BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015D02

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343543.1|  PREDICTED: xylose isomerase-like                   192   1e-55   Solanum tuberosum [potatoes]
ref|XP_004242672.1|  PREDICTED: xylose isomerase                        187   6e-54   Solanum lycopersicum
gb|KDP43806.1|  hypothetical protein JCGZ_23014                         187   1e-53   Jatropha curcas
ref|XP_009801815.1|  PREDICTED: xylose isomerase                        187   1e-53   Nicotiana sylvestris
ref|XP_009606829.1|  PREDICTED: xylose isomerase                        186   1e-53   Nicotiana tomentosiformis
gb|EYU42440.1|  hypothetical protein MIMGU_mgv1a0056112mg               174   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_002324488.1|  hypothetical protein POPTR_0018s10460g             178   1e-50   Populus trichocarpa [western balsam poplar]
gb|EYU34279.1|  hypothetical protein MIMGU_mgv1a005575mg                177   3e-50   Erythranthe guttata [common monkey flower]
ref|XP_011069881.1|  PREDICTED: xylose isomerase-like                   177   3e-50   Sesamum indicum [beniseed]
ref|XP_002277520.2|  PREDICTED: xylose isomerase                        176   7e-50   Vitis vinifera
emb|CBI17768.3|  unnamed protein product                                177   1e-49   Vitis vinifera
ref|XP_011018165.1|  PREDICTED: xylose isomerase                        176   1e-49   Populus euphratica
ref|XP_011079316.1|  PREDICTED: xylose isomerase                        172   2e-48   Sesamum indicum [beniseed]
emb|CDP02939.1|  unnamed protein product                                168   1e-46   Coffea canephora [robusta coffee]
ref|XP_007011130.1|  Xylose isomerase family protein isoform 4          166   1e-46   
ref|XP_007011129.1|  Xylose isomerase family protein isoform 3          166   3e-46   
ref|XP_007011127.1|  Xylose isomerase family protein isoform 1          167   6e-46   
ref|XP_002532409.1|  Xylose isomerase, putative                         163   7e-45   Ricinus communis
ref|XP_004297371.1|  PREDICTED: xylose isomerase                        163   7e-45   Fragaria vesca subsp. vesca
ref|XP_010102993.1|  Xylose isomerase                                   162   3e-44   
gb|KJB60238.1|  hypothetical protein B456_009G296100                    160   1e-43   Gossypium raimondii
gb|KJB60241.1|  hypothetical protein B456_009G296100                    160   1e-43   Gossypium raimondii
gb|KJB60239.1|  hypothetical protein B456_009G296100                    160   1e-43   Gossypium raimondii
ref|XP_009417936.1|  PREDICTED: xylose isomerase-like                   159   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010259769.1|  PREDICTED: xylose isomerase isoform X2             159   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010259768.1|  PREDICTED: xylose isomerase isoform X1             160   2e-43   Nelumbo nucifera [Indian lotus]
gb|KHG02217.1|  Xylose isomerase -like protein                          159   3e-43   Gossypium arboreum [tree cotton]
gb|KJB60240.1|  hypothetical protein B456_009G296100                    158   3e-43   Gossypium raimondii
ref|XP_010065877.1|  PREDICTED: xylose isomerase-like isoform X2        155   4e-43   
ref|XP_006845583.1|  hypothetical protein AMTR_s00019p00197750          156   2e-42   Amborella trichopoda
gb|KCW63564.1|  hypothetical protein EUGRSUZ_G01193                     156   3e-42   Eucalyptus grandis [rose gum]
ref|XP_010065878.1|  PREDICTED: xylose isomerase-like isoform X3        156   3e-42   Eucalyptus grandis [rose gum]
ref|XP_010065874.1|  PREDICTED: xylose isomerase-like isoform X1        155   3e-42   
ref|XP_007222807.1|  hypothetical protein PRUPE_ppa005065mg             155   6e-42   Prunus persica
ref|XP_010414290.1|  PREDICTED: xylose isomerase-like                   148   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006401183.1|  hypothetical protein EUTSA_v10013406mg             154   2e-41   Eutrema salsugineum [saltwater cress]
dbj|BAJ34093.1|  unnamed protein product                                154   2e-41   Eutrema halophilum
ref|XP_006453438.1|  hypothetical protein CICLE_v10008154mg             154   2e-41   Citrus clementina [clementine]
ref|XP_004958625.1|  PREDICTED: xylose isomerase-like                   154   2e-41   Setaria italica
ref|XP_008223675.1|  PREDICTED: xylose isomerase                        153   3e-41   Prunus mume [ume]
ref|XP_008796227.1|  PREDICTED: xylose isomerase isoform X1             154   3e-41   Phoenix dactylifera
ref|NP_851203.1|  xylose isomerase                                      149   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54617.1|  xylose isomerase                                        153   3e-41   Phaseolus vulgaris [French bean]
ref|XP_008452100.1|  PREDICTED: xylose isomerase                        153   4e-41   Cucumis melo [Oriental melon]
ref|XP_002864523.1|  xylose isomerase family protein                    152   7e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_008365436.1|  PREDICTED: xylose isomerase-like                   152   1e-40   Malus domestica [apple tree]
ref|XP_007154797.1|  hypothetical protein PHAVU_003G148700g             152   1e-40   Phaseolus vulgaris [French bean]
ref|XP_010102992.1|  Xylose isomerase                                   152   1e-40   
ref|XP_004149070.1|  PREDICTED: xylose isomerase-like                   151   2e-40   
ref|NP_568861.3|  xylose isomerase                                      151   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KGN61107.1|  hypothetical protein Csa_2G049960                       151   2e-40   Cucumis sativus [cucumbers]
dbj|BAE98492.1|  xylose isomerase                                       151   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658089.1|  PREDICTED: xylose isomerase-like                   151   2e-40   Oryza brachyantha
dbj|BAB08802.1|  xylose isomerase                                       151   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958079.1|  PREDICTED: xylose isomerase-like                   151   2e-40   Setaria italica
emb|CAN65150.1|  hypothetical protein VITISV_037086                     150   3e-40   Vitis vinifera
ref|XP_009336656.1|  PREDICTED: xylose isomerase-like                   150   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_009348411.1|  PREDICTED: xylose isomerase-like                   150   3e-40   Pyrus x bretschneideri [bai li]
emb|CDY25894.1|  BnaC09g32660D                                          150   4e-40   Brassica napus [oilseed rape]
ref|XP_006280396.1|  hypothetical protein CARUB_v10026323mg             150   5e-40   Capsella rubella
ref|XP_010483295.1|  PREDICTED: xylose isomerase-like                   150   6e-40   Camelina sativa [gold-of-pleasure]
gb|ACG35698.1|  xylose isomerase                                        150   6e-40   Zea mays [maize]
ref|XP_009120281.1|  PREDICTED: xylose isomerase                        150   6e-40   Brassica rapa
ref|XP_010452612.1|  PREDICTED: xylose isomerase-like                   149   7e-40   Camelina sativa [gold-of-pleasure]
gb|AAM61519.1|  xylose isomerase                                        149   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132653.1|  uncharacterized protein LOC100194128 precursor     149   7e-40   Zea mays [maize]
ref|NP_001060585.1|  Os07g0669100                                       149   8e-40   
gb|EEC82655.1|  hypothetical protein OsI_27268                          149   8e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_003549495.1|  PREDICTED: xylose isomerase                        149   9e-40   Glycine max [soybeans]
emb|CDY49729.1|  BnaA10g11590D                                          149   9e-40   Brassica napus [oilseed rape]
gb|KHN17567.1|  Xylose isomerase                                        149   1e-39   Glycine soja [wild soybean]
ref|XP_008650947.1|  PREDICTED: uncharacterized protein LOC100194...    149   1e-39   Zea mays [maize]
ref|XP_010443465.1|  PREDICTED: xylose isomerase                        149   1e-39   Camelina sativa [gold-of-pleasure]
gb|ACG42142.1|  xylose isomerase                                        149   2e-39   Zea mays [maize]
ref|NP_001132889.1|  putative xylose isomerase family protein pre...    149   2e-39   Zea mays [maize]
ref|XP_003562496.1|  PREDICTED: xylose isomerase                        148   2e-39   Brachypodium distachyon [annual false brome]
gb|KDO62435.1|  hypothetical protein CISIN_1g0373932mg                  148   2e-39   Citrus sinensis [apfelsine]
ref|XP_008796228.1|  PREDICTED: xylose isomerase isoform X2             148   3e-39   Phoenix dactylifera
ref|XP_010938719.1|  PREDICTED: xylose isomerase                        147   4e-39   Elaeis guineensis
gb|ACU18251.1|  unknown                                                 141   8e-39   Glycine max [soybeans]
ref|XP_010688509.1|  PREDICTED: xylose isomerase isoform X2             145   3e-38   
ref|XP_010688508.1|  PREDICTED: xylose isomerase isoform X1             145   4e-38   
tpg|DAA64056.1|  TPA: putative xylose isomerase family protein          144   7e-38   
tpg|DAA64057.1|  TPA: putative xylose isomerase family protein          144   7e-38   
ref|XP_010688511.1|  PREDICTED: xylose isomerase isoform X3             144   9e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS67638.1|  xylose isomerase                                        144   1e-37   Genlisea aurea
ref|XP_009391575.1|  PREDICTED: xylose isomerase-like                   143   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539451.1|  PREDICTED: xylose isomerase                        143   1e-37   Tarenaya hassleriana [spider flower]
gb|AFK33995.1|  unknown                                                 136   2e-37   Lotus japonicus
ref|XP_003610179.1|  Xylose isomerase                                   141   9e-37   
gb|AES92376.2|  xylose isomerase                                        141   9e-37   Medicago truncatula
ref|XP_004507817.1|  PREDICTED: xylose isomerase-like isoform X3        140   1e-36   Cicer arietinum [garbanzo]
ref|XP_004507815.1|  PREDICTED: xylose isomerase-like isoform X1        140   2e-36   
gb|AFK39166.1|  unknown                                                 139   4e-36   Medicago truncatula
dbj|BAJ96683.1|  predicted protein                                      139   7e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA64544.1|  xylose isomerase                                       137   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q40082.1|XYLA_HORVU  RecName: Full=Xylose isomerase                  137   2e-35   Hordeum vulgare [barley]
emb|CDY58846.1|  BnaA02g35220D                                          131   8e-35   Brassica napus [oilseed rape]
ref|XP_007011128.1|  Xylose isomerase family protein isoform 2          135   9e-35   
gb|KJB68666.1|  hypothetical protein B456_010G217000                    132   5e-34   Gossypium raimondii
ref|XP_002991182.1|  hypothetical protein SELMODRAFT_161472             127   7e-32   
ref|XP_002991242.1|  hypothetical protein SELMODRAFT_229601             127   7e-32   
gb|KIZ04907.1|  xylose isomerase                                        120   3e-29   Monoraphidium neglectum
ref|XP_001774702.1|  predicted protein                                  120   3e-29   
ref|XP_005646804.1|  xylose isomerase                                   110   8e-26   Coccomyxa subellipsoidea C-169
gb|AFG69667.1|  hypothetical protein 2_5497_01                          105   1e-25   Pinus taeda
gb|KHN34792.1|  Xylose isomerase                                      99.0    4e-23   Glycine soja [wild soybean]
emb|CDY02747.1|  BnaC02g11420D                                          100   1e-22   
ref|WP_013109552.1|  xylose isomerase                                   100   3e-22   Planctopirus limnophila
ref|WP_011118969.1|  xylose isomerase                                 98.6    1e-21   Rhodopirellula baltica
ref|WP_008655763.1|  xylose isomerase                                 98.6    1e-21   Rhodopirellula europaea
emb|CAD72762.1|  xylose isomerase                                     98.6    2e-21   Rhodopirellula baltica SH 1
ref|WP_007335236.1|  xylose isomerase                                 98.6    2e-21   Rhodopirellula baltica
ref|WP_007324329.1|  xylose isomerase                                 98.2    2e-21   Rhodopirellula baltica
ref|XP_008362076.1|  PREDICTED: xylose isomerase-like                 99.4    2e-21   
ref|WP_038172460.1|  xylose isomerase                                 98.2    2e-21   Verrucomicrobium sp. BvORR106
ref|WP_002643822.1|  xylose isomerase                                 97.1    5e-21   Gimesia maris
ref|WP_044302066.1|  xylose isomerase                                 97.1    6e-21   Rhodopirellula sallentina
gb|EMI56412.1|  xylose isomerase                                      97.1    7e-21   Rhodopirellula sallentina SM41
gb|EMT06905.1|  Xylose isomerase                                      96.7    8e-21   
ref|WP_009959507.1|  xylose isomerase                                 96.7    8e-21   Verrucomicrobium spinosum
ref|WP_008707454.1|  xylose isomerase                                 96.3    1e-20   Rhodopirellula maiorica
ref|WP_013701478.1|  xylose isomerase                                 96.3    1e-20   Treponema succinifaciens
ref|WP_015358602.1|  MULTISPECIES: xylose isomerase XylA              95.9    1e-20   Thermoclostridium stercorarium
ref|WP_009095728.1|  xylose isomerase                                 95.5    2e-20   Rhodopirellula sp. SWK7
ref|WP_010588344.1|  xylose isomerase                                 95.1    2e-20   Schlesneria paludicola
emb|CDY03999.1|  BnaC02g37140D                                        89.7    4e-20   
ref|WP_012924965.1|  xylose isomerase                                 94.7    5e-20   
ref|WP_002651869.1|  xylose isomerase                                 94.0    7e-20   Blastopirellula marina
ref|WP_010040427.1|  xylose isomerase                                 93.6    9e-20   Gemmata obscuriglobus
ref|WP_012913169.1|  xylose isomerase                                 93.2    1e-19   Pirellula staleyi
ref|WP_026475377.1|  xylose isomerase                                 93.2    2e-19   Alkaliflexus imshenetskii
ref|WP_020471332.1|  xylose isomerase                                 92.8    2e-19   Zavarzinella formosa
ref|WP_013626379.1|  xylose isomerase                                 92.8    2e-19   Rubinisphaera brasiliensis
ref|WP_020153617.1|  xylose isomerase                                 92.4    2e-19   Caldibacillus debilis
ref|WP_013711740.1|  xylose isomerase                                 92.0    3e-19   Carnobacterium sp. 17-4
ref|WP_013667214.1|  xylose isomerase                                 92.0    4e-19   Sphingobacterium sp. 21
ref|WP_013711744.1|  xylose isomerase                                 92.0    4e-19   Carnobacterium sp. 17-4
ref|WP_008880082.1|  MULTISPECIES: xylose isomerase                   92.0    4e-19   Geobacillus
emb|CBK25455.2|  unnamed protein product                              91.7    5e-19   Blastocystis hominis
ref|WP_019387009.1|  xylose isomerase                                 91.7    5e-19   Arenitalea lutea
ref|WP_007414259.1|  xylose isomerase                                 91.7    6e-19   Pedosphaera parvula
ref|WP_026561670.1|  xylose isomerase                                 91.7    6e-19   Bacillus sp. J37
ref|WP_010255892.1|  xylose isomerase                                 91.7    6e-19   Treponema primitia
ref|WP_015707713.1|  xylose isomerase                                 91.3    7e-19   Treponema primitia
ref|WP_018615189.1|  xylose isomerase                                 91.3    8e-19   Segetibacter koreensis
ref|WP_022103428.1|  xylose isomerase                                 91.3    9e-19   
ref|WP_019986665.1|  xylose isomerase                                 91.3    9e-19   Rudanella lutea
ref|XP_005764620.1|  hypothetical protein EMIHUDRAFT_214014           87.4    9e-19   Emiliania huxleyi CCMP1516
gb|EPH17343.1|  xylose isomerase                                      91.3    9e-19   Bacteroides stercoris CC31F
dbj|GAK49954.1|  xylose isomerase                                     90.9    9e-19   Candidatus Moduliflexus flocculans
ref|WP_018666714.1|  xylose isomerase                                 90.9    9e-19   Bacteroides gallinarum
emb|CAB76571.1|  xylose isomerase                                     90.9    9e-19   Piromyces sp. E2
ref|WP_036940898.1|  xylose isomerase                                 90.9    1e-18   Pseudobacteroides cellulosolvens
ref|WP_044737009.1|  xylose isomerase                                 90.9    1e-18   Geobacillus kaustophilus
ref|WP_010538096.1|  MULTISPECIES: xylose isomerase                   90.9    1e-18   Bacteroides
ref|WP_008761491.1|  MULTISPECIES: xylose isomerase                   90.9    1e-18   
ref|WP_031409263.1|  xylose isomerase                                 90.9    1e-18   Geobacillus vulcani
ref|WP_024987508.1|  xylose isomerase                                 90.9    1e-18   Bacteroides acidifaciens
ref|WP_022138821.1|  xylose isomerase                                 90.9    1e-18   Bacteroides
ref|WP_011107447.1|  xylose isomerase                                 90.9    1e-18   Bacteroides thetaiotaomicron
ref|WP_004295876.1|  MULTISPECIES: xylose isomerase                   90.9    1e-18   Bacteroides
ref|WP_021321588.1|  xylose isomerase                                 90.9    1e-18   Geobacillus
ref|WP_033008779.1|  xylose isomerase                                 90.9    1e-18   
gb|ABI49954.1|  xylose kinase                                         90.9    1e-18   Geobacillus stearothermophilus
ref|WP_016267511.1|  xylose isomerase                                 90.9    1e-18   Bacteroides thetaiotaomicron
ref|WP_034536238.1|  xylose isomerase                                 90.9    1e-18   Bacteroides stercoris
ref|WP_044745016.1|  xylose isomerase                                 90.9    1e-18   Anoxybacillus geothermalis
ref|WP_005654109.1|  xylose isomerase                                 90.5    1e-18   Bacteroides stercoris
ref|WP_008765652.1|  xylose isomerase                                 90.5    1e-18   Bacteroides thetaiotaomicron
ref|WP_023634171.1|  xylose isomerase                                 90.9    1e-18   Geobacillus sp. MAS1
ref|WP_044731434.1|  xylose isomerase                                 90.5    1e-18   Geobacillus kaustophilus
ref|WP_007760618.1|  xylose isomerase                                 90.5    1e-18   Bacteroides finegoldii
ref|WP_007748423.1|  MULTISPECIES: xylose isomerase                   90.5    1e-18   Bacteroides finegoldii
dbj|GAE90252.1|  xylose isomerase [ [                                 89.7    1e-18   Hungateiclostridium straminisolvens JCM 21531
ref|WP_007567790.1|  MULTISPECIES: xylose isomerase                   90.5    1e-18   Bacteroides coprocola
ref|WP_018709956.1|  xylose isomerase                                 90.5    1e-18   Bacteroides barnesiae
ref|WP_006801274.1|  xylose isomerase                                 90.5    1e-18   Dysgonomonas gadei
ref|WP_022042383.1|  xylose isomerase                                 90.5    1e-18   Bacteroides caccae
ref|WP_040994511.1|  xylose isomerase                                 90.5    1e-18   Chryseobacterium oranimense
ref|WP_022339343.1|  xylose isomerase                                 90.5    1e-18   
ref|WP_028986624.1|  xylose isomerase                                 90.5    1e-18   Thermicanus aegyptius
gb|AEI87757.1|  xylose isomerase                                      90.5    1e-18   Parageobacillus thermantarcticus
ref|WP_005675918.1|  xylose isomerase                                 90.5    2e-18   Bacteroides caccae
ref|WP_007930953.1|  MULTISPECIES: xylose isomerase                   90.5    2e-18   Pelosinus
ref|WP_022164491.1|  xylose isomerase                                 90.5    2e-18   
ref|WP_005588920.1|  xylose isomerase                                 90.5    2e-18   
ref|WP_010245089.1|  xylose isomerase                                 90.5    2e-18   Hungateiclostridium cellulolyticum
ref|WP_013877022.1|  xylose isomerase                                 90.5    2e-18   Parageobacillus thermoglucosidasius
ref|WP_028120803.1|  xylose isomerase                                 90.1    2e-18   Chryseobacterium tenax
ref|WP_025763423.1|  xylose isomerase                                 90.1    2e-18   Dyadobacter tibetensis
ref|WP_019538924.1|  xylose isomerase                                 90.1    2e-18   Proteiniphilum acetatigenes
ref|WP_009125594.1|  xylose isomerase                                 90.1    2e-18   Bacteroides fluxus
ref|WP_025498145.1|  xylose isomerase                                 90.1    2e-18   
sp|Q6T6K9.1|XYLA_FERGO  RecName: Full=Xylose isomerase                89.7    2e-18   Fervidobacterium gondwanense
ref|WP_013564383.1|  xylose isomerase                                 89.7    2e-18   Isosphaera pallida
ref|WP_029292485.1|  xylose isomerase                                 89.7    2e-18   Chryseobacterium hispalense
ref|WP_024996964.1|  xylose isomerase                                 89.7    2e-18   Bacteroides graminisolvens
ref|WP_012238060.1|  xylose isomerase                                 89.7    2e-18   Sorangium cellulosum
ref|WP_034673582.1|  xylose isomerase                                 89.7    2e-18   Chryseobacterium formosense
ref|WP_004290957.1|  MULTISPECIES: xylose isomerase                   89.7    3e-18   Bacteroides eggerthii
ref|WP_020594904.1|  xylose isomerase                                 89.7    3e-18   Spirosoma panaciterrae
ref|WP_008618038.1|  xylose isomerase                                 89.7    3e-18   Paraprevotella clara
ref|WP_014856692.1|  xylose isomerase                                 89.7    3e-18   Melioribacter roseus
ref|WP_022389541.1|  xylose isomerase                                 89.7    3e-18   Tannerella sp. AF04-6
ref|WP_038559919.1|  xylose isomerase                                 89.7    3e-18   Draconibacterium orientale
ref|WP_020960004.1|  xylose isomerase                                 89.7    3e-18   Geobacillus genomosp. 3
ref|WP_022600970.1|  xylose isomerase                                 89.7    3e-18   Coprobacter fastidiosus
ref|WP_011231365.1|  xylose isomerase                                 89.7    3e-18   Geobacillus kaustophilus
ref|WP_009319331.1|  xylose isomerase                                 89.7    3e-18   Tannerella sp. 6_1_58FAA_CT1
ref|WP_022829574.1|  xylose isomerase                                 89.7    3e-18   Cytophagales bacterium B6
ref|WP_008626667.1|  xylose isomerase                                 89.7    3e-18   Paraprevotella xylaniphila
sp|Q9KGU2.1|XYLA_THEYO  RecName: Full=Xylose isomerase                89.7    3e-18   Caldanaerobacter subterraneus subsp. yonseiensis
ref|WP_021969955.1|  xylose isomerase                                 89.7    3e-18   
ref|WP_022231753.1|  xylose isomerase                                 89.7    3e-18   
ref|WP_002978702.1|  xylose isomerase                                 89.7    3e-18   Chryseobacterium gleum
ref|WP_029904902.1|  xylose isomerase                                 89.7    3e-18   Prevotella sp. 10(H)
