDGRLIVD  82

Query  276  FIAQ  287
            FIAQ
Sbjct  83   FIAQ  86



>gb|EMT30303.1| GDSL esterase/lipase [Aegilops tauschii]
Length=359

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 13/65 (20%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSV--PPYGETFFHHPTGRYSDGRLIID  275
            GC+K I +FGDS+ DTGN           F   S+  PPYG T+FHHPTGR SDGRLI+D
Sbjct  26   GCFKRIFAFGDSIIDTGN-----------FRSGSIWGPPYGGTYFHHPTGRCSDGRLIVD  74

Query  276  FIAQS  290
            F AQ+
Sbjct  75   FYAQA  79



>ref|XP_009414900.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 8/67 (12%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVP--PYGETFFHHPTGRYSDGRLI  269
            A GCY +I SFGDS+ DTGN I+       G +  SV   PYG+T+F H TGR+SDGRLI
Sbjct  29   AVGCYTSIFSFGDSIADTGNAINS------GIIVESVRHLPYGQTYFGHATGRFSDGRLI  82

Query  270  IDFIAQS  290
            +DFIA++
Sbjct  83   VDFIAEA  89



>ref|XP_007148067.1| hypothetical protein PHAVU_006G177800g [Phaseolus vulgaris]
 gb|ESW20061.1| hypothetical protein PHAVU_006G177800g [Phaseolus vulgaris]
Length=317

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            + +I SFGDS+TDTGN    S   +  F     PPYG+TFFHH TGR SDGRLIIDFIA+
Sbjct  44   FTSIFSFGDSLTDTGNRYLASHSPNHCFF----PPYGQTFFHHVTGRCSDGRLIIDFIAE  99

Query  288  S  290
            S
Sbjct  100  S  100



>gb|EEE65824.1| hypothetical protein OsJ_21563 [Oryza sativa Japonica Group]
Length=411

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = +3

Query  96   AGGCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIID  275
            A G Y+A+ +FGDS+ D GNL+         ++ ++ PPYG+T+F +PTGR SDGRL++D
Sbjct  29   AAGKYRAVFNFGDSLVDAGNLVTDG---IPDYLATARPPYGQTYFGYPTGRCSDGRLVVD  85

Query  276  FIAQ  287
            FIAQ
Sbjct  86   FIAQ  89



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            C  +I SFGDS+ DTGNL+H     +  F      PYGET+FH+ TGR+SDGRLIIDFIA
Sbjct  44   CLTSIFSFGDSLADTGNLLHYLGDDAGPFAHL---PYGETYFHNATGRFSDGRLIIDFIA  100

Query  285  QS  290
            QS
Sbjct  101  QS  102



>emb|CDP15060.1| unnamed protein product [Coffea canephora]
Length=384

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I +FGDS TDTGN    S      ++  S  PYG+TFFHHPT RYSDGRL+IDF+AQ
Sbjct  38   FKSIYAFGDSYTDTGNT--NSATGPNPYLYVSRSPYGQTFFHHPTNRYSDGRLVIDFLAQ  95

Query  288  S  290
             
Sbjct  96   Q  96



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKGFV  194
            M  SL   IT + +              C  YK+I+SFGDS+ DTGN +H S V      
Sbjct  1    MASSLKKLITSFLLFFFYTNIVASSEPSCRRYKSIISFGDSIADTGNYLHLSDVNHP--P  58

Query  195  KSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++  PYGETFF  PTGR SDGRLIIDFIA+
Sbjct  59   QAAFLPYGETFFSVPTGRNSDGRLIIDFIAE  89



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGGC--YKAIVSFGDSVTDTGNLIHKSKVLSKGFV  194
            M  SL   IT + +              C  YK+I+SFGDS+ DTGN +H S V      
Sbjct  1    MASSLKKLITSFLLFFFYTNIVASSEPSCRRYKSIISFGDSIADTGNYLHLSDVNHP--P  58

Query  195  KSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +++  PYGETFF  PTGR SDGRLIIDFIA+
Sbjct  59   QAAFLPYGETFFSVPTGRNSDGRLIIDFIAE  89