ref|WP_022587522.1|  xylose isomerase                                 89.4    3e-18   Caldanaerobacter subterraneus
ref|WP_025608026.1|  xylose isomerase                                 89.4    4e-18   Pontibacter actiniarum
ref|XP_005779983.1|  hypothetical protein EMIHUDRAFT_59556            87.4    4e-18   Emiliania huxleyi CCMP1516
dbj|BAP32351.1|  xylose isomerase                                     89.4    4e-18   Chryseobacterium sp. StRB126
ref|WP_020605377.1|  xylose isomerase                                 89.4    4e-18   Spirosoma spitsbergense
ref|WP_006842491.1|  xylose isomerase                                 89.4    4e-18   Dysgonomonas mossii
ref|WP_025881085.1|  xylose isomerase                                 89.0    4e-18   Prevotella baroniae
ref|XP_004356776.1|  xylose isomerase                                 89.0    5e-18   Acanthamoeba castellanii str. Neff
ref|WP_022825466.1|  xylose isomerase                                 89.0    5e-18   Hymenobacter norwichensis
ref|WP_013931484.1|  xylose isomerase                                 89.0    5e-18   Pseudothermotoga thermarum
gb|ACA65427.1|  xylose isomerase                                      89.0    5e-18   Orpinomyces sp. ukk1
ref|WP_020733663.1|  xylose isomerase                                 89.0    5e-18   Sorangium cellulosum
ref|WP_010074860.1|  xylose isomerase                                 89.0    6e-18   Clostridium cellulovorans
ref|WP_013618897.1|  xylose isomerase                                 89.0    6e-18   Bacteroides salanitronis
ref|WP_026679492.1|  xylose isomerase                                 89.0    6e-18   Fictibacillus gelatini
ref|WP_026390872.1|  xylose isomerase                                 88.6    6e-18   Acholeplasma axanthum
ref|WP_041252697.1|  xylose isomerase                                 88.6    6e-18   Flavobacteriaceae bacterium 3519-10
gb|ACU08186.1|  Xylose isomerase                                      89.0    7e-18   Flavobacteriaceae bacterium 3519-10
ref|WP_044627421.1|  xylose isomerase                                 88.6    7e-18   Tamlana nanhaiensis
ref|WP_008507562.1|  xylose isomerase                                 88.6    7e-18   Mucilaginibacter paludis
ref|WP_024268780.1|  Xylose isomerase                                 88.6    8e-18   Salinispira pacifica
ref|WP_018199100.1|  hypothetical protein                             88.6    8e-18   
ref|WP_013411463.1|  xylose isomerase                                 88.6    8e-18   Caldicellulosiruptor owensensis
ref|WP_013145206.1|  xylose isomerase                                 88.6    8e-18   Geobacillus sp. C56-T3
gb|ETL77578.1|  xylose isomerase                                      88.6    8e-18   Phytophthora parasitica
ref|WP_035146022.1|  xylose isomerase                                 88.2    8e-18   Caldicoprobacter
ref|WP_033025489.1|  xylose isomerase                                 88.6    8e-18   Geobacillus sp. CAMR5420
ref|WP_013289876.1|  xylose isomerase                                 88.2    9e-18   Caldicellulosiruptor obsidiansis
ref|WP_013523871.1|  MULTISPECIES: xylose isomerase                   88.6    9e-18   Geobacillus
ref|WP_015374960.1|  MULTISPECIES: xylose isomerase                   88.6    9e-18   Geobacillus
gb|EPR27593.1|  Xylose isomerase                                      88.6    9e-18   Geobacillus sp. WSUCF1
ref|WP_034968396.1|  xylose isomerase                                 88.2    9e-18   Chryseobacterium sp. FH1
ref|WP_027621618.1|  xylose isomerase [                               88.2    9e-18   Hungateiclostridium clariflavum
dbj|GAD14402.1|  xylose isomerase                                     88.6    9e-18   Geobacillus kaustophilus GBlys
ref|WP_033012686.1|  xylose isomerase                                 88.2    9e-18   Geobacillus
gb|ETO82214.1|  xylose isomerase                                      88.6    9e-18   Phytophthora parasitica P1976
ref|WP_042380762.1|  xylose isomerase                                 88.2    9e-18   Geobacillus kaustophilus
ref|WP_026976161.1|  xylose isomerase                                 88.2    1e-17   Alicyclobacillus contaminans
ref|WP_026626867.1|  xylose isomerase                                 88.2    1e-17   Dysgonomonas capnocytophagoides
gb|ETP51333.1|  xylose isomerase                                      88.2    1e-17   Phytophthora parasitica P10297
gb|ETI53536.1|  xylose isomerase                                      88.2    1e-17   Phytophthora parasitica P1569
ref|WP_013433194.1|  xylose isomerase                                 88.2    1e-17   Caldicellulosiruptor kristjanssonii
ref|WP_017733947.1|  xylose isomerase                                 88.2    1e-17   Nafulsella turpanensis
ref|WP_044225739.1|  xylose isomerase                                 88.2    1e-17   Phaeodactylibacter xiamenensis
ref|WP_028555493.1|  xylose isomerase                                 88.2    1e-17   Paenibacillus sp. URHA0014
ref|WP_042834224.1|  xylose isomerase                                 88.2    1e-17   Thermoanaerobacter sp. YS13
ref|WP_007557712.1|  xylose isomerase                                 88.2    1e-17   Bacteroides plebeius
ref|WP_007415126.1|  xylose isomerase                                 88.2    1e-17   Pedosphaera parvula
ref|WP_027382385.1|  xylose isomerase                                 88.2    1e-17   Chryseobacterium caeni
ref|WP_018619163.1|  xylose isomerase                                 88.2    1e-17   Spirosoma luteum
ref|WP_025950753.1|  xylose isomerase                                 88.2    1e-17   Geobacillus thermocatenulatus
ref|XP_008900733.1|  xylose isomerase                                 88.2    1e-17   Phytophthora parasitica INRA-310
ref|WP_022039388.1|  xylose isomerase                                 87.8    1e-17   Bacteroides
ref|WP_013547913.1|  xylose isomerase                                 87.8    1e-17   Bacteroides helcogenes
ref|WP_002560285.1|  MULTISPECIES: xylose isomerase                   87.8    1e-17   Bacteroides
ref|WP_039365617.1|  xylose isomerase                                 87.8    1e-17   Chryseobacterium taiwanense
pdb|1A0E|A  Chain A, Xylose Isomerase From Thermotoga Neapolitana     87.8    1e-17   Thermotoga neapolitana
ref|WP_015919215.1|  MULTISPECIES: xylose isomerase                   87.8    1e-17   Thermotoga
ref|WP_038538799.1|  xylose isomerase                                 87.8    1e-17   Bacillus sp. X1(2014)
ref|WP_038607329.1|  xylose isomerase                                 87.8    1e-17   
ref|WP_022508280.1|  xylose isomerase                                 87.8    1e-17   Bacteroides vulgatus
ref|WP_027092932.1|  xylose isomerase                                 87.8    2e-17   Cohnella thermotolerans
ref|WP_005851486.1|  MULTISPECIES: xylose isomerase                   87.8    2e-17   
ref|WP_014195978.1|  MULTISPECIES: xylose isomerase                   87.8    2e-17   
ref|WP_005843150.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_016276408.1|  MULTISPECIES: xylose isomerase                   87.4    2e-17   
ref|WP_008101337.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_020007900.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_027381263.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_022386029.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_009120973.1|  MULTISPECIES: xylose isomerase                   87.4    2e-17   
ref|WP_028787239.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_021979384.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_023663756.1|  xylose isomerase                                 87.4    2e-17   
ref|WP_005931926.1|  MULTISPECIES: xylose isomerase                   87.4    2e-17   
ref|WP_041695343.1|  xylose isomerase                                 87.4    2e-17   
gb|AEJ44206.1|  xylose isomerase                                      87.4    2e-17   
ref|WP_042719664.1|  xylose isomerase                                 87.4    2e-17   
sp|P54272.1|XYLA_BACSW  RecName: Full=Xylose isomerase                87.4    2e-17   
emb|CAA66715.1|  xylose isomerase                                     87.4    2e-17   
ref|WP_044745389.1|  xylose isomerase                                 87.4    2e-17   
pdb|1A0D|A  Chain A, Xylose Isomerase From Bacillus Stearothermop...  87.0    2e-17   
ref|WP_003250950.1|  MULTISPECIES: xylose isomerase                   87.0    2e-17   
ref|WP_009186695.1|  xylose isomerase                                 87.0    2e-17   
ref|WP_029688173.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_013570854.1|  MULTISPECIES: xylose isomerase                   87.0    3e-17   
ref|WP_003868244.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_012994345.1|  MULTISPECIES: xylose isomerase                   87.0    3e-17   
ref|WP_009051955.1|  MULTISPECIES: xylose isomerase                   87.0    3e-17   
ref|WP_032100300.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_014225930.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_013430944.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_028668460.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_004399926.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_015814165.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_002299156.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_012811447.1|  xylose isomerase                                 87.0    3e-17   
ref|WP_028262068.1|  xylose isomerase                                 86.7    3e-17   
ref|WP_026350601.1|  xylose isomerase                                 87.0    3e-17   
gb|EFR67495.1|  xylose isomerase                                      86.7    3e-17   
ref|WP_003869013.1|  MULTISPECIES: xylose isomerase                   86.7    3e-17   
ref|WP_002322281.1|  xylose isomerase                                 86.7    3e-17   
gb|AAC46145.1|  xylose isomerase                                      87.0    3e-17   
ref|XP_794920.3|  PREDICTED: xylose isomerase-like                    87.0    3e-17   
ref|WP_006569355.1|  xylose isomerase                                 86.7    3e-17   
ref|WP_005820227.1|  xylose isomerase                                 86.7    4e-17   
ref|WP_007841615.1|  MULTISPECIES: xylose isomerase                   86.7    4e-17   
ref|WP_044748193.1|  xylose isomerase                                 86.7    4e-17   
ref|WP_042409316.1|  xylose isomerase                                 86.7    4e-17   
ref|WP_017446990.1|  hypothetical protein                             86.7    4e-17   
ref|WP_017434257.1|  xylose isomerase                                 86.7    4e-17   
ref|WP_025658881.1|  xylose isomerase                                 86.7    4e-17   
emb|CDQ80418.1|  unnamed protein product                              86.7    4e-17   
ref|WP_021846289.1|  xylose isomerase                                 86.7    4e-17   
ref|WP_018856526.1|  xylose isomerase                                 86.3    4e-17   
ref|WP_042505772.1|  xylose isomerase                                 86.3    4e-17   
ref|WP_044162815.1|  xylose isomerase                                 86.3    4e-17   
ref|WP_034652848.1|  xylose isomerase                                 86.3    4e-17   
ref|WP_035468893.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_034264614.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_039138274.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_032531500.1|  xylose isomerase                                 86.3    5e-17   
emb|CCQ75106.1|  xylose isomerase                                     86.3    5e-17   
ref|WP_032598317.1|  xylose isomerase                                 86.3    5e-17   
gb|EED08196.1|  xylose isomerase                                      86.3    5e-17   
ref|WP_022054239.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_005806049.1|  MULTISPECIES: xylose isomerase                   86.3    5e-17   
ref|WP_032575525.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_032600983.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_011943656.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_003128196.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_007956865.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_013928648.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_005470141.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_033164816.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_031535720.1|  MULTISPECIES: xylose isomerase                   86.3    5e-17   
ref|WP_009033396.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_038052482.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_020464968.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_019005667.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_009127448.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_008907517.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_022019645.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_014062099.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_028525170.1|  xylose isomerase                                 86.3    5e-17   
ref|WP_035663900.1|  xylose isomerase                                 86.3    6e-17   
ref|WP_012896352.1|  xylose isomerase                                 86.3    6e-17   
ref|WP_027328216.1|  xylose isomerase                                 86.3    6e-17   
ref|WP_007214097.1|  MULTISPECIES: xylose isomerase                   85.9    6e-17   
ref|WP_022210068.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_021150351.1|  nylose isomerase                                 85.9    6e-17   
gb|KHC94878.1|  xylose isomerase                                      86.3    6e-17   
ref|WP_014217259.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_029683770.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_022083252.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_044150649.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_029486454.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_003125594.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_034707292.1|  xylose isomerase                                 85.9    6e-17   
gb|KJF45546.1|  xylose isomerase                                      85.9    6e-17   
ref|WP_038033066.1|  MULTISPECIES: xylose isomerase                   85.9    6e-17   
ref|WP_012310984.1|  xylose isomerase                                 85.9    6e-17   
ref|WP_027388724.1|  xylose isomerase                                 85.9    7e-17   
ref|WP_044637928.1|  xylose isomerase                                 85.9    7e-17   
ref|WP_044271094.1|  xylose isomerase                                 85.9    7e-17   
ref|WP_029715011.1|  xylose isomerase                                 85.9    7e-17   
emb|CDZ23165.1|  Xylose isomerase [ [                                 85.9    7e-17   
ref|WP_010898905.1|  xylose isomerase                                 85.9    7e-17   
ref|WP_026564802.1|  xylose isomerase                                 85.9    7e-17   
ref|WP_021590663.1|  xylose isomerase                                 85.9    7e-17   
ref|WP_012789601.1|  xylose isomerase                                 85.9    7e-17   
ref|WP_028974176.1|  xylose isomerase                                 85.9    8e-17   
ref|WP_013970119.1|  xylose isomerase                                 85.9    8e-17   
ref|WP_014826083.1|  xylose isomerase                                 85.9    8e-17   
ref|WP_037360765.1|  xylose isomerase                                 85.5    8e-17   
ref|WP_005470534.1|  xylose isomerase                                 85.5    8e-17   
ref|WP_022847921.1|  xylose isomerase                                 85.5    8e-17   
ref|WP_040203718.1|  MULTISPECIES: xylose isomerase                   85.5    8e-17   
gb|ACO55082.1|  xylose isomerase                                      85.5    9e-17   
ref|WP_034313192.1|  xylose isomerase                                 85.5    9e-17   
emb|CEG31985.1|  xylose isomerase                                     85.5    9e-17   
ref|WP_007218456.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_037998292.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_018387210.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_027410332.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_038674727.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_009571734.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_035527339.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_014625278.1|  xylose isomerase                                 85.5    1e-16   
ref|WP_037327396.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_044003575.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_024029540.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_037179575.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_013314408.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_039847233.1|  xylose isomerase                                 80.5    1e-16   
ref|WP_018628617.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_004082185.1|  MULTISPECIES: xylose isomerase                   85.1    1e-16   
ref|WP_017260113.1|  xylose isomerase                                 85.1    1e-16   
ref|XP_009537174.1|  hypothetical protein PHYSODRAFT_306712           85.9    1e-16   
ref|WP_015807432.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_028673307.1|  MULTISPECIES: xylose isomerase                   85.1    1e-16   
ref|WP_009134074.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_031526178.1|  xylose isomerase                                 85.1    1e-16   
ref|WP_028396664.1|  xylose isomerase                                 85.1    2e-16   
ref|WP_027067621.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_032539378.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_034838066.1|  xylose isomerase [                               84.7    2e-16   
ref|WP_016183390.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_026630704.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_042534090.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_037119675.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_019381289.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_009334243.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_043981918.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_016763761.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_043618463.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_037414339.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_005825539.1|  MULTISPECIES: xylose isomerase                   84.7    2e-16   
ref|WP_025835352.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_036155519.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_019416726.1|  MULTISPECIES: xylose isomerase                   84.7    2e-16   
gb|EGC69929.1|  xylose isomerase                                      84.7    2e-16   
ref|WP_006195377.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_033826987.1|  xylose isomerase                                 84.7    2e-16   
gb|AIB17286.1|  Xylose isomerase                                      84.7    2e-16   
gb|ACI62424.1|  xylisomerase                                          84.7    2e-16   
ref|WP_034872124.1|  MULTISPECIES: xylose isomerase                   84.7    2e-16   
ref|WP_008380597.1|  MULTISPECIES: xylose isomerase                   84.7    2e-16   
ref|WP_032556812.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_005228447.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_044173166.1|  xylose isomerase                                 84.7    2e-16   
gb|ERE62367.1|  xylose isomerase                                      83.2    2e-16   
ref|WP_025863290.1|  xylose isomerase                                 84.7    2e-16   
gb|EPH66201.1|  xylose isomerase                                      84.7    2e-16   
ref|WP_042890500.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_034858628.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_044749145.1|  xylose isomerase                                 84.7    2e-16   
gb|EPH88597.1|  xylose isomerase                                      84.7    2e-16   
ref|WP_029228039.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_016775947.1|  xylose isomerase                                 84.7    2e-16   
ref|WP_032564865.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_007527764.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_007802725.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_006189966.1|  MULTISPECIES: xylose isomerase                   84.3    2e-16   
ref|WP_027624313.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_020209790.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_008508460.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_008935467.1|  MULTISPECIES: xylose isomerase                   84.3    2e-16   
ref|WP_006011751.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_032562944.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_005803483.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_014298921.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_005777710.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_025199606.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_006144625.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_002966715.1|  MULTISPECIES: xylose isomerase                   84.3    2e-16   
ref|WP_012783901.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_004689533.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_002963697.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_032599677.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_010992983.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_007700780.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_005787643.1|  MULTISPECIES: xylose isomerase                   84.3    2e-16   
gb|EEH14934.1|  xylose isomerase                                      84.3    2e-16   
gb|EFM59199.1|  xylose isomerase                                      84.3    2e-16   
ref|WP_012652406.1|  MULTISPECIES: xylose isomerase                   84.3    2e-16   
ref|WP_018096676.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_028752785.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_028748811.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_034787018.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_014041981.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_044634086.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_015917171.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_041967868.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_025026464.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_008533378.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_010768166.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_037151728.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_024847494.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_018328012.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_016556986.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_010416001.1|  xylose isomerase                                 84.3    2e-16   
ref|WP_010094936.1|  xylose isomerase                                 84.3    2e-16   



>ref|XP_006343543.1| PREDICTED: xylose isomerase-like [Solanum tuberosum]
Length=481

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  264
            M +   GK L  L CLNV+S++V+AA PPTCPAD  SDC S SGEWEGEFFPGIPKI+YE
Sbjct  1    MRERNVGKCLLFLLCLNVVSSVVIAAAPPTCPADTGSDCGSDSGEWEGEFFPGIPKIEYE  60

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPLSFKWYNAEEEILG+KMKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  61   GPSSKNPLSFKWYNAEEEILGEKMKDWMRFSVAFWHTFRGTGADPFG  107



>ref|XP_004242672.1| PREDICTED: xylose isomerase [Solanum lycopersicum]
Length=481

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  264
            M +   GK    L CLNV+S++VMAA PPTCPAD  S C S SGEW+GEFFPGIPKIKYE
Sbjct  1    MRERNVGKCSLFLLCLNVVSSVVMAAAPPTCPADTGSGCGSDSGEWDGEFFPGIPKIKYE  60

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPLSFKWYNAEEE+LG+KMKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  61   GPSSKNPLSFKWYNAEEEVLGEKMKDWMRFSVAFWHTFRGTGADPFG  107



>gb|KDP43806.1| hypothetical protein JCGZ_23014 [Jatropha curcas]
Length=477

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M  GK+L LLFCLN+++++V+A GPPTCPAD+  +C SGS EW+GEFFPG+PKIKYEGPS
Sbjct  1    MKGGKILLLLFCLNIVASLVIADGPPTCPADLGGEC-SGSDEWKGEFFPGVPKIKYEGPS  59

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+FKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  60   SKNPLAFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGGDPFG  103



>ref|XP_009801815.1| PREDICTED: xylose isomerase [Nicotiana sylvestris]
Length=481

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  264
            MI+   GK L LL CLN +SNIV AA PPTCPADI SDC S SGEWEGEFFPGIPKIKYE
Sbjct  1    MIERNLGKCLLLLLCLNAVSNIVTAAAPPTCPADIGSDCGSDSGEWEGEFFPGIPKIKYE  60

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  61   GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGADPFG  107



>ref|XP_009606829.1| PREDICTED: xylose isomerase [Nicotiana tomentosiformis]
Length=481

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  264
            MI+   GK L LL CLNV+SNIV AA PPTCPADI SDC   SGEWEGEFFPGIPKIKYE
Sbjct  1    MIERNLGKCLLLLLCLNVVSNIVTAAAPPTCPADIGSDCGGDSGEWEGEFFPGIPKIKYE  60

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  61   GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGADPFG  107



>gb|EYU42440.1| hypothetical protein MIMGU_mgv1a0056112mg, partial [Erythranthe 
guttata]
 gb|EYU42441.1| hypothetical protein MIMGU_mgv1a0056112mg, partial [Erythranthe 
guttata]
Length=216

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   K L  L  LN +SN+V + GPPTCPADI S+C  GS EWEGEFFPGIP IKYEGPS
Sbjct  1    MKIAKFLLFLLSLNTVSNLVTSVGPPTCPADIESNCGGGS-EWEGEFFPGIPNIKYEGPS  59

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKN LSFKWYNAEEEILGKKMKDWMRFS+AFWHTFRGTG+DPFG
Sbjct  60   SKNHLSFKWYNAEEEILGKKMKDWMRFSIAFWHTFRGTGADPFG  103



>ref|XP_002324488.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
 gb|EEF03053.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
Length=477

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M  G++L LL C +VI+  V AAGPPTCPAD+   C S SGEWEGEFFPGIPKIKYEGPS
Sbjct  1    MKGGRILLLLVCSSVITLGVFAAGPPTCPADLGGKC-SDSGEWEGEFFPGIPKIKYEGPS  59

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+FKWYNAEEEILGKKMKDWMRFS+AFWHTFRGTG DPFG
Sbjct  60   SKNPLAFKWYNAEEEILGKKMKDWMRFSIAFWHTFRGTGGDPFG  103



>gb|EYU34279.1| hypothetical protein MIMGU_mgv1a005575mg [Erythranthe guttata]
Length=478

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M + K + LL  LNV+ N V A GPPTCPA + SDC++ S EWEGEFFPG+PKIKYEGPS
Sbjct  1    MKSAKFVILLLTLNVVYNTVTAVGPPTCPATVGSDCSASSSEWEGEFFPGVPKIKYEGPS  60

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKN L+FKWYNAEEEILGK MKDWMRFSVAFWHTFRGTG DPFG
Sbjct  61   SKNHLAFKWYNAEEEILGKTMKDWMRFSVAFWHTFRGTGGDPFG  104



>ref|XP_011069881.1| PREDICTED: xylose isomerase-like [Sesamum indicum]
Length=475

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 91/104 (88%), Gaps = 3/104 (3%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M + K L LL  LNV+SN+VMAA PPTCPA + SDCA+   EW+GEFFPGIPKIKYEGPS
Sbjct  1    MKSAKFLLLLISLNVVSNLVMAA-PPTCPAHLGSDCATD--EWKGEFFPGIPKIKYEGPS  57

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+FKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  58   SKNPLAFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGGDPFG  101



>ref|XP_002277520.2| PREDICTED: xylose isomerase [Vitis vinifera]
 ref|XP_010656801.1| PREDICTED: xylose isomerase [Vitis vinifera]
Length=478

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            MMAGKV   L CLNV+S  V+A+ P TCPAD  S     S EWEGEFFPGIPKIKYEGPS
Sbjct  1    MMAGKVFLFLLCLNVVSFAVIASSPQTCPADDVSSKCGASDEWEGEFFPGIPKIKYEGPS  60

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPLS+KWYNA+EEILGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  61   SKNPLSYKWYNADEEILGKKMKDWMRFSVAFWHTFRGTGGDPFG  104



>emb|CBI17768.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            MMAGKV   L CLNV+S  V+A+ P TCPAD  S     S EWEGEFFPGIPKIKYEGPS
Sbjct  49   MMAGKVFLFLLCLNVVSFAVIASSPQTCPADDVSSKCGASDEWEGEFFPGIPKIKYEGPS  108

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPLS+KWYNA+EEILGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  109  SKNPLSYKWYNADEEILGKKMKDWMRFSVAFWHTFRGTGGDPFG  152



>ref|XP_011018165.1| PREDICTED: xylose isomerase [Populus euphratica]
 ref|XP_011018166.1| PREDICTED: xylose isomerase [Populus euphratica]
Length=477

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M  G++L LL C +VI+  V AAGPPTCPAD+   C S S EWEGEFFPGIPKIKYEGPS
Sbjct  1    MKGGRILLLLVCSSVITLGVFAAGPPTCPADLGGKC-SDSEEWEGEFFPGIPKIKYEGPS  59

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+FKWYNAEEEILGKKMKDWMRFS+AFWHTFRGTG DPFG
Sbjct  60   SKNPLAFKWYNAEEEILGKKMKDWMRFSIAFWHTFRGTGGDPFG  103



>ref|XP_011079316.1| PREDICTED: xylose isomerase [Sesamum indicum]
 ref|XP_011079317.1| PREDICTED: xylose isomerase [Sesamum indicum]
Length=477

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 1/88 (1%)
 Frame = +1

Query  142  SNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEI  321
            SNIV AA PPTCPADI SDCA+ SGEWEGEFFPGIP+IKYEGPSSKNPL+FKWYNAEEEI
Sbjct  17   SNIV-AAAPPTCPADIGSDCATSSGEWEGEFFPGIPEIKYEGPSSKNPLAFKWYNAEEEI  75

Query  322  LGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            LGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  76   LGKKMKDWMRFSVAFWHTFRGTGGDPFG  103



>emb|CDP02939.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M A K+L L  CL+++ N+V+A GPPTCPAD+ S CAS S EW+GEFFPGIPKIKYEGP 
Sbjct  1    MKAWKILSLCLCLSLVLNVVIAVGPPTCPADVGSGCASDSDEWQGEFFPGIPKIKYEGPK  60

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL++KWYNA+EEILGKKMKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  61   SKNPLAYKWYNADEEILGKKMKDWMRFSVAFWHTFRGTGADPFG  104



>ref|XP_007011130.1| Xylose isomerase family protein isoform 4 [Theobroma cacao]
 gb|EOY19940.1| Xylose isomerase family protein isoform 4 [Theobroma cacao]
Length=414

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGEFFPGIPKIKYEG SS
Sbjct  8    MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGEFFPGIPKIKYEGTSS  65

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  66   KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  108



>ref|XP_007011129.1| Xylose isomerase family protein isoform 3 [Theobroma cacao]
 gb|EOY19939.1| Xylose isomerase family protein isoform 3 [Theobroma cacao]
Length=409

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGEFFPGIPKIKYEG SS
Sbjct  8    MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGEFFPGIPKIKYEGTSS  65

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  66   KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  108



>ref|XP_007011127.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY19937.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
Length=538

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGEFFPGIPKIKYEG SS
Sbjct  64   MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGEFFPGIPKIKYEGTSS  121

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  122  KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  164



>ref|XP_002532409.1| Xylose isomerase, putative [Ricinus communis]
 gb|EEF29973.1| Xylose isomerase, putative [Ricinus communis]
Length=477

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M  G +L LL CLN +++ V+AAGPPTCPAD+   CA  S EW+GEFFPGIPKIKYEGPS
Sbjct  1    MKGGWILLLLLCLNTVTSGVIAAGPPTCPADLGGKCAD-SDEWKGEFFPGIPKIKYEGPS  59

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL++KWYNAEEEILGKKMKDWMRFS+AFWHTFRGTG+DPFG
Sbjct  60   SKNPLAYKWYNAEEEILGKKMKDWMRFSIAFWHTFRGTGADPFG  103



>ref|XP_004297371.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
 ref|XP_011463128.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
Length=478

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 2/106 (2%)
 Frame = +1

Query  88   IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEG  267
            + M A K+L LL C++      + AGP TCPAD+ SDC + SGEW+GEFFP IPKIKYEG
Sbjct  1    MKMKAEKILLLLVCVSFWI-FGVTAGPQTCPADLESDC-NDSGEWKGEFFPEIPKIKYEG  58

Query  268  PSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            PSSKNPLS+KWYNAEEEILGKKMKDWMRFSVAFWHTFRG+G+DPFG
Sbjct  59   PSSKNPLSYKWYNAEEEILGKKMKDWMRFSVAFWHTFRGSGADPFG  104



>ref|XP_010102993.1| Xylose isomerase [Morus notabilis]
 gb|EXB94560.1| Xylose isomerase [Morus notabilis]
Length=523

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +1

Query  76   SRLMIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKI  255
            S   + M   ++L L+ CLN+++   +  GPPTCPA++ SDC   S EW+GEFFPGIPKI
Sbjct  42   SMRTMKMKPVEILLLVLCLNIVA-FGVNGGPPTCPANLESDCGD-SDEWKGEFFPGIPKI  99

Query  256  KYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KYEGPSSKNPL+FKWYNAEE ILGKKMKDW RFSVAFWHTFRGTG+DPFG
Sbjct  100  KYEGPSSKNPLAFKWYNAEEVILGKKMKDWFRFSVAFWHTFRGTGADPFG  149



>gb|KJB60238.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
 gb|KJB60242.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=475

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L L+  +N    IV A  P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAAFLIVNAV-PETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  58

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFRGTGADPFG  101



>gb|KJB60241.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=465

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L L+  +N    IV A  P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAAFLIVNAV-PETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  58

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFRGTGADPFG  101



>gb|KJB60239.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L L+  +N    IV A  P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAAFLIVNAV-PETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  58

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFRGTGADPFG  101



>ref|XP_009417936.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   159 bits (403),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 1/86 (1%)
 Frame = +1

Query  151  VMAAGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILG  327
            V+A GP TCPA++ + C  GS + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILG
Sbjct  19   VIAEGPHTCPANLEAKCDGGSSDGWEGEFFPGIPKIKYEGPTSKNPLSYKWYNAEEEILG  78

Query  328  KKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  79   KKMKDWLRFSVAFWHTFRGTGADPFG  104



>ref|XP_010259769.1| PREDICTED: xylose isomerase isoform X2 [Nelumbo nucifera]
Length=479

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = +1

Query  151  VMAAGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILG  327
            V+A GPPTCPAD  ++C+ S SGEWEGEFFPGIPKIKYEGPSSKNPL+FKWYNA EEILG
Sbjct  20   VIATGPPTCPADHITECSGSDSGEWEGEFFPGIPKIKYEGPSSKNPLAFKWYNANEEILG  79

Query  328  KKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  80   KKMKDWLRFSVAFWHTFRGTGADPFG  105



>ref|XP_010259768.1| PREDICTED: xylose isomerase isoform X1 [Nelumbo nucifera]
Length=515

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 1/86 (1%)
 Frame = +1

Query  151  VMAAGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILG  327
            V+A GPPTCPAD  ++C+ S SGEWEGEFFPGIPKIKYEGPSSKNPL+FKWYNA EEILG
Sbjct  56   VIATGPPTCPADHITECSGSDSGEWEGEFFPGIPKIKYEGPSSKNPLAFKWYNANEEILG  115

Query  328  KKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  116  KKMKDWLRFSVAFWHTFRGTGADPFG  141



>gb|KHG02217.1| Xylose isomerase -like protein [Gossypium arboreum]
Length=475

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L L+  +N +  IV A  P TCPAD+   C    GEWEGEFFP +PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMNAVFFIVNAV-PETCPADLGGKCGE-DGEWEGEFFPEVPKIKYEGPSS  58

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  59   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFRGTGADPFG  101



>gb|KJB60240.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L L+  +N  +  ++ A P TCPAD+   C    GEWEGEFFPG+PKIKYEGPSS
Sbjct  1    MAGRILLLVLFMN--AAFLINAVPETCPADLGGKCGE-DGEWEGEFFPGVPKIKYEGPSS  57

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  58   KNPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFRGTGADPFG  100



>ref|XP_010065877.1| PREDICTED: xylose isomerase-like isoform X2 [Eucalyptus grandis]
Length=308

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  261
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  262  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGGDPFG  106



>ref|XP_006845583.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
 gb|ERN07258.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
Length=477

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = +1

Query  109  VLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPL  288
            +L LL  L  I    +AA PPTCPA+I+S CA     W+GEFFPGIPKIKYEGPSSKNPL
Sbjct  6    ILRLLLSLTCILFSAVAANPPTCPANIDSGCADDV--WKGEFFPGIPKIKYEGPSSKNPL  63

Query  289  SFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            ++KWYNA+EEILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  64   AYKWYNADEEILGKKMKDWLRFSVAFWHTFRGTGGDPFG  102



>gb|KCW63564.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
 gb|KCW63565.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
Length=495

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  261
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  262  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGGDPFG  106



>ref|XP_010065878.1| PREDICTED: xylose isomerase-like isoform X3 [Eucalyptus grandis]
Length=480

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  261
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  262  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGGDPFG  106



>ref|XP_010065874.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065875.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065876.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
Length=467

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKY  261
            M  M  GK+LF+L C ++    V+AA PPTCPA D+  +C     +W+GEFFPGIP IKY
Sbjct  1    MKRMELGKILFVLLCASLAIAGVVAA-PPTCPANDLGGECGDAD-DWKGEFFPGIPNIKY  58

Query  262  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EGPSSKNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  59   EGPSSKNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGGDPFG  106



>ref|XP_007222807.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
 gb|EMJ24006.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
Length=479

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 92/107 (86%), Gaps = 3/107 (3%)
 Frame = +1