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            CY ++ SFGDS+ DTGNL+   + L K  +     PYGET+F  PTGR+ DGRL++DFIA
Sbjct  72   CYTSVFSFGDSLADTGNLL---RYLGKKNIDVGRLPYGETYFRRPTGRFCDGRLVVDFIA  128

Query  285  QS  290
            Q+
Sbjct  129  QA  130



>ref|NP_564314.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FPE4.1|GDL12_ARATH RecName: Full=GDSL esterase/lipase At1g28660; AltName: Full=Extracellular 
lipase At1g28660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG42007.1|AF327417_1 unknown protein [Arabidopsis thaliana]
 gb|AAN71956.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31011.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ +  +LV++ +T  VA     C  + +I+SFGDS+ DTGN++H S V   
Sbjct  1    MASSLKKLISSF--LLVLYSTTIIVASSESRCRRFTSIISFGDSIADTGNILHLSDV--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +++  PYGE+FFH P+GR SDGRLIIDFIA+
Sbjct  57   HLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAE  90



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K+I+SFG+S+ DTGNL+  S          + PPYGETFF+H TGR+S+GRLIIDFIA+
Sbjct  36   FKSIISFGNSIADTGNLLGLSD--PNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAE  93



>ref|NP_849723.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31010.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +3

Query  21   MGFSLGTAITYYCIVLVVFESTGHVAGG---C--YKAIVSFGDSVTDTGNLIHKSKVLSK  185
            M  SL   I+ +  +LV++ +T  VA     C  + +I+SFGDS+ DTGN++H S V   
Sbjct  1    MASSLKKLISSF--LLVLYSTTIIVASSESRCRRFTSIISFGDSIADTGNILHLSDV--N  56

Query  186  GFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
               +++  PYGE+FFH P+GR SDGRLIIDFIA+
Sbjct  57   HLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAE  90



>ref|XP_006844517.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
 gb|ERN06192.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
Length=378

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            C+ A+ SFGDS+TDTGNL +   +    F      PYGETFFH PTGR SDGRLI+DF+A
Sbjct  29   CHTALFSFGDSLTDTGNLKY---LEHDQFFDIWSLPYGETFFHRPTGRCSDGRLIVDFLA  85

Query  285  Q  287
            Q
Sbjct  86   Q  86



>gb|EMT30306.1| GDSL esterase/lipase [Aegilops tauschii]
Length=336

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +3

Query  102  GCYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFI  281
            GC+K I SFGDS+TDTGN  + S+  +      SVPPYGET+FH PTGR SDGRLIIDF 
Sbjct  31   GCFKRIFSFGDSITDTGNFAYISR--NSPPGPPSVPPYGETYFHRPTGRASDGRLIIDFY  88

Query  282  AQS  290
            AQ+
Sbjct  89   AQA  91



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  105  CYKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIA  284
            C  +I SFGDS+ DTGNL+H     +  F      PYGET+FH+ TGR+SDGRLIIDFIA
Sbjct  44   CLTSIFSFGDSLADTGNLLHYLGDDAGPFAHL---PYGETYFHNATGRFSDGRLIIDFIA  100

Query  285  QS  290
            QS
Sbjct  101  QS  102



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            YK+I+SFGDS+ DTGN +H S V      +++  PYGETFF  PTGR SDGRLIIDFIA+
Sbjct  32   YKSIISFGDSIADTGNYLHLSDVNHP--PQAAFLPYGETFFSVPTGRNSDGRLIIDFIAE  89



>emb|CAN62554.1| hypothetical protein VITISV_031355 [Vitis vinifera]
Length=385

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = +3

Query  108  YKAIVSFGDSVTDTGNLIHKSKVLSKGFVKSSVPPYGETFFHHPTGRYSDGRLIIDFIAQ  287
            +K I +FGDS TDTGN   +S      F   S  PYG TFFHHPT RYSDGRL+IDF+AQ
Sbjct  41   FKRIYAFGDSYTDTGNT--RSATGPNAFTYVSNLPYGSTFFHHPTNRYSDGRLVIDFVAQ  98

Query  288  S  290
            +
Sbjct  99   A  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552217968300