Query  88   IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYE  264
            + M AG++L LL CLNV++  V+A GP TCPA D+ S C S S EW+GEFFPGIPKIKYE
Sbjct  1    MKMKAGRILLLLLCLNVVTFGVIA-GPQTCPASDLESGC-SDSEEWKGEFFPGIPKIKYE  58

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPLSFKWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  59   GPSSKNPLSFKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGGDPFG  105



>ref|XP_010414290.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=171

 Score =   148 bits (373),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL CL + ++ +++A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS
Sbjct  1    MKKVEFFILLLCL-IAASFLVSADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +KNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   TKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>ref|XP_006401183.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
 gb|ESQ42636.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
Length=482

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  264
            MI  M    + LL      ++ +++A PPTCPAD+   C+ GS +WEGEFFP IP+IKYE
Sbjct  1    MIQTMKKVEILLLLLCLNAASFLVSADPPTCPADLGGKCSDGSDDWEGEFFPEIPQIKYE  60

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  61   GPSSKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  107



>dbj|BAJ34093.1| unnamed protein product [Thellungiella halophila]
Length=482

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  264
            MI  M    + LL      ++ +++A PPTCPAD+   C+ GS +WEGEFFP IP+IKYE
Sbjct  1    MIQTMKKVEILLLLLCLNAASFLVSADPPTCPADLGGKCSDGSDDWEGEFFPEIPQIKYE  60

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  61   GPSSKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  107



>ref|XP_006453438.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
 ref|XP_006474142.1| PREDICTED: xylose isomerase-like [Citrus sinensis]
 gb|ESR66678.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
Length=478

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M A K+L LLFCLN++S++V+A  PPTC A+++S CA  S EW+GEFFPGIPKIKYEGPS
Sbjct  2    MEAQKILLLLFCLNLVSSLVIAGAPPTCAANLDSKCAD-SDEWKGEFFPGIPKIKYEGPS  60

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKN L+FKWYN EE ILGKKMKDWMRFSVAFWHTFRGTGSDPFG
Sbjct  61   SKNHLAFKWYNPEEVILGKKMKDWMRFSVAFWHTFRGTGSDPFG  104



>ref|XP_004958625.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   154 bits (388),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPAD++S C  G SG+WEGEFFPGIPKI YEGP+SKNPL++KWYNAEE ILGKKM
Sbjct  23   AAQQTCPADLDSKCEDGASGDWEGEFFPGIPKINYEGPTSKNPLAYKWYNAEEVILGKKM  82

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDWMRFSVAFWHTFRGTG+DPFG
Sbjct  83   KDWMRFSVAFWHTFRGTGADPFG  105



>ref|XP_008223675.1| PREDICTED: xylose isomerase [Prunus mume]
Length=479

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +1

Query  88   IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYE  264
            + M AG++L LL CLNV++  V+A  P TCPA D+ S C S S EW+GEFFPGIPKIKYE
Sbjct  1    MKMKAGRILLLLLCLNVVTFGVIAV-PQTCPASDLESGC-SDSEEWKGEFFPGIPKIKYE  58

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKNPLSFKWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  59   GPSSKNPLSFKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGGDPFG  105



>ref|XP_008796227.1| PREDICTED: xylose isomerase isoform X1 [Phoenix dactylifera]
Length=529

 Score =   154 bits (389),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A P TCPA++ + C   S + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILGKKM
Sbjct  72   AAPQTCPANLEAKCNDASSDDWEGEFFPGIPKIKYEGPTSKNPLSYKWYNAEEEILGKKM  131

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDW RFSVAFWHTFRGTG+DPFG
Sbjct  132  KDWFRFSVAFWHTFRGTGADPFG  154



>ref|NP_851203.1| xylose isomerase [Arabidopsis thaliana]
 gb|AED96931.1| xylose isomerase [Arabidopsis thaliana]
Length=287

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPS
Sbjct  1    MKKVEFFMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   SKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>gb|AGV54617.1| xylose isomerase [Phaseolus vulgaris]
Length=480

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +1

Query  85   MIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE  264
            M+ M  G+ L L  CL V    V+A  P TCPA     C    G WEGEFFPGIP IKYE
Sbjct  1    MMKMKLGRTLLLFLCLKVFCYAVIAT-PQTCPASNVDKCGDSDG-WEGEFFPGIPTIKYE  58

Query  265  GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            GPSSKN LSFKWYN EEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  59   GPSSKNQLSFKWYNPEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  105



>ref|XP_008452100.1| PREDICTED: xylose isomerase [Cucumis melo]
 ref|XP_008452108.1| PREDICTED: xylose isomerase [Cucumis melo]
Length=476

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 87/101 (86%), Gaps = 4/101 (4%)
 Frame = +1

Query  106  KVLFLLFCLNVISNIVMA-AGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKN  282
            ++  L+ CL  +  +V A A   TCPAD+NS+C S SG+WEG+FFPGIPKIKYEGP+SKN
Sbjct  5    EISVLVLCL--LGFVVGAIADSHTCPADLNSEC-SHSGDWEGDFFPGIPKIKYEGPTSKN  61

Query  283  PLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            PL++KWYNA+EEILGKKMKDWMRFSVA+WHTFRGTG+DPFG
Sbjct  62   PLAYKWYNADEEILGKKMKDWMRFSVAYWHTFRGTGADPFG  102



>ref|XP_002864523.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40782.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
Length=477

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +1

Query  112  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  291
              LL CL + ++ +++A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPSSKNPL+
Sbjct  7    FMLLLCL-IAASFLVSADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPSSKNPLA  64

Query  292  FKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            ++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  65   YRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>ref|XP_008365436.1| PREDICTED: xylose isomerase-like [Malus domestica]
 ref|XP_008365437.1| PREDICTED: xylose isomerase-like [Malus domestica]
Length=477

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYEGP  270
            M AG++L LL CLNVI+  V+A   PTCPA D+ S C   S EWEGEFFPGIPKIKYEGP
Sbjct  1    MRAGRILLLLLCLNVITFGVIA-DSPTCPASDLGSGCGD-SDEWEGEFFPGIPKIKYEGP  58

Query  271  SSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            S+KNPL+FKWYNA+EEILGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  59   STKNPLAFKWYNADEEILGKKMKDWMRFSVAFWHTFRGTGGDPFG  103



>ref|XP_007154797.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
 gb|ESW26791.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
Length=479

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +1

Query  88   IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEG  267
            + M  G+ L L  CL V    V+A  P TCPA     C    G WEGEFFPGIP IKYEG
Sbjct  1    MKMKLGRTLLLFLCLKVFCYAVIAT-PQTCPASNVDKCGDSDG-WEGEFFPGIPTIKYEG  58

Query  268  PSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            PSSKN LSFKWYN EEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  59   PSSKNQLSFKWYNPEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  104



>ref|XP_010102992.1| Xylose isomerase [Morus notabilis]
 gb|EXB94559.1| Xylose isomerase [Morus notabilis]
Length=482

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  151  VMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGK  330
            ++  GPPTCPA++ SDC   S EW+GEFFPGIPKIKYEGPSSKNPL+FKWYNAEE ILGK
Sbjct  25   MINGGPPTCPANLESDCGD-SDEWKGEFFPGIPKIKYEGPSSKNPLAFKWYNAEEVILGK  83

Query  331  KMKDWMRFSVAFWHTFRGTGSDPFG  405
            KMKDW RFSVAFWHTFRGTG+DPFG
Sbjct  84   KMKDWFRFSVAFWHTFRGTGADPFG  108



>ref|XP_004149070.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
 ref|XP_004166789.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
Length=476

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 77/82 (94%), Gaps = 1/82 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMK  339
            A   TCPAD++S+C S SG+WEGEFFPGIPKIKYEGP+SKNPL++KWYNA+EEILGKKMK
Sbjct  22   ANSHTCPADLSSEC-SHSGDWEGEFFPGIPKIKYEGPTSKNPLAYKWYNADEEILGKKMK  80

Query  340  DWMRFSVAFWHTFRGTGSDPFG  405
            DWMRFSVA+WHTFRGTG+DPFG
Sbjct  81   DWMRFSVAYWHTFRGTGADPFG  102



>ref|NP_568861.3| xylose isomerase [Arabidopsis thaliana]
 sp|Q9FKK7.2|XYLA_ARATH RecName: Full=Xylose isomerase [Arabidopsis thaliana]
 gb|AAM97134.1| expressed protein; supported by full length cDNA: Ceres: 122798 
[Arabidopsis thaliana]
 gb|AAP31951.1| At5g57655 [Arabidopsis thaliana]
 gb|AED96932.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPS
Sbjct  1    MKKVEFFMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   SKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>gb|KGN61107.1| hypothetical protein Csa_2G049960 [Cucumis sativus]
Length=476

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 77/82 (94%), Gaps = 1/82 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMK  339
            A   TCPAD++S+C S SG+WEGEFFPGIPKIKYEGP+SKNPL++KWYNA+EEILGKKMK
Sbjct  22   ANSHTCPADLSSEC-SHSGDWEGEFFPGIPKIKYEGPTSKNPLAYKWYNADEEILGKKMK  80

Query  340  DWMRFSVAFWHTFRGTGSDPFG  405
            DWMRFSVA+WHTFRGTG+DPFG
Sbjct  81   DWMRFSVAYWHTFRGTGADPFG  102



>dbj|BAE98492.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPS
Sbjct  1    MKKVEFFMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   SKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>ref|XP_006658089.1| PREDICTED: xylose isomerase-like [Oryza brachyantha]
Length=480

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 2/83 (2%)
 Frame = +1

Query  163  GPPTCPADINSDC--ASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
             P TCPAD++S C  A+ SG+WEGEFFPGIPKIKYEGPSSKNPL++KWYNAEE ILGKKM
Sbjct  23   APQTCPADLDSKCDDAAASGDWEGEFFPGIPKIKYEGPSSKNPLAYKWYNAEEVILGKKM  82

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDWMRFSVAFWHTFRG G+DPFG
Sbjct  83   KDWMRFSVAFWHTFRGNGADPFG  105



>dbj|BAB08802.1| xylose isomerase [Arabidopsis thaliana]
Length=472

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKYEGPS
Sbjct  1    MKKVEFFMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   SKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>ref|XP_004958079.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   151 bits (381),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPAD++  C  G S +WEGEFFPGIPKIKYEGP SKNPL++KWYNAEE ILGKKM
Sbjct  23   AAQQTCPADLDRKCEGGASDDWEGEFFPGIPKIKYEGPKSKNPLAYKWYNAEEVILGKKM  82

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDWMRFSVAFWHTFRGTG+DPFG
Sbjct  83   KDWMRFSVAFWHTFRGTGADPFG  105



>emb|CAN65150.1| hypothetical protein VITISV_037086 [Vitis vinifera]
Length=462

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  154  MAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  333
            +A+ P TCPAD  S     S EWEGEFFPGIPKIKYEGPSSKNPLS+KWYNA+EEILGKK
Sbjct  5    IASSPQTCPADDVSSKCGASDEWEGEFFPGIPKIKYEGPSSKNPLSYKWYNADEEILGKK  64

Query  334  MKDWMRFSVAFWHTFRGTGSDPFG  405
            MKDWMRFSVAFWHTFRGTG DPFG
Sbjct  65   MKDWMRFSVAFWHTFRGTGGDPFG  88



>ref|XP_009336656.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYEGP  270
            M AG++L LL CLNV++  V+A   PTCPA D+ S C   S EWEGEFFPGIPKIKYEGP
Sbjct  1    MKAGRILLLLLCLNVVTFGVIA-DLPTCPASDLGSGCGD-SDEWEGEFFPGIPKIKYEGP  58

Query  271  SSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            S+KNPL+FKWYNA+EEILGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  59   STKNPLAFKWYNADEEILGKKMKDWMRFSVAFWHTFRGTGGDPFG  103



>ref|XP_009348411.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPA-DINSDCASGSGEWEGEFFPGIPKIKYEGP  270
            M AG++L LL CLNV++  V+A   PTCPA D+ S C   S EWEGEFFPGIPKIKYEGP
Sbjct  1    MKAGRILLLLLCLNVVTFGVIA-DLPTCPASDLGSGCGD-SDEWEGEFFPGIPKIKYEGP  58

Query  271  SSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            S+KNPL+FKWYNA+EEILGKKMKDWMRFSVAFWHTFRGTG DPFG
Sbjct  59   STKNPLAFKWYNADEEILGKKMKDWMRFSVAFWHTFRGTGGDPFG  103



>emb|CDY25894.1| BnaC09g32660D [Brassica napus]
Length=491

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 4/102 (4%)
 Frame = +1

Query  106  KVLFLLF--CLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSK  279
            KV F +F  CLN  S +V +A   TCPAD+   C S S EW+GEFFPGIP+IKYEGPSSK
Sbjct  17   KVCFFMFLLCLNAASFLV-SAESQTCPADLGGKC-SDSDEWQGEFFPGIPQIKYEGPSSK  74

Query  280  NPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            NPL+++WYNAEEEILGKKMK+W RFSVAFWHTFRGTG DPFG
Sbjct  75   NPLAYRWYNAEEEILGKKMKEWFRFSVAFWHTFRGTGGDPFG  116



>ref|XP_006280396.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
 gb|EOA13294.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
Length=477

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL CL + ++ ++ A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS
Sbjct  1    MKKVEFFMLLLCL-IAASFLVCADPPTCPADLDGKC-SDSDDWKGDFFPEIPNIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   SKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>ref|XP_010483295.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL CL + ++ ++ A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS
Sbjct  1    MKKVEFFILLLCL-IAASFLVCADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +KNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   TKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>gb|ACG35698.1| xylose isomerase [Zea mays]
Length=484

 Score =   150 bits (378),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  333
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  26   AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  85

Query  334  MKDWMRFSVAFWHTFRGTGSDPFG  405
            MKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  86   MKDWMRFSVAFWHTFRGTGADPFG  109



>ref|XP_009120281.1| PREDICTED: xylose isomerase [Brassica rapa]
 ref|XP_009120282.1| PREDICTED: xylose isomerase [Brassica rapa]
Length=477

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = +1

Query  109  VLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPL  288
            +  +L CLN  S +V +A   TCPAD+   C S S +W+GEFFPGIP+I+YEGPSSKNPL
Sbjct  6    LFMILVCLNAASFLV-SAESQTCPADLGGKC-SDSDDWQGEFFPGIPQIRYEGPSSKNPL  63

Query  289  SFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +++WYNAEEE+LGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  64   AYRWYNAEEEVLGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>ref|XP_010452612.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL CL + ++ +++A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS
Sbjct  1    MKKVEFFMLLLCL-IGASFLVSADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +KNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   TKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>gb|AAM61519.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL C    S++V +A PPTCPAD+   C S S +W+G+FFP IPKIKY+GPS
Sbjct  1    MKKVEFFMLLLCFIAASSLV-SADPPTCPADLGGKC-SDSDDWQGDFFPEIPKIKYKGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   SKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>ref|NP_001132653.1| uncharacterized protein LOC100194128 precursor [Zea mays]
 ref|XP_008650948.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 ref|XP_008650949.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 gb|ACF81585.1| unknown [Zea mays]
Length=484

 Score =   149 bits (377),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  333
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  26   AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  85

Query  334  MKDWMRFSVAFWHTFRGTGSDPFG  405
            MKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  86   MKDWMRFSVAFWHTFRGTGADPFG  109



>ref|NP_001060585.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAC83596.1| putative xylose isomerase [Oryza sativa Japonica Group]
 dbj|BAF22499.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAG92890.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPAD++S C  + SG+WEGEFFPGIPKIKYEGPSSKNPL++KWYNAEE ILGKKM
Sbjct  22   ATQQTCPADLDSKCGDAASGDWEGEFFPGIPKIKYEGPSSKNPLAYKWYNAEEVILGKKM  81

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDWMRFSVAFWHTFRGTG DPFG
Sbjct  82   KDWMRFSVAFWHTFRGTGGDPFG  104



>gb|EEC82655.1| hypothetical protein OsI_27268 [Oryza sativa Indica Group]
 gb|EEE67782.1| hypothetical protein OsJ_25511 [Oryza sativa Japonica Group]
Length=478

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPAD++S C  + SG+WEGEFFPGIPKIKYEGPSSKNPL++KWYNAEE ILGKKM
Sbjct  21   ATQQTCPADLDSKCGDAASGDWEGEFFPGIPKIKYEGPSSKNPLAYKWYNAEEVILGKKM  80

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDWMRFSVAFWHTFRGTG DPFG
Sbjct  81   KDWMRFSVAFWHTFRGTGGDPFG  103



>ref|XP_003549495.1| PREDICTED: xylose isomerase [Glycine max]
Length=480

 Score =   149 bits (377),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 70/94 (74%), Positives = 74/94 (79%), Gaps = 7/94 (7%)
 Frame = +1

Query  124  FCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWY  303
            FC  VI        P TCPA+ N D    S EW+GEFFP IPKIKYEGPSSKN LSFKWY
Sbjct  19   FCYAVI------GAPQTCPAN-NEDKCGDSDEWKGEFFPDIPKIKYEGPSSKNVLSFKWY  71

Query  304  NAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            NAEEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  72   NAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  105



>emb|CDY49729.1| BnaA10g11590D [Brassica napus]
Length=477

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 2/99 (2%)
 Frame = +1

Query  109  VLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPL  288
            +  +L CLN  S +V +A   TCPAD+   C S S +W+GEFFPGIP+IKYEGP+SKNPL
Sbjct  6    LFMILVCLNAASFLV-SAESQTCPADLGGKC-SDSDDWQGEFFPGIPQIKYEGPASKNPL  63

Query  289  SFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +++WYNAEEE+LGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  64   AYRWYNAEEEVLGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>gb|KHN17567.1| Xylose isomerase [Glycine soja]
Length=480

 Score =   149 bits (376),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 70/94 (74%), Positives = 74/94 (79%), Gaps = 7/94 (7%)
 Frame = +1

Query  124  FCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWY  303
            FC  VI        P TCPA+ N D    S EW+GEFFP IPKIKYEGPSSKN LSFKWY
Sbjct  19   FCYAVI------GAPQTCPAN-NEDKCGDSDEWKGEFFPDIPKIKYEGPSSKNVLSFKWY  71

Query  304  NAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            NAEEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  72   NAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  105



>ref|XP_008650947.1| PREDICTED: uncharacterized protein LOC100194128 isoform X2 [Zea 
mays]
Length=533

 Score =   149 bits (377),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  333
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  75   AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  134

Query  334  MKDWMRFSVAFWHTFRGTGSDPFG  405
            MKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  135  MKDWMRFSVAFWHTFRGTGADPFG  158



>ref|XP_010443465.1| PREDICTED: xylose isomerase [Camelina sativa]
Length=477

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   +   LL CL + ++ ++ A PPTCPAD++  C S S +W+G+FFP IP IKYEGPS
Sbjct  1    MKKVEFFMLLLCL-IGASFLVCADPPTCPADLDGKC-SDSDDWQGDFFPEIPNIKYEGPS  58

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +KNPL+++WYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   TKNPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>gb|ACG42142.1| xylose isomerase [Zea mays]
Length=484

 Score =   149 bits (375),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 1/79 (1%)
 Frame = +1

Query  172  TCPADINSDCASGS-GEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWM  348
            TCPAD++S C  G+  +WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKKMKDWM
Sbjct  31   TCPADLDSKCDGGAPDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKKMKDWM  90

Query  349  RFSVAFWHTFRGTGSDPFG  405
            RFSVAFWHTFRGTG+DPFG
Sbjct  91   RFSVAFWHTFRGTGADPFG  109



>ref|NP_001132889.1| putative xylose isomerase family protein precursor [Zea mays]
 gb|ACF81922.1| unknown [Zea mays]
 gb|ACG41148.1| xylose isomerase [Zea mays]
 tpg|DAA41688.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=482

 Score =   149 bits (375),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 1/79 (1%)
 Frame = +1

Query  172  TCPADINSDCASGS-GEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWM  348
            TCPAD++S C  G+  +WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKKMKDWM
Sbjct  29   TCPADLDSKCDGGAPDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKKMKDWM  88

Query  349  RFSVAFWHTFRGTGSDPFG  405
            RFSVAFWHTFRGTG+DPFG
Sbjct  89   RFSVAFWHTFRGTGADPFG  107



>ref|XP_003562496.1| PREDICTED: xylose isomerase [Brachypodium distachyon]
Length=479

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPS  273
            M G  L  L   + +      A   TCPAD+++ C  G S +WEGEFFPGIPKIKYEGP+
Sbjct  1    MKGAELLTLLVASFLCLSAAIAAQETCPADLDAKCGDGASDDWEGEFFPGIPKIKYEGPT  60

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SK PLS+KWYNAEE ILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  61   SKKPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFRGTGGDPFG  104



>gb|KDO62435.1| hypothetical protein CISIN_1g0373932mg, partial [Citrus sinensis]
Length=487

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +1

Query  151  VMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGK  330
            V+A  PPTC A+++S CA  S EW+GEFFPGIPKIKYEGPSSKN L+FKWYN EE ILGK
Sbjct  30   VIAGAPPTCAANLDSKCAD-SDEWKGEFFPGIPKIKYEGPSSKNHLAFKWYNPEEVILGK  88

Query  331  KMKDWMRFSVAFWHTFRGTGSDPFG  405
            KMKDWMRFSVAFWHTFRGTGSDPFG
Sbjct  89   KMKDWMRFSVAFWHTFRGTGSDPFG  113



>ref|XP_008796228.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796229.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796230.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
Length=483

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A P TCPA++ + C   S + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILGKKM
Sbjct  26   AAPQTCPANLEAKCNDASSDDWEGEFFPGIPKIKYEGPTSKNPLSYKWYNAEEEILGKKM  85

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDW RFSVAFWHTFRGTG+DPFG
Sbjct  86   KDWFRFSVAFWHTFRGTGADPFG  108



>ref|XP_010938719.1| PREDICTED: xylose isomerase [Elaeis guineensis]
Length=479

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A P TCPA++ + C   S + WEGEFFPGIPKIKYEGP+SKNPLS+KWYNAEEEILGKKM
Sbjct  22   ATPQTCPANLEAKCNDASSDDWEGEFFPGIPKIKYEGPASKNPLSYKWYNAEEEILGKKM  81

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDW RFSVAFWHTFRGTG+DPFG
Sbjct  82   KDWFRFSVAFWHTFRGTGADPFG  104



>gb|ACU18251.1| unknown [Glycine max]
Length=203

 Score =   141 bits (355),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 74/94 (79%), Gaps = 7/94 (7%)
 Frame = +1

Query  124  FCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWY  303
            FC  VI        P TCPA+ N D    S EW+GEFFP IPKIKYEGPSSKN LSFKWY
Sbjct  19   FCYAVI------GAPQTCPAN-NEDKCGDSDEWKGEFFPDIPKIKYEGPSSKNVLSFKWY  71

Query  304  NAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            NAEEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  72   NAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  105



>ref|XP_010688509.1| PREDICTED: xylose isomerase isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = +1

Query  70   SHSRLMIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIP  249
            S +R+ I M     L LL C  ++   V+A GPPTCPA+  S C  G   WEGEFFP IP
Sbjct  8    SKNRMRIRMN----LLLLCCFTLVLTAVVAVGPPTCPAE-GSGC--GDDGWEGEFFPEIP  60

Query  250  KIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KIKYEGP SKN L+FK+YNAEE ILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  61   KIKYEGPKSKNHLAFKYYNAEEVILGKKMKDWFRFSVAFWHTFRGTGGDPFG  112



>ref|XP_010688508.1| PREDICTED: xylose isomerase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=517

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 82/112 (73%), Gaps = 7/112 (6%)
 Frame = +1

Query  70   SHSRLMIDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIP  249
            S +R+ I M     L LL C  ++   V+A GPPTCPA+  S C  G   WEGEFFP IP
Sbjct  39   SKNRMRIRMN----LLLLCCFTLVLTAVVAVGPPTCPAE-GSGC--GDDGWEGEFFPEIP  91

Query  250  KIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KIKYEGP SKN L+FK+YNAEE ILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  92   KIKYEGPKSKNHLAFKYYNAEEVILGKKMKDWFRFSVAFWHTFRGTGGDPFG  143



>tpg|DAA64056.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=456

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  333
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  101  AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  160

Query  334  MKDWMRFSVAFWHTFRGTGSDPFG  405
            MKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  161  MKDWMRFSVAFWHTFRGTGADPFG  184



>tpg|DAA64057.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=559

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE--WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  333
            A   TCPAD++S C  G+ +  WEGEFFPG+PKIKYEGP+SKNPL++KWYN EE ILGKK
Sbjct  101  AAQQTCPADLDSKCDGGASDDDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKK  160

Query  334  MKDWMRFSVAFWHTFRGTGSDPFG  405
            MKDWMRFSVAFWHTFRGTG+DPFG
Sbjct  161  MKDWMRFSVAFWHTFRGTGADPFG  184



>ref|XP_010688511.1| PREDICTED: xylose isomerase isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = +1

Query  112  LFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLS  291
            L LL C  ++   V+A GPPTCPA+  S C  G   WEGEFFP IPKIKYEGP SKN L+
Sbjct  7    LLLLCCFTLVLTAVVAVGPPTCPAE-GSGC--GDDGWEGEFFPEIPKIKYEGPKSKNHLA  63

Query  292  FKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FK+YNAEE ILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  64   FKYYNAEEVILGKKMKDWFRFSVAFWHTFRGTGGDPFG  101



>gb|EPS67638.1| xylose isomerase [Genlisea aurea]
Length=472

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 80/102 (78%), Gaps = 9/102 (9%)
 Frame = +1

Query  106  KVLFLLFCLNVIS--NIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSK  279
            K +F +F +++++  N+  AA PPTCPAD+ S C       EGEFFPG+P I YEGPSS 
Sbjct  3    KAVFSVFIISLLAVPNVTNAAVPPTCPADLESSC-------EGEFFPGVPNILYEGPSSN  55

Query  280  NPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            NPL+FKWYNAEE ILGKKMK+W+RFSVAFWHTFRGTG DPFG
Sbjct  56   NPLAFKWYNAEEVILGKKMKEWLRFSVAFWHTFRGTGGDPFG  97



>ref|XP_009391575.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = +1

Query  139  ISNIVMAAGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEE  315
            + + V A G  TC A++ + C  GS + W+GEFFPGI KIKYEGP+SKNPLS+KWYNAEE
Sbjct  15   VVSTVNAEGQQTCAANLEAKCDGGSSDGWKGEFFPGISKIKYEGPTSKNPLSYKWYNAEE  74

Query  316  EILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EILGKKMKDW RFSVAFWHTFRGTG+DPFG
Sbjct  75   EILGKKMKDWFRFSVAFWHTFRGTGADPFG  104



>ref|XP_010539451.1| PREDICTED: xylose isomerase [Tarenaya hassleriana]
Length=477

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +1

Query  142  SNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEI  321
            ++ ++ A  PTCPAD+   C   S +W+GEFF GIPKIKYEGPSSKNPL+FKWYNAEEEI
Sbjct  16   ASFLVFAEAPTCPADLGGKC-DDSDDWKGEFFAGIPKIKYEGPSSKNPLAFKWYNAEEEI  74

Query  322  LGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            LGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  75   LGKKMKDWFRFSVAFWHTFRGTGGDPFG  102



>gb|AFK33995.1| unknown [Lotus japonicus]
Length=173

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 82/106 (77%), Gaps = 2/106 (2%)
 Frame = +1

Query  88   IDMMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEG  267
            + M  G++L LL CL V    V+ A P TCPA+    C   S EW+GEFFPGI KIKYEG
Sbjct  1    MKMKPGEILLLLLCLKVFIYAVIDA-PETCPANDLGKCGD-SDEWKGEFFPGISKIKYEG  58

Query  268  PSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            PSSKNPLSFKWYNAEEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  59   PSSKNPLSFKWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFG  104



>ref|XP_003610179.1| Xylose isomerase [Medicago truncatula]
Length=478

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M +GK+L LL   NV     +   P TCPA  ++ C   S +W+ EFFPGI KIKYEGPS
Sbjct  1    MKSGKLLLLLLSFNVFYYAAVNCAPQTCPATKDAKCGD-SDDWKAEFFPGISKIKYEGPS  59

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPLSFKWYN EEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  60   SKNPLSFKWYNPEEEILGKKMKDWFRFSVAFWHTFRGTGVDPFG  103



>gb|AES92376.2| xylose isomerase [Medicago truncatula]
Length=480

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M +GK+L LL   NV     +   P TCPA  ++ C   S +W+ EFFPGI KIKYEGPS
Sbjct  3    MKSGKLLLLLLSFNVFYYAAVNCAPQTCPATKDAKCGD-SDDWKAEFFPGISKIKYEGPS  61

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPLSFKWYN EEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  62   SKNPLSFKWYNPEEEILGKKMKDWFRFSVAFWHTFRGTGVDPFG  105



>ref|XP_004507817.1| PREDICTED: xylose isomerase-like isoform X3 [Cicer arietinum]
Length=479

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +1

Query  163  GPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKD  342
             P TCPA  N   +  S EWEGEFFPGI KIKYEGPSSKNPLSFKWYNAEEEI+GKKMKD
Sbjct  25   APQTCPA-TNVGKSGDSDEWEGEFFPGISKIKYEGPSSKNPLSFKWYNAEEEIIGKKMKD  83

Query  343  WMRFSVAFWHTFRGTGSDPFG  405
            W RFSVAFWHTFRGTG DPFG
Sbjct  84   WFRFSVAFWHTFRGTGGDPFG  104



>ref|XP_004507815.1| PREDICTED: xylose isomerase-like isoform X1 [Cicer arietinum]
 ref|XP_004507816.1| PREDICTED: xylose isomerase-like isoform X2 [Cicer arietinum]
Length=491

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +1

Query  163  GPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKD  342
             P TCPA  N   +  S EWEGEFFPGI KIKYEGPSSKNPLSFKWYNAEEEI+GKKMKD
Sbjct  25   APQTCPA-TNVGKSGDSDEWEGEFFPGISKIKYEGPSSKNPLSFKWYNAEEEIIGKKMKD  83

Query  343  WMRFSVAFWHTFRGTGSDPFG  405
            W RFSVAFWHTFRGTG DPFG
Sbjct  84   WFRFSVAFWHTFRGTGGDPFG  104



>gb|AFK39166.1| unknown [Medicago truncatula]
Length=480

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M +GK+L LL   NV     +   P TCPA  ++ C   S +W+ EFFPGI KIKYEGPS
Sbjct  3    MKSGKLLLLLLSFNVFYYAAVNCAPQTCPATKDAKCGD-SDDWKAEFFPGISKIKYEGPS  61

Query  274  SKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            SKNPLSFKW+N EEEILGKKMKDW RFSVAFWHTFRGTG DPFG
Sbjct  62   SKNPLSFKWHNPEEEILGKKMKDWFRFSVAFWHTFRGTGVDPFG  105



>dbj|BAJ96683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPADI + C  + S +WEGEFFPGI KI YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  22   AAQETCPADIGAKCGDAASDDWEGEFFPGIAKINYEGPTSKKPLSYKWYNAEEVILGKKM  81

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDW+RFSVAFWHTFRGTG DPFG
Sbjct  82   KDWLRFSVAFWHTFRGTGGDPFG  104



>emb|CAA64544.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
 prf||2209268A xylose isomerase
Length=479

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPADI + C  + S +WEGEFFPGI KI YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  22   AAQETCPADIGAKCTDAASDDWEGEFFPGIDKINYEGPTSKKPLSYKWYNAEEVILGKKM  81

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDW RFSVAFWHTFRGTG DPFG
Sbjct  82   KDWFRFSVAFWHTFRGTGGDPFG  104



>sp|Q40082.1|XYLA_HORVU RecName: Full=Xylose isomerase [Hordeum vulgare]
 emb|CAA64545.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +1

Query  160  AGPPTCPADINSDCA-SGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPADI + C  + S +WEGEFFPGI KI YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  22   AAQETCPADIGAKCTDAASDDWEGEFFPGIDKINYEGPTSKKPLSYKWYNAEEVILGKKM  81

Query  337  KDWMRFSVAFWHTFRGTGSDPFG  405
            KDW RFSVAFWHTFRGTG DPFG
Sbjct  82   KDWFRFSVAFWHTFRGTGGDPFG  104



>emb|CDY58846.1| BnaA02g35220D [Brassica napus]
Length=221

 Score =   131 bits (329),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 77/112 (69%), Gaps = 10/112 (9%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYE---  264
            M   K+  +  C N  +  +++A P TCPAD    C SGS +WEGEFFP IP IKYE   
Sbjct  1    MKKVKIFMIFLCFNA-AFFLVSAEPQTCPADSGGKC-SGSDDWEGEFFPEIPHIKYELSD  58

Query  265  -----GPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
                 GP+S NPL++KWYNAEEEILGKKM DW RFSVAFW TFRGTG DPFG
Sbjct  59   QNHFFGPNSSNPLAYKWYNAEEEILGKKMNDWFRFSVAFWLTFRGTGGDPFG  110



>ref|XP_007011128.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
 gb|EOY19938.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
Length=471

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (74%), Gaps = 13/103 (13%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAG++L LL C+N +S IV A  P TCPAD+   CA    +WEGE           G SS
Sbjct  8    MAGRILLLLLCMNAVSFIVNAV-PQTCPADLGGKCAEDD-DWEGE-----------GTSS  54

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KNPL++KWYNAEEEILGKKMKDW+RFSVAFWHTFRGTG+DPFG
Sbjct  55   KNPLAYKWYNAEEEILGKKMKDWLRFSVAFWHTFRGTGADPFG  97



>gb|KJB68666.1| hypothetical protein B456_010G217000 [Gossypium raimondii]
Length=369

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = +1

Query  97   MAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSS  276
            MAGK+ ++  C+NVI  ++ AA    C A  ++ C S +GEW GEFFPGIPKIKYEGP +
Sbjct  1    MAGKISYIFLCMNVIP-LLAAAASQACSAQSDAKC-SQTGEWNGEFFPGIPKIKYEGPYT  58

Query  277  KNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KN  ++K YNAEE ILGKKMKDW+RFSVAFWHTFRGTG DPFG
Sbjct  59   KNKFAYKSYNAEEVILGKKMKDWLRFSVAFWHTFRGTGVDPFG  101



>ref|XP_002991182.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
 gb|EFJ07726.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
Length=478

 Score =   127 bits (319),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  190  NSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFW  369
            +  C SG  E E EFFP I KI+YEGPSSKNPL+FKWYN EEEI GKKMKDW+RFSVAFW
Sbjct  32   DQTCGSGFQEGEVEFFPNISKIEYEGPSSKNPLAFKWYNPEEEIYGKKMKDWLRFSVAFW  91

Query  370  HTFRGTGSDPFG  405
            HTFRG GSDPFG
Sbjct  92   HTFRGDGSDPFG  103



>ref|XP_002991242.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
 gb|EFJ07670.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
Length=476

 Score =   127 bits (319),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  190  NSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFW  369
            +  C SG  E E EFFP I KI+YEGPSSKNPL+FKWYN EEEI GKKMKDW+RFSVAFW
Sbjct  30   DQTCGSGFQEGEVEFFPNISKIEYEGPSSKNPLAFKWYNPEEEIYGKKMKDWLRFSVAFW  89

Query  370  HTFRGTGSDPFG  405
            HTFRG GSDPFG
Sbjct  90   HTFRGDGSDPFG  101



>gb|KIZ04907.1| xylose isomerase [Monoraphidium neglectum]
Length=472

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query  157  AAGPPTCPADINSDCASG-SGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKK  333
            +A PP   +  +  C+    GEW GEFFPGIPKIKYEGP S NPL+F++YNAEE I GK 
Sbjct  22   SAEPPADGSKADCGCSGDFKGEWYGEFFPGIPKIKYEGPKSTNPLAFRYYNAEEVISGKT  81

Query  334  MKDWMRFSVAFWHTFRGTGSDPFG  405
            MKDW+RFSVAFWHTFRG G DPFG
Sbjct  82   MKDWLRFSVAFWHTFRGDGGDPFG  105



>ref|XP_001774702.1| predicted protein [Physcomitrella patens]
 gb|EDQ60517.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  118  LLFCLNVISNIVMAAGPPTCPADINSDCASGSG--EWEGEFFPGIPKIKYEGPSSKNPLS  291
            LLF + ++  ++  +G          D + GS   EWEGEFFP I  IKYEGP+S NPL+
Sbjct  4    LLFSVVLLVAVLSCSGQRVADITCGVDGSLGSDFQEWEGEFFPNISYIKYEGPASHNPLA  63

Query  292  FKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +K+YNAEE I GKKMKDW+RFSVAFWHTFRG G DPFG
Sbjct  64   YKYYNAEELIFGKKMKDWLRFSVAFWHTFRGDGGDPFG  101



>ref|XP_005646804.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE22260.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
Length=471

 Score =   110 bits (276),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  181  ADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSV  360
            A I  +C S  G +EGEFFPG+ KI YEGP S NP++F +YNA+E I+GK MK+W+RFSV
Sbjct  19   AAIQGECDS-RGLYEGEFFPGVGKIPYEGPDSTNPMAFHYYNADEVIMGKPMKEWLRFSV  77

Query  361  AFWHTFRGTGSDPFG  405
            AFWHT RG G+DPFG
Sbjct  78   AFWHTMRGDGADPFG  92



>gb|AFG69667.1| hypothetical protein 2_5497_01, partial [Pinus taeda]
Length=164

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  250  KIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            KIKYEGP SKNPL+FKWYNAEEEILGKKMKDW+RFSV+FWHTFRG+G+DPFG
Sbjct  1    KIKYEGPLSKNPLAFKWYNAEEEILGKKMKDWLRFSVSFWHTFRGSGADPFG  52



>gb|KHN34792.1| Xylose isomerase [Glycine soja]
Length=153

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = +1

Query  139  ISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEE  318
            ++N  M   P TC A+ ++D    S EWEGEFFPGIPKIKYEGPSSK+PLSFKWYNAEEE
Sbjct  1    MANKQMIGAPQTCAAN-DADKCGDSDEWEGEFFPGIPKIKYEGPSSKSPLSFKWYNAEEE  59

Query  319  ILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            ILGKKMK   R  +A+        +DPFG
Sbjct  60   ILGKKMK---RCILAYKQVL---SADPFG  82



>emb|CDY02747.1| BnaC02g11420D [Brassica napus]
Length=309

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  94   MMAGKVLFLLFCLNVISNIVMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPS  273
            M   K+  +  C N  S +V +A P TCPAD    C SG  +WEGEFFP IP IKYEGP 
Sbjct  1    MKKVKIFMIFLCFNAASFLV-SADPQTCPADSGGKC-SGPDDWEGEFFPEIPHIKYEGPK  58

Query  274  SKNPLSFKWYNAEEEILGKKMK  339
            S NPL++KWYNAEEEILGKKMK
Sbjct  59   SSNPLTYKWYNAEEEILGKKMK  80



>ref|WP_013109552.1| xylose isomerase [Planctomyces limnophilus]
 gb|ADG67121.1| xylose isomerase [Planctomyces limnophilus DSM 3776]
Length=437

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP SKNPL+FK YNA+E+I G+ MKD +R+SVA+WHTFRGTGSDPFG
Sbjct  3    YFPEISKIVYEGPKSKNPLAFKHYNADEQIEGQSMKDLLRYSVAYWHTFRGTGSDPFG  60



>ref|WP_011118969.1| xylose isomerase [Rhodopirellula baltica]
 ref|NP_865078.2| xylose isomerase [Rhodopirellula baltica SH 1]
 sp|Q7UVG2.2|XYLA_RHOBA RecName: Full=Xylose isomerase [Rhodopirellula baltica SH 1]
Length=439

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFRGTG+DPFG
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFRGTGADPFG  60



>ref|WP_008655763.1| xylose isomerase [Rhodopirellula europaea]
 gb|EMB17313.1| xylose isomerase [Rhodopirellula europaea 6C]
 gb|EMI28379.1| xylose isomerase [Rhodopirellula europaea SH398]
Length=439

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFRGTG+DPFG
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFRGTGADPFG  60



>emb|CAD72762.1| xylose isomerase [Rhodopirellula baltica SH 1]
Length=454

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFRGTG+DPFG
Sbjct  19   FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFRGTGADPFG  75



>ref|WP_007335236.1| xylose isomerase [Rhodopirellula baltica]
 gb|EKJ98851.1| xylose isomerase [Rhodopirellula baltica SH28]
 gb|ELP31267.1| xylose isomerase [Rhodopirellula baltica SWK14]
Length=439

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFRGTG+DPFG
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFRGTGADPFG  60



>ref|WP_007324329.1| xylose isomerase [Rhodopirellula baltica]
 gb|EGF29596.1| xylose isomerase [Rhodopirellula baltica WH47]
Length=439

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP +P I+YEGP S NPL+F+WYN +E I GK MKD MRFS+ +WHTFRGTG+DPFG
Sbjct  4    FPDVPVIQYEGPQSDNPLAFRWYNPDEVIEGKTMKDHMRFSIVYWHTFRGTGADPFG  60



>ref|XP_008362076.1| PREDICTED: xylose isomerase-like [Malus domestica]
Length=571

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  262  EGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EGPS+KNPL+FKWYNA+EEILGKKMK+WMRFSVAFWHTFRGTG DPFG
Sbjct  215  EGPSTKNPLAFKWYNADEEILGKKMKEWMRFSVAFWHTFRGTGGDPFG  262



>ref|WP_038172460.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=436

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E FP IPKIKYEGP SKNPLSFK YNA+E + GKKMKD MRF VA+WH  R T SDPFG
Sbjct  3    EAFPDIPKIKYEGPKSKNPLSFKHYNADEVVAGKKMKDHMRFGVAYWHAMRNTLSDPFG  61



>ref|WP_002643822.1| xylose isomerase [Planctomyces maris]
 gb|EDL61873.1| xylose isomerase [Planctomyces maris DSM 8797]
Length=436

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F  +PKI+YEGP SKNPL+FK Y  EEEI G+ M+D  RFS+ +WHTFRGTGSDPFG
Sbjct  2    EYFADVPKIEYEGPQSKNPLAFKHYCPEEEIEGQTMRDLFRFSICYWHTFRGTGSDPFG  60



>ref|WP_044302066.1| xylose isomerase [Rhodopirellula sallentina]
Length=438

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP + KI+YEGP S NPL+F+WYN +E + GK MKD +RF+V +WHTFRGTGSDPFG
Sbjct  4    FPEVSKIQYEGPQSDNPLAFRWYNPDEVVAGKTMKDHLRFTVTYWHTFRGTGSDPFG  60



>gb|EMI56412.1| xylose isomerase [Rhodopirellula sallentina SM41]
Length=456

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP + KI+YEGP S NPL+F+WYN +E + GK MKD +RF+V +WHTFRGTGSDPFG
Sbjct  22   FPEVSKIQYEGPQSDNPLAFRWYNPDEVVAGKTMKDHLRFTVTYWHTFRGTGSDPFG  78



>gb|EMT06905.1| Xylose isomerase [Aegilops tauschii]
Length=450

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  160  AGPPTCPADINSDCASGSGE-WEGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKM  336
            A   TCPADI++ C   + + WEGEFFPGI KI+YEGP+SK PLS+KWYNAEE ILGKKM
Sbjct  23   AAQETCPADIDAKCGDAASDGWEGEFFPGITKIRYEGPTSKKPLSYKWYNAEEVILGKKM  82

Query  337  K  339
            K
Sbjct  83   K  83



>ref|WP_009959507.1| xylose isomerase [Verrucomicrobium spinosum]
Length=436

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E FP IPKIKYEGP SKNPLSFK Y+A+E + GKKMKD MRF VA+WH  R T SDPFG
Sbjct  3    EAFPDIPKIKYEGPKSKNPLSFKHYHADEVVAGKKMKDHMRFGVAYWHAMRNTLSDPFG  61



>ref|WP_008707454.1| xylose isomerase [Rhodopirellula maiorica]
 gb|EMI16129.1| xylose isomerase [Rhodopirellula maiorica SM1]
Length=437

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP + KIKYEGP S NPL+F+WYN +E + GK MK+ +RF+V +WHTFRGTGSDPFG
Sbjct  4    FPEVSKIKYEGPDSDNPLAFRWYNPDEVVAGKTMKEHLRFTVTYWHTFRGTGSDPFG  60



>ref|WP_013701478.1| xylose isomerase [Treponema succinifaciens]
 gb|AEB14191.1| Xylose isomerase [Treponema succinifaciens DSM 2489]
Length=437

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI +IKYEGP SKNPL+FK+Y+AE+ ++GKKMKDW++F+VA+WH+F   G DPFG
Sbjct  9    EYFPGIGQIKYEGPESKNPLAFKYYDAEKVVMGKKMKDWLKFTVAYWHSFCADGGDPFG  67



>ref|WP_015358602.1| MULTISPECIES: xylose isomerase XylA [Ruminiclostridium]
 ref|YP_007678969.1| Xyi [ [[Clostridium] stercorarium subsp. stercorarium DSM 8532]
 gb|AGC67911.1| xylose isomerase XylA [ [[Clostridium] stercorarium subsp. stercorarium 
DSM 8532]
 gb|AGI38951.1| Xyi [ [[Clostridium] stercorarium subsp. stercorarium DSM 8532]
Length=441

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF  IPKIKYEGP S NPL+FK+YN +E I GK MK+ +RFSVA+WHT +G GSDPFG
Sbjct  3    EFFKNIPKIKYEGPKSDNPLAFKFYNPDEVIGGKTMKEHLRFSVAYWHTLQGRGSDPFG  61



>ref|WP_009095728.1| xylose isomerase [Rhodopirellula sp. SWK7]
 gb|EMI45512.1| xylose isomerase [Rhodopirellula sp. SWK7]
Length=438

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP + KI+YEGP S NPL+F+WYN +E + GK MK+ +RF+V +WHTFRGTGSDPFG
Sbjct  4    FPEVSKIQYEGPQSDNPLAFRWYNPDEVVAGKTMKEHLRFTVTYWHTFRGTGSDPFG  60



>ref|WP_010588344.1| xylose isomerase [Schlesneria paludicola]
Length=436

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP + KI YEGP+SKNPL+F+ YN EE + GKK+KD +RF+V +WHTFRGTG DPFG
Sbjct  3    YFPEVSKIAYEGPTSKNPLAFRHYNPEEVVEGKKLKDLLRFTVCYWHTFRGTGVDPFG  60



>emb|CDY03999.1| BnaC02g37140D [Brassica napus]
Length=101

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +1

Query  106  KVLFLLFCLNVISNI-VMAAGPPTCPADINSDCASGSGEWEGEFFPGIPKIKYEGPSSKN  282
            KV   + CL   + + +++A P TCPA+  + C SGSG+WEGEFFP IP IKYE   S N
Sbjct  3    KVEIFMICLCSYTALFLVSADPQTCPAESGAKC-SGSGDWEGEFFPEIPHIKYERLKSSN  61

Query  283  PLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGT  387
            PLS+KWY+AEEEILG     +  FS   ++  RG+
Sbjct  62   PLSYKWYSAEEEILGSNPLAYKCFSTPIFNARRGS  96



>ref|WP_012924965.1| xylose isomerase [Spirosoma linguale]
 gb|ADB36413.1| xylose isomerase [Spirosoma linguale DSM 74]
Length=443

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI  I YEGP+SKNPLSFKWYN +  I GK +++ +RF++++WHTF GTG DPFG
Sbjct  10   EFFPGIGAIAYEGPTSKNPLSFKWYNPDLVIGGKTLREQLRFAISYWHTFTGTGGDPFG  68



>ref|WP_002651869.1| xylose isomerase [Blastopirellula marina]
 gb|EAQ80286.1| xylose isomerase [Blastopirellula marina DSM 3645]
Length=436

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP + KI+YEGP SKNPL+F+WYN +E + GK M+D MRFSV +WHTFRG+G+DPFG
Sbjct  4    FPEVDKIQYEGPESKNPLAFRWYNPDEVVEGKTMRDHMRFSVVYWHTFRGSGADPFG  60



>ref|WP_010040427.1| xylose isomerase [Gemmata obscuriglobus]
Length=437

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FFP +PKIKYEGP S NPL+++ YN +E + GK MKD +RF+V +WHTFRGTGSDPFG
Sbjct  3    FFPDVPKIKYEGPDSTNPLAYRHYNPDELVEGKSMKDHLRFAVCYWHTFRGTGSDPFG  60



>ref|WP_012913169.1| xylose isomerase [Pirellula staleyi]
 gb|ADB18910.1| xylose isomerase [Pirellula staleyi DSM 6068]
Length=437

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP I KI+YEGP SKNPL+F+WYN +E I GK M + +RFSV +WHTFRGTGSDPFG
Sbjct  5    FPEIEKIRYEGPKSKNPLAFRWYNPDEVIEGKTMAEHLRFSVVYWHTFRGTGSDPFG  61



>ref|WP_026475377.1| xylose isomerase [Alkaliflexus imshenetskii]
Length=442

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI +IKYEG  SKNP++FKWYN E+ I GK MK+ +RF+V++WHTF G G DPFG
Sbjct  9    EYFPGIGEIKYEGRDSKNPMAFKWYNPEQVIAGKTMKEHLRFAVSYWHTFCGEGGDPFG  67



>ref|WP_020471332.1| xylose isomerase [Zavarzinella formosa]
Length=437

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FFP I KIKYEG  SKNPL+F+ YN +E + GK MK+ +RF+V +WHTFRGTGSDPFG
Sbjct  3    FFPEISKIKYEGADSKNPLAFRHYNPDEVVEGKTMKEHLRFAVCYWHTFRGTGSDPFG  60



>ref|WP_013626379.1| xylose isomerase [Planctomyces brasiliensis]
 gb|ADY57635.1| D-xylose isomerase [Planctomyces brasiliensis DSM 5305]
Length=436

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP +P I +EGP S+NPL+F++YN +E I G+ M+D +RFSV +WHTFRGTG DPFG
Sbjct  3    YFPDVPTIPFEGPESRNPLAFRYYNPDEMIEGQSMRDLLRFSVCYWHTFRGTGGDPFG  60



>ref|WP_020153617.1| xylose isomerase [Caldibacillus debilis]
Length=440

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +F  + KI+YEG  SKNPLSFK+YN EE+I  +KMKDW+RFSVA+WHTF   G+DPFG
Sbjct  3    YFENVSKIQYEGADSKNPLSFKFYNPEEKIGDRKMKDWLRFSVAYWHTFTYDGTDPFG  60



>ref|WP_013711740.1| xylose isomerase [Carnobacterium sp. 17-4]
 gb|AEB30798.1| xylose isomerase [Carnobacterium sp. 17-4]
Length=436

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI+YEGP S NP +F++YN EE +LGK MK+ +RFSVA+WHTF   GSDPFG
Sbjct  3    YFPAINKIQYEGPESTNPFAFRYYNPEEVVLGKTMKEQLRFSVAYWHTFTDDGSDPFG  60



>ref|WP_013667214.1| xylose isomerase [Sphingobacterium sp. 21]
 gb|ADZ80497.1| Xylose isomerase [Sphingobacterium sp. 21]
Length=442

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            E E+F GI +IKYEGP S NPL+++WY+    + GK MK+ +RF+VA+WH+F GTGSDPF
Sbjct  7    EREYFKGIGQIKYEGPESDNPLAYRWYDPNRVVGGKTMKEHLRFAVAYWHSFNGTGSDPF  66

Query  403  G  405
            G
Sbjct  67   G  67



>ref|WP_013711744.1| xylose isomerase [Carnobacterium sp. 17-4]
 gb|AEB30802.1| xylose isomerase [Carnobacterium sp. 17-4]
Length=436

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KIKYEGP S NP +F+ YN EE +LGK MK+ +RFSVA+WHTF   GSDPFG
Sbjct  3    YFPSIDKIKYEGPESTNPFAFRHYNPEEIVLGKTMKEQLRFSVAYWHTFTNDGSDPFG  60



>ref|WP_008880082.1| MULTISPECIES: xylose isomerase [Geobacillus]
 sp|A4IP67.1|XYLA_GEOTN RecName: Full=Xylose isomerase [Geobacillus thermodenitrificans 
NG80-2]
 gb|ABO67121.1| Xylose isomerase [Geobacillus thermodenitrificans NG80-2]
 gb|EDY06124.1| xylose isomerase [Geobacillus sp. G11MC16]
Length=445

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NP +FK+YN EE++ GK M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPFAFKFYNPEEKVGGKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>emb|CBK25455.2| unnamed protein product [Blastocystis hominis]
Length=435

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI  IKYEG +S N LSFKWYNAE+ +LGKKMKD +RF+V +WHTF   G+D FG
Sbjct  2    EYFPGISNIKYEGSASMNDLSFKWYNAEQVVLGKKMKDHLRFAVCYWHTFCYQGNDQFG  60



>ref|WP_019387009.1| xylose isomerase [Arenitalea lutea]
Length=438

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F GI KIK+EG  S NPL+FK+YN ++ + GK MKDW +FS+A+WHTF G GSDPFG
Sbjct  5    EYFKGIDKIKFEGKESDNPLAFKYYNPDQVVAGKTMKDWFKFSIAYWHTFCGQGSDPFG  63



>ref|WP_007414259.1| xylose isomerase [Pedosphaera parvula]
 gb|EEF61725.1| xylose isomerase [bacterium Ellin514]
Length=437

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  FPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FP I KI++EGP SKNPL+FK YN  E I GK MKDW+RFSV +WHTFR   SDPFG
Sbjct  5    FPKISKIQFEGPQSKNPLAFKHYNESEIIEGKTMKDWLRFSVVYWHTFRNQLSDPFG  61



>ref|WP_026561670.1| xylose isomerase [Bacillus sp. J37]
Length=443

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +F  + +IKYEGP S NPL+FK+YN EE I GKKM+D +RFSVA+WHTF   GSDPFG
Sbjct  3    YFENVNQIKYEGPGSANPLAFKYYNPEEVINGKKMEDLLRFSVAYWHTFTADGSDPFG  60



>ref|WP_010255892.1| xylose isomerase [Treponema primitia]
Length=446

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KI YEG  SKNPL+FK+Y+AE+ + GKK KDW+RF++A+WH+F G G+DPFG
Sbjct  10   EYFPGIGKIPYEGSGSKNPLAFKYYDAEKTVRGKKTKDWLRFAIAYWHSFCGDGADPFG  68



>ref|WP_015707713.1| xylose isomerase [Treponema primitia]
 gb|AEF85442.1| xylose isomerase [Treponema primitia ZAS-2]
Length=446

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KI YEG  SKNPL+FK+Y+AE+ I GKK++DW+RF++A+WH+F   G+DPFG
Sbjct  10   EFFPGIGKIPYEGSGSKNPLAFKYYDAEKTIRGKKLRDWLRFAIAYWHSFCADGADPFG  68



>ref|WP_018615189.1| xylose isomerase [Segetibacter koreensis]
Length=442

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            E EFF GI +IKYEGP S NP +F+WY+  + I GK MKD+++FS A+WH+F   GSDPF
Sbjct  7    EKEFFKGIQQIKYEGPKSDNPFAFRWYDENKVIAGKTMKDYLKFSCAYWHSFNNEGSDPF  66

Query  403  G  405
            G
Sbjct  67   G  67



>ref|WP_022103428.1| xylose isomerase [Bacteroides stercoris CAG:120]
 emb|CDA49117.1| xylose isomerase [Bacteroides stercoris CAG:120]
Length=455

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT    G D FG
Sbjct  22   EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTLCAEGGDQFG  80



>ref|WP_019986665.1| xylose isomerase [Rudanella lutea]
Length=443

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            + EFF G+  I YEGP SKNPL+FKWYN ++ + GK ++D +RF++++WHTF GTG DPF
Sbjct  8    DNEFFKGVGAIGYEGPKSKNPLAFKWYNPDQVVGGKTLRDQLRFAISYWHTFCGTGGDPF  67

Query  403  G  405
            G
Sbjct  68   G  68



>ref|XP_005764620.1| hypothetical protein EMIHUDRAFT_214014 [Emiliania huxleyi CCMP1516]
 gb|EOD12191.1| hypothetical protein EMIHUDRAFT_214014 [Emiliania huxleyi CCMP1516]
Length=147

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FFP I K++YEGPSS+NPL+FK Y  +E + G+ MK+W+RFS+A+WHT+RG G D FG
Sbjct  34   FFPDIDKVRYEGPSSRNPLAFKQYAEDEVVAGRTMKEWLRFSIAYWHTWRGNGGDIFG  91



>gb|EPH17343.1| xylose isomerase [Bacteroides stercoris CC31F]
Length=456

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT    G D FG
Sbjct  23   EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTLCAEGGDQFG  81



>dbj|GAK49954.1| xylose isomerase [bacterium UASB14]
Length=444

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KI+YEGP SKNPL+FK+Y+  + + GK MKD  RF++A+WHTF G GSDPFG
Sbjct  11   EYFPGISKIQYEGPQSKNPLAFKYYDENKVVAGKPMKDHFRFAIAYWHTFCGAGSDPFG  69



>ref|WP_018666714.1| xylose isomerase [Bacteroides gallinarum]
Length=438

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>emb|CAB76571.1| xylose isomerase [Piromyces sp. E2]
Length=437

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FP I KIK+EG  SKNPL+F +Y+AE+E++GKKMKDW+RF++A+WHT    G+D FG
Sbjct  4    EYFPQIQKIKFEGKDSKNPLAFHYYDAEKEVMGKKMKDWLRFAMAWWHTLCAEGADQFG  62



>ref|WP_036940898.1| xylose isomerase [Pseudobacteroides cellulosolvens]
Length=439

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF  + KI+YEG +S NPL+FK+YN +E I GK MKD +RF+VA+WHTF+GTG DPFG
Sbjct  3    EFFSNVSKIQYEGKNSDNPLAFKYYNPDEVIGGKTMKDHLRFAVAYWHTFQGTGGDPFG  61



>ref|WP_044737009.1| xylose isomerase [Geobacillus kaustophilus]
Length=445

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_010538096.1| MULTISPECIES: xylose isomerase [Bacteroides]
 emb|CDC90990.1| xylose isomerase [Bacteroides faecis CAG:32]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_008761491.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EFI04598.1| xylose isomerase [Bacteroides sp. 1_1_14]
 emb|CDE80101.1| xylose isomerase [Bacteroides thetaiotaomicron CAG:40]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_031409263.1| xylose isomerase [Geobacillus vulcani]
Length=445

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_024987508.1| xylose isomerase [Bacteroides acidifaciens]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_022138821.1| xylose isomerase [Bacteroides acidifaciens]
 emb|CDA83943.1| xylose isomerase [Bacteroides sp. CAG:754]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_011107447.1| xylose isomerase [Bacteroides thetaiotaomicron]
 ref|NP_809706.1| xylose isomerase [Bacteroides thetaiotaomicron VPI-5482]
 sp|Q8A9M2.1|XYLA_BACTN RecName: Full=Xylose isomerase [Bacteroides thetaiotaomicron 
VPI-5482]
 gb|AAO75900.1| xylose isomerase [Bacteroides thetaiotaomicron VPI-5482]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_004295876.1| MULTISPECIES: xylose isomerase [Bacteroides]
 ref|YP_007791408.1| D-xylose isomerase [Bacteroides xylanisolvens XB1A]
 gb|EDO12033.1| xylose isomerase [Bacteroides ovatus ATCC 8483]
 gb|EEO52538.1| xylose isomerase [Bacteroides sp. D1]
 gb|EEO57842.1| xylose isomerase [Bacteroides sp. 2_2_4]
 gb|EEZ04374.1| xylose isomerase [Bacteroides sp. 2_1_22]
 gb|EFF53135.1| xylose isomerase [Bacteroides ovatus SD CMC 3f]
 gb|EFF55785.1| xylose isomerase [Bacteroides xylanisolvens SD CC 2a]
 gb|EFG12983.1| xylose isomerase [Bacteroides xylanisolvens SD CC 1b]
 emb|CBK65827.1| D-xylose isomerase [Bacteroides xylanisolvens XB1A]
 gb|EFI10988.1| xylose isomerase [Bacteroides sp. D22]
 gb|EFI40282.1| xylose isomerase [Bacteroides sp. 3_1_23]
 gb|EFS33825.1| xylose isomerase [Bacteroides sp. D2]
 gb|EGN00349.1| xylose isomerase [Bacteroides ovatus 3_8_47FAA]
 gb|EGN06270.1| xylose isomerase [Bacteroides sp. 1_1_30]
 gb|EIY63641.1| xylose isomerase [Bacteroides ovatus CL03T12C18]
 gb|EIY68776.1| xylose isomerase [Bacteroides ovatus CL02T12C04]
 gb|EIY86839.1| xylose isomerase [Bacteroides xylanisolvens CL03T12C04]
 emb|CDB59241.1| xylose isomerase [Bacteroides ovatus CAG:22]
 emb|CDM01605.1| Xylose isomerase [Bacteroides xylanisolvens SD CC 2a]
 emb|CDM03469.1| Xylose isomerase [Bacteroides xylanisolvens SD CC 1b]
 gb|KDS13894.1| xylose isomerase [Bacteroides ovatus str. 3725 D1 iv]
 gb|KDS19139.1| xylose isomerase [Bacteroides fragilis str. 3725 D9 ii]
 gb|KDS22170.1| xylose isomerase [Bacteroides ovatus str. 3725 D9 iii]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_021321588.1| xylose isomerase [Geobacillus sp. A8]
 gb|EQB97063.1| xylose isomerase [Geobacillus sp. A8]
Length=445

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_033008779.1| xylose isomerase [Geobacillus stearothermophilus]
 gb|KFL17009.1| xylose isomerase [Geobacillus stearothermophilus]
 gb|KFX35310.1| xylose isomerase [Geobacillus stearothermophilus]
Length=445

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>gb|ABI49954.1| xylose kinase [Geobacillus stearothermophilus]
Length=445

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_016267511.1| xylose isomerase [Bacteroides thetaiotaomicron]
 gb|EOS01935.1| xylose isomerase [Bacteroides thetaiotaomicron dnLKV9]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_034536238.1| xylose isomerase [Bacteroides stercoris]
 gb|ADD61712.1| putative protein [uncultured organism]
Length=438

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_044745016.1| xylose isomerase [Anoxybacillus sp. ATCC BAA-2555]
Length=445

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_005654109.1| xylose isomerase [Bacteroides stercoris]
 gb|EDS15937.1| xylose isomerase [Bacteroides stercoris ATCC 43183]
 gb|AEK21499.1| xylose isomerase [Bacteroides stercoris]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_008765652.1| xylose isomerase [Bacteroides sp. 1_1_6]
 gb|EES70518.1| xylose isomerase [Bacteroides sp. 1_1_6]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW+RF++A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGDQFG  63



>ref|WP_023634171.1| xylose isomerase [Geobacillus sp. MAS1]
 gb|ESU71592.1| xylose isomerase [Geobacillus sp. MAS1]
Length=445

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_044731434.1| xylose isomerase [Geobacillus kaustophilus]
 gb|KJE26833.1| beta-xylosidase [Geobacillus kaustophilus]
Length=445

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I KI YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGKIAYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_007760618.1| xylose isomerase [Bacteroides finegoldii]
 gb|EKJ92327.1| xylose isomerase [Bacteroides finegoldii CL09T03C10]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_007748423.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EEX47182.1| xylose isomerase [Bacteroides finegoldii DSM 17565]
 emb|CDC51974.1| xylose isomerase [Bacteroides finegoldii CAG:203]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>dbj|GAE90252.1| xylose isomerase [ [[Clostridium] straminisolvens JCM 21531]
Length=368

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  226  GEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
             E+F  +PKIKYEG  S NPL+FK+YN +E I GK MK+ +RF+VA+WHT++GTG+DPFG
Sbjct  2    AEYFKNVPKIKYEGKDSDNPLAFKYYNPDEVIGGKTMKEHLRFAVAYWHTYQGTGADPFG  61



>ref|WP_007567790.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EDU98713.1| xylose isomerase [Bacteroides coprocola DSM 17136]
 emb|CDA71534.1| xylose isomerase [Bacteroides coprocola CAG:162]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT    G+D FG
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTLCAEGADQFG  63



>ref|WP_018709956.1| xylose isomerase [Bacteroides barnesiae]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++F++A+WHT    GSD FG
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFAMAWWHTLCAEGSDQFG  63



>ref|WP_006801274.1| xylose isomerase [Dysgonomonas gadei]
 gb|EGJ99870.1| xylose isomerase [Dysgonomonas gadei ATCC BAA-286]
Length=442

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNPL++++Y+  + ++GK MKDWMRF++A+WHT    G DPFG
Sbjct  9    EFFPGIGKIKFEGKESKNPLAYRFYDENKVVMGKSMKDWMRFAMAYWHTLCANGGDPFG  67



>ref|WP_022042383.1| xylose isomerase [Bacteroides caccae CAG:21]
 emb|CCZ72091.1| xylose isomerase [Bacteroides caccae CAG:21]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_040994511.1| xylose isomerase [Chryseobacterium oranimense]
 emb|CEJ68933.1| Xylose isomerase [Chryseobacterium oranimense G311]
Length=442

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI KIK+EG  SKNPL+F++Y+AE+ ++GK MKDW RF++A+WHT    GSDPFG
Sbjct  9    EFFTGIEKIKFEGKESKNPLAFRYYDAEKIVMGKPMKDWTRFAMAWWHTLCANGSDPFG  67



>ref|WP_022339343.1| xylose isomerase [Bacteroides sp. CAG:714]
 emb|CDD32747.1| xylose isomerase [Bacteroides sp. CAG:714]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KI++EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT    GSD FG
Sbjct  5    EYFPGIGKIQFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTLCAEGSDQFG  63



>ref|WP_028986624.1| xylose isomerase [Thermicanus aegyptius]
Length=440

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +F  + KI+YEGP+SKNPL+FK+YN+EE+I  + M++W+RFSVA+WHTF   G+DPFG
Sbjct  3    YFENVSKIQYEGPTSKNPLAFKFYNSEEKIGDRTMEEWLRFSVAYWHTFTFEGTDPFG  60



>gb|AEI87757.1| xylose isomerase [Geobacillus thermantarcticus]
Length=441

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP+SKNPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIETIVYEGPTSKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_005675918.1| xylose isomerase [Bacteroides caccae]
 gb|EDM22268.1| xylose isomerase [Bacteroides caccae ATCC 43185]
 gb|EIY22176.1| xylose isomerase [Bacteroides caccae CL03T12C61]
Length=438

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+AE+ I GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_007930953.1| MULTISPECIES: xylose isomerase [Pelosinus]
 gb|EIW20574.1| xylose isomerase [Pelosinus fermentans B4]
 gb|EIW25711.1| Xylose isomerase [Pelosinus fermentans A11]
 gb|EIW33123.1| Xylose isomerase [Pelosinus fermentans DSM 17108]
Length=437

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F GI KI YEGP S+NPL+FK+YN +E + GK M++ +RFSVA+WHTF   GSDPFG
Sbjct  2    EYFSGIKKITYEGPKSQNPLAFKYYNPQELVAGKTMEEHLRFSVAYWHTFTHDGSDPFG  60



>ref|WP_022164491.1| xylose isomerase [Bacteroides sp. CAG:633]
 emb|CDB11822.1| xylose isomerase [Bacteroides sp. CAG:633]
Length=438

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  S+NPL+F++Y+ E+ I+GKKMKDW++FS+A+WHT    GSD FG
Sbjct  5    EYFPGIGKIKFEGVESRNPLAFRYYDPEKVIMGKKMKDWLKFSMAWWHTLCAEGSDQFG  63



>ref|WP_005588920.1| xylose isomerase [Clostridium ultunense]
 emb|CCQ98538.1| xylose isomerase [Clostridium ultunense Esp]
Length=440

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +F  + KI+YEGP+SKNPL+FK+YN+EE+I  + M++W+RFSVA+WHTF   G+DPFG
Sbjct  3    YFENVSKIQYEGPTSKNPLAFKFYNSEEKIGDRTMEEWLRFSVAYWHTFTFEGTDPFG  60



>ref|WP_010245089.1| xylose isomerase [Acetivibrio cellulolyticus]
Length=439

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  226  GEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
             E+F  + KIKYEG  S NPL+FK+YN +E I GK MK+ +RF+VA+WHTF+GTGSDPFG
Sbjct  2    AEYFNNVSKIKYEGKDSDNPLAFKYYNPDEVIGGKTMKEHLRFAVAYWHTFQGTGSDPFG  61



>ref|WP_013877022.1| xylose isomerase [Geobacillus thermoglucosidasius]
 gb|AEH48176.1| Xylose isomerase [Geobacillus thermoglucosidasius C56-YS93]
Length=441

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP+SKNPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIETIVYEGPTSKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_028120803.1| xylose isomerase [Epilithonimonas tenax]
Length=442

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI +IK+EG  S+NPL+F++Y A+  ++GK MK+WMRF++A+WHT    GSDPFG
Sbjct  9    EFFPGIEQIKFEGKESRNPLAFRYYEADRMVMGKPMKEWMRFAMAWWHTLCADGSDPFG  67



>ref|WP_025763423.1| xylose isomerase [Dyadobacter tibetensis]
Length=442

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            E E+F GI KI YEGPSS NPL+++WY+    I GK MK+ +RF+VA+WH+F G GSDPF
Sbjct  7    EQEYFKGIGKIAYEGPSSDNPLAYRWYDENRVIAGKTMKEHLRFAVAYWHSFCGNGSDPF  66

Query  403  G  405
            G
Sbjct  67   G  67



>ref|WP_019538924.1| xylose isomerase [Proteiniphilum acetatigenes]
Length=443

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KI++EG  SKNPL+F++Y+AE+ + G+KMKDW +FS+A+WHT      DPFG
Sbjct  9    EFFPGIGKIEFEGKESKNPLAFRYYDAEKVVYGRKMKDWFKFSMAYWHTLCAEARDPFG  67



>ref|WP_009125594.1| xylose isomerase [Bacteroides fluxus]
 gb|EGF56331.1| xylose isomerase [Bacteroides fluxus YIT 12057]
Length=438

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++F++A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFAMAWWHTLCAEGGDQFG  63



>ref|WP_025498145.1| xylose isomerase [Chitinophagaceae bacterium JGI 0001013-J17]
Length=442

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI +IKYEGP + NPL+F+WY+  + + GK MK+ +RF+VA+WH+F G G+DPFG
Sbjct  9    EFFKGIGQIKYEGPETDNPLAFRWYDESKTVAGKTMKEHLRFAVAYWHSFCGNGADPFG  67



>sp|Q6T6K9.1|XYLA_FERGO RecName: Full=Xylose isomerase [Fervidobacterium gondwanense]
 gb|AAR07504.1| glucose isomerase [Fervidobacterium gondwanense]
Length=433

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  244  IPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            + K+ YEGPSSKN L++K+YN EEEI GKKM+DW RF+VA+WHTF   G DPFG
Sbjct  5    VEKVVYEGPSSKNLLAYKFYNPEEEIAGKKMRDWFRFAVAYWHTFNSRGEDPFG  58



>ref|WP_013564383.1| xylose isomerase [Isosphaera pallida]
 gb|ADV62095.1| D-xylose isomerase [Isosphaera pallida ATCC 43644]
Length=437

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  226  GEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
             EFFP +PKI+Y GP+SKNPL FK YN +E + GK M+D +RFSV +WHTF    SDPFG
Sbjct  2    AEFFPDVPKIRYGGPTSKNPLEFKHYNPDEVVAGKTMRDHLRFSVVYWHTFTNPLSDPFG  61



>ref|WP_029292485.1| xylose isomerase [Chryseobacterium hispalense]
Length=442

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI KIK+EG  S+NPL+F++Y+AE+ ++GK MKDW RF++A+WHT    GSDPFG
Sbjct  9    EFFTGIDKIKFEGKESRNPLAFRYYDAEKVVMGKPMKDWTRFAMAWWHTLCANGSDPFG  67



>ref|WP_024996964.1| xylose isomerase [Bacteroides graminisolvens]
 dbj|GAK37242.1| xylose isomerase [Bacteroides graminisolvens DSM 19988 = JCM 
15093]
Length=438

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP++F++Y+ E+EI GKKMKDW +FS+A+WHT    G D FG
Sbjct  5    EFFPGIGKIKFEGKESKNPMAFRYYDPEKEINGKKMKDWFKFSMAWWHTLCAEGGDQFG  63



>ref|WP_012238060.1| xylose isomerase [Sorangium cellulosum]
 ref|YP_001616072.1| xylose isomerase [Sorangium cellulosum So ce56]
 emb|CAN95592.1| xylA [Sorangium cellulosum So ce56]
Length=443

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPG+ KI YEGP S NPL+FKWY+A   + GK MKD  +F+V +WHTF G G DPFG
Sbjct  9    EYFPGVGKIPYEGPESDNPLAFKWYDANRVVAGKAMKDHFKFAVCYWHTFCGRGHDPFG  67



>ref|WP_034673582.1| xylose isomerase [Chryseobacterium formosense]
 gb|KFE99785.1| xylose isomerase [Chryseobacterium formosense]
Length=442

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI KIK+EG  S+NPL+F++Y+AE  ++GK MKDW RF++A+WHT    GSDPFG
Sbjct  9    EFFTGIEKIKFEGKESRNPLAFRYYDAERMVMGKPMKDWTRFAMAWWHTLCANGSDPFG  67



>ref|WP_004290957.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EEC53078.1| xylose isomerase [Bacteroides eggerthii DSM 20697]
 gb|EFV28579.1| xylose isomerase [Bacteroides eggerthii 1_2_48FAA]
 emb|CCY57543.1| xylose isomerase [Bacteroides eggerthii CAG:109]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ I+GKKMKDW++F++A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGKESKNPMAFRYYDAEKVIMGKKMKDWLKFAMAWWHTLCAEGGDQFG  63



>ref|WP_020594904.1| xylose isomerase [Spirosoma panaciterrae]
Length=443

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI  I YEGP SKNPL+FKWYN E  I GK +++ +RF++++WHTF GTG DPFG
Sbjct  10   EFFKGIGAIAYEGPKSKNPLAFKWYNPELIINGKSLREQLRFAISYWHTFCGTGGDPFG  68



>ref|WP_008618038.1| xylose isomerase [Paraprevotella clara]
 gb|EHH01123.1| xylose isomerase [Paraprevotella clara YIT 11840]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            + E+FPGI KIK+EG  SKNPL++++Y+AE+ I+GKKMKDW++F++A+WHT    G D F
Sbjct  3    QKEYFPGIGKIKFEGKESKNPLAYRYYDAEKVIMGKKMKDWLKFAMAWWHTLCAEGGDQF  62

Query  403  G  405
            G
Sbjct  63   G  63



>ref|WP_014856692.1| xylose isomerase [Melioribacter roseus]
 gb|AFN75260.1| xylose isomerase [Melioribacter roseus P3M-2]
Length=442

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F GI KIKYEGP SKNPL+FKWY+  + + GK MK++ RFS A+WHTF    SDPFG
Sbjct  9    EYFTGIGKIKYEGPDSKNPLAFKWYDENKVVFGKTMKEYFRFSAAYWHTFCSELSDPFG  67



>ref|WP_022389541.1| xylose isomerase [Tannerella sp. CAG:51]
 emb|CDD88353.1| xylose isomerase [Tannerella sp. CAG:51]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_038559919.1| xylose isomerase [Draconibacterium orientale]
 gb|AHW60447.1| xylose isomerase [Draconibacterium orientale]
Length=441

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F GI +IK+EGP SKNPL+FKWY+    + GK MK+ +RF+VA+WHTF GTG DPFG
Sbjct  9    EYFKGIDQIKFEGPDSKNPLAFKWYDENRVVGGKTMKEHLRFAVAYWHTFCGTGEDPFG  67



>ref|WP_020960004.1| xylose isomerase [Geobacillus sp. JF8]
 gb|AGT32197.1| xylose isomerase [Geobacillus sp. JF8]
Length=445

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP S+NPL+FK+YN +E++ GK M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGTIPYEGPESRNPLAFKFYNPDEKVGGKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_022600970.1| xylose isomerase [Coprobacter fastidiosus]
 gb|ERM89420.1| xylose isomerase [Coprobacter fastidiosus NSB1]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_011231365.1| xylose isomerase [Geobacillus kaustophilus]
 sp|Q5KYS6.1|XYLA_GEOKA RecName: Full=Xylose isomerase [Geobacillus kaustophilus HTA426]
 dbj|BAD76160.1| xylose isomerase [Geobacillus kaustophilus HTA426]
Length=445

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP S+NPL+FK+YN +E++ GK M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGTIPYEGPESRNPLAFKFYNPDEKVGGKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_009319331.1| xylose isomerase [Tannerella sp. 6_1_58FAA_CT1]
 gb|EHL81684.1| xylose isomerase [Tannerella sp. 6_1_58FAA_CT1]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE+ ++GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAEKVVMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_022829574.1| xylose isomerase [Cytophagales bacterium B6]
Length=441

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            E EFF GI +IK+EG  S NPL+F+WY+A+  + GK MKD +RF+ A+WH+F GTG+DPF
Sbjct  6    EKEFFKGIGQIKFEGLESDNPLAFRWYDADRVVAGKTMKDHLRFACAYWHSFCGTGADPF  65

Query  403  G  405
            G
Sbjct  66   G  66



>ref|WP_008626667.1| xylose isomerase [Paraprevotella xylaniphila]
 gb|EGG54729.1| xylose isomerase [Paraprevotella xylaniphila YIT 11841]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            + E+FPGI KIK+EG  SKNPL++++Y+AE+ I+GKKMKDW++F++A+WHT    G D F
Sbjct  3    QKEYFPGIGKIKFEGKESKNPLAYRYYDAEKVIMGKKMKDWLKFAMAWWHTLCAEGGDQF  62

Query  403  G  405
            G
Sbjct  63   G  63



>sp|Q9KGU2.1|XYLA_THEYO RecName: Full=Xylose isomerase [Caldanaerobacter subterraneus 
subsp. yonseiensis]
 gb|AAF87247.1| xylose/glucose isomerase [Caldanaerobacter subterraneus subsp. 
yonseiensis]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F  +PK++YEGP S NP +FK+YN +E I GK +K+ +RF+VA+WHTF GTG+DPFG
Sbjct  2    EYFKNVPKVQYEGPKSNNPYAFKFYNPDEIIDGKPLKEHLRFAVAYWHTFTGTGTDPFG  60



>ref|WP_021969955.1| xylose isomerase [Bacteroides sp. CAG:1076]
 emb|CCY89918.1| xylose isomerase [Bacteroides sp. CAG:1076]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE  ++GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAERVVMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_022231753.1| xylose isomerase [Bacteroides sp. CAG:443]
 emb|CDB99617.1| xylose isomerase [Bacteroides sp. CAG:443]
Length=438

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNP++F++Y+AE  ++GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGVESKNPMAFRYYDAERVVMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_002978702.1| xylose isomerase [Chryseobacterium gleum]
 gb|EFK34192.1| xylose isomerase [Chryseobacterium gleum ATCC 35910]
Length=442

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI KIK+EG  S+NPL+F++Y+AE+ ++GK MKDW RF++A+WHT    GSDPFG
Sbjct  9    EFFTGIEKIKFEGKESRNPLAFRYYDAEKIVMGKPMKDWTRFAMAWWHTLCANGSDPFG  67



>ref|WP_029904902.1| xylose isomerase [Prevotella sp. 10(H)]
Length=442

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNP+++++Y+  + ++GK MKDWMRF++A+WHT    G DPFG
Sbjct  9    EFFPGIGKIKFEGKESKNPMAYRFYDENKVVMGKTMKDWMRFAMAYWHTLCANGGDPFG  67



>ref|WP_022587522.1| xylose isomerase [Caldanaerobacter subterraneus]
 gb|ERM92670.1| xylose isomerase [Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=438

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F  +PK++YEGP S NP +FK+YN +E I GK +K+ +RF+VA+WHTF GTG+DPFG
Sbjct  2    EYFKNVPKVQYEGPKSNNPYAFKFYNPDEIIDGKPLKEHLRFAVAYWHTFTGTGTDPFG  60



>ref|WP_025608026.1| xylose isomerase [Pontibacter actiniarum]
Length=443

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            + E+F GI KIKYEGP S NPL+++WY+    + GK +KD +RF+VA+WH+F   GSDPF
Sbjct  8    QTEYFKGIDKIKYEGPESDNPLAYRWYDENRMVAGKTLKDHLRFAVAYWHSFNADGSDPF  67

Query  403  G  405
            G
Sbjct  68   G  68



>ref|XP_005779983.1| hypothetical protein EMIHUDRAFT_59556, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD27554.1| hypothetical protein EMIHUDRAFT_59556, partial [Emiliania huxleyi 
CCMP1516]
Length=226

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FFP I K++YEGPSS+NPL+FK Y  +E + G+ MK+W+RFS+A+WHT+RG G D FG
Sbjct  1    FFPDIDKVRYEGPSSRNPLAFKQYAEDEVVAGRTMKEWLRFSIAYWHTWRGNGGDIFG  58



>dbj|BAP32351.1| xylose isomerase [Chryseobacterium sp. StRB126]
Length=442

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI KIK+EG  S+NPL+F++Y+AE+ ++GK MKDW RF++A+WHT    GSDPFG
Sbjct  9    EFFTGIEKIKFEGKESRNPLAFRYYDAEKIVMGKPMKDWTRFAMAWWHTLCANGSDPFG  67



>ref|WP_020605377.1| xylose isomerase [Spirosoma spitsbergense]
Length=443

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F GI  I YEGP SKNPL+FKWYN + E+ GK +++ +RF++++WHTF GTG DPFG
Sbjct  10   EYFKGIGAIGYEGPKSKNPLAFKWYNPDLEVGGKTLREQLRFAISYWHTFCGTGGDPFG  68



>ref|WP_006842491.1| xylose isomerase [Dysgonomonas mossii]
 gb|EGK04092.1| xylose isomerase [Dysgonomonas mossii DSM 22836]
Length=442

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPGI KIK+EG  SKNPL+F++Y+  + ++GK MKDW RF++A+WHT    G DPFG
Sbjct  9    EFFPGIGKIKFEGKESKNPLAFRFYDENKVVMGKTMKDWTRFAMAYWHTLCANGGDPFG  67



>ref|WP_025881085.1| xylose isomerase [Prevotella baroniae]
Length=439

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFP I KI +EG  SKNPL+F +Y+AE+EILGKKMKDW++F++A+WHT     SD FG
Sbjct  4    EFFPQIGKIPFEGMESKNPLTFHYYDAEKEILGKKMKDWLKFAIAWWHTLGQASSDQFG  62



>ref|XP_004356776.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
 gb|ELR24876.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
Length=437

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F GI KI +EGP S NPL+FK+Y  ++ + G+ MKDW+RFSV +WHT+RGTG+D FG
Sbjct  4    EYFKGISKIPFEGPESVNPLAFKYYRPDQVVAGRPMKDWLRFSVCYWHTWRGTGADMFG  62



>ref|WP_022825466.1| xylose isomerase [Hymenobacter norwichensis]
Length=443

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFF GI  IKYEG  S NPL+FKWY+    + GK M+D MRF+V++WHTF GTG DPFG
Sbjct  10   EFFTGIEPIKYEGRESDNPLAFKWYDPTRVVAGKTMQDHMRFAVSYWHTFTGTGGDPFG  68



>ref|WP_013931484.1| xylose isomerase [Thermotoga thermarum]
 gb|AEH50260.1| D-xylose isomerase [Thermotoga thermarum DSM 5069]
Length=441

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FF   PKI+YEGP+S NPLSFK+YN  E I GK +KD ++FSVAFWHTF G GSD FG
Sbjct  2    KFFKEFPKIEYEGPTSTNPLSFKYYNPNEIIDGKSLKDHLKFSVAFWHTFVGAGSDMFG  60



>gb|ACA65427.1| xylose isomerase [Orpinomyces sp. ukk1]
Length=437

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FP I KI++EG  SKNP++F +Y+AE+E++GKKMKDW+RF++A+WHT    G+D FG
Sbjct  4    EYFPTIGKIRFEGKDSKNPMAFHYYDAEKEVMGKKMKDWLRFAMAWWHTLCADGADQFG  62



>ref|WP_020733663.1| xylose isomerase [Sorangium cellulosum]
 ref|YP_008148129.1| xylose isomerase [Sorangium cellulosum So0157-2]
 gb|AGP34522.1| xylose isomerase [Sorangium cellulosum So0157-2]
Length=443

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPG+ KI YEGP S NPL+FKWY+ +  + GK MKD  +F+V +WHTF G G DPFG
Sbjct  9    EYFPGVGKIPYEGPESDNPLAFKWYDEKRVVAGKAMKDHFKFAVCYWHTFCGRGHDPFG  67



>ref|WP_010074860.1| xylose isomerase [Clostridium cellulovorans]
 gb|ADL50361.1| xylose isomerase [Clostridium cellulovorans 743B]
Length=439

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F  +PKIKYEG  SKNPL+FK+YN +E + GK MK+ +RF++++WHT  G GSDPFG
Sbjct  3    EYFANVPKIKYEGKDSKNPLAFKYYNPDEVVGGKTMKEHLRFTLSYWHTLTGAGSDPFG  61



>ref|WP_013618897.1| xylose isomerase [Bacteroides salanitronis]
 gb|ADY37524.1| Xylose isomerase [Bacteroides salanitronis DSM 18170]
Length=438

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KIK+EG  SKNPL+F++Y+ E  ++GKKMKDW++FS+A+WHT    G D FG
Sbjct  5    EYFPGIGKIKFEGVESKNPLAFRYYDPERVVMGKKMKDWLKFSMAWWHTLCAEGGDQFG  63



>ref|WP_026679492.1| xylose isomerase [Fictibacillus gelatini]
Length=443

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I +I++EGP+SKNP +FK+YN EE++ GK M++ +RFSVA+WHTF   G+DPFG
Sbjct  3    YFPNIHQIQFEGPASKNPFAFKYYNPEEKVNGKTMEEILRFSVAYWHTFTADGTDPFG  60



>ref|WP_026390872.1| xylose isomerase [Acholeplasma axanthum]
Length=439

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E F  + KIKYEG  SKNP +FK+YN EE +LGKKMKD ++FS+A+WHT   TG+DPFG
Sbjct  2    EHFKNVAKIKYEGSKSKNPFAFKYYNPEEVVLGKKMKDHLKFSMAYWHTLTYTGTDPFG  60



>ref|WP_041252697.1| xylose isomerase [Flavobacteriaceae bacterium 3519-10]
Length=442

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPG+ +IK+EG  S+NPL+F++Y+A+  ++GK MK+WMRF+ A+WHT    GSDPFG
Sbjct  9    EFFPGVEQIKFEGVESRNPLAFRYYDADRVVMGKPMKEWMRFATAWWHTLCADGSDPFG  67



>gb|ACU08186.1| Xylose isomerase [Flavobacteriaceae bacterium 3519-10]
Length=461

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            EFFPG+ +IK+EG  S+NPL+F++Y+A+  ++GK MK+WMRF+ A+WHT    GSDPFG
Sbjct  28   EFFPGVEQIKFEGVESRNPLAFRYYDADRVVMGKPMKEWMRFATAWWHTLCADGSDPFG  86



>ref|WP_044627421.1| xylose isomerase [Tamlana nanhaiensis]
 gb|KJD31448.1| xylose isomerase [Tamlana nanhaiensis]
Length=441

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E++ GI +IKYEG  S NPL+FK+YN ++ + GK MK+W +FSVA+WHTF G GSDPFG
Sbjct  8    EYYKGIGEIKYEGKESDNPLAFKYYNPDQVVAGKTMKEWFKFSVAYWHTFCGQGSDPFG  66



>ref|WP_008507562.1| xylose isomerase [Mucilaginibacter paludis]
 gb|EHQ27208.1| Xylose isomerase [Mucilaginibacter paludis DSM 18603]
Length=443

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  223  EGEFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
            E EFF GI +IKYEGP + NPL+F+WY+    + GK +KD +RF+ A+WH+F G G+DPF
Sbjct  8    EKEFFKGISQIKYEGPQTDNPLAFRWYDENRVVAGKTLKDHLRFAGAYWHSFVGNGADPF  67

Query  403  G  405
            G
Sbjct  68   G  68



>ref|WP_024268780.1| Xylose isomerase [Salinispira pacifica]
 gb|AHC15877.1| Xylose isomerase [Salinispira pacifica]
Length=446

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FPGI KI YEGP+S NPLSFK+Y+  + + GK MK+ +RF+VA+WHT   TG+DPFG
Sbjct  10   EYFPGIGKIGYEGPASDNPLSFKFYDENKIVAGKSMKEHLRFAVAYWHTMTATGADPFG  68



>ref|WP_018199100.1| hypothetical protein [Candidatus Hydrogenedens terephthalicus]
Length=438

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  226  GEFFPGIPK-IKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPF  402
             E+FP + K I YEGP+SKNPL+FK+YN +E++LGK M   +RF+V +WHTFRGTG+D F
Sbjct  2    AEYFPEVKKPIAYEGPNSKNPLAFKYYNPKEKVLGKTMAQHLRFAVCYWHTFRGTGADMF  61

Query  403  G  405
            G
Sbjct  62   G  62



>ref|WP_013411463.1| xylose isomerase [Caldicellulosiruptor owensensis]
 gb|ADQ04052.1| xylose isomerase [Caldicellulosiruptor owensensis OL]
Length=438

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            ++F  IP++KYEGP S NP +FK+YN +E I GK +KD +RF+VA+WHTF  TGSDPFG
Sbjct  2    KYFKDIPEVKYEGPQSDNPFAFKYYNPDEIIDGKPLKDHLRFAVAYWHTFCATGSDPFG  60



>ref|WP_013145206.1| xylose isomerase [Geobacillus sp. C56-T3]
 gb|ADI26665.1| xylose isomerase [Geobacillus sp. C56-T3]
Length=445

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>gb|ETL77578.1| xylose isomerase [Phytophthora parasitica]
 gb|ETL99919.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM30630.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM53081.1| xylose isomerase [Phytophthora parasitica]
 gb|ETO82200.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETO82215.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETP23318.1| xylose isomerase [Phytophthora parasitica CJ01A1]
 gb|ETP23343.1| xylose isomerase [Phytophthora parasitica CJ01A1]
Length=452

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+FP +PKI +EG ++KN L+++ YNA E I+GK M++W RF+V +WHTF  TGSDPFG
Sbjct  8    EYFPKVPKIAFEGQNAKNALAYREYNASEVIMGKTMEEWCRFAVCYWHTFGNTGSDPFG  66



>ref|WP_035146022.1| xylose isomerase [Caldicoprobacter oshimai]
Length=438

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +F  I  I YEGP SKNPL+FK+YN  E ++GK M++ +RF+VA+WHTF GTG+DPFG
Sbjct  3    YFENIKPIAYEGPDSKNPLAFKYYNPSEVVMGKTMEEHLRFAVAYWHTFTGTGADPFG  60



>ref|WP_033025489.1| xylose isomerase [Geobacillus sp. CAMR5420]
 gb|KDE48735.1| xylose isomerase [Geobacillus sp. CAMR5420]
Length=445

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_013289876.1| xylose isomerase [Caldicellulosiruptor obsidiansis]
 gb|ADL41871.1| xylose isomerase [Caldicellulosiruptor obsidiansis OB47]
Length=438

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            ++F  IP++KYEGP S NP +FK+YN +E I GK +KD +RF+VA+WHTF  TGSDPFG
Sbjct  2    KYFKDIPEVKYEGPKSDNPFAFKYYNPDEIIDGKPLKDHLRFAVAYWHTFCATGSDPFG  60



>ref|WP_013523871.1| MULTISPECIES: xylose isomerase [Geobacillus]
 gb|ACX79275.1| xylose isomerase [Geobacillus sp. Y412MC61]
 gb|ADU94245.1| xylose isomerase [Geobacillus sp. Y412MC52]
Length=445

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>ref|WP_015374960.1| MULTISPECIES: xylose isomerase [Geobacillus]
 gb|AGE22436.1| xylose isomerase [Geobacillus sp. GHH01]
Length=445

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  3    YFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  60



>gb|EPR27593.1| Xylose isomerase [Geobacillus sp. WSUCF1]
Length=447

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            +FP I  I YEGP S+NPL+FK+YN EE++  K M++ +RFSVA+WHTF G GSDPFG
Sbjct  5    YFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG  62



>ref|WP_034968396.1| xylose isomerase [Epilithonimonas sp. FH1]
 gb|KFC20646.1| xylose isomerase [Epilithonimonas sp. FH1]
Length=442

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  232  FFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            FFPG+ +IK+EG  S+NPL+F++Y+A+  ++GK MK+WMRF++A+WHT    GSDPFG
Sbjct  10   FFPGVEQIKFEGRESRNPLAFRYYDADRTVMGKPMKEWMRFAMAWWHTLCADGSDPFG  67



>ref|WP_027621618.1| xylose isomerase [[Clostridium] clariflavum]
Length=439

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  229  EFFPGIPKIKYEGPSSKNPLSFKWYNAEEEILGKKMKDWMRFSVAFWHTFRGTGSDPFG  405
            E+F GI KI+YEG  S NPL+FK+YN +E +  K MK+ +RF+VA+WHTF+GTG+DPFG
Sbjct  3    EYFKGISKIQYEGKDSDNPLAFKYYNPDEVVGDKTMKEHLRFAVAYWHTFQGTGADPFG  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568922768400