BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF015C16

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    277   4e-88   
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    277   5e-88   Nicotiana tomentosiformis
ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    276   1e-87   Solanum tuberosum [potatoes]
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    275   2e-87   Nicotiana sylvestris
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               271   1e-85   Petunia x hybrida [garden petunia]
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                270   4e-85   Erythranthe guttata [common monkey flower]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               269   8e-85   Rehmannia glutinosa [Chinese foxglove]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               268   9e-85   Rehmannia glutinosa [Chinese foxglove]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    263   1e-82   Sesamum indicum [beniseed]
gb|AAL25590.1|  At2g33150/F25I18.11                                     258   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KCW57292.1|  hypothetical protein EUGRSUZ_H00090                     256   5e-81   Eucalyptus grandis [rose gum]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    258   1e-80   Cucumis melo [Oriental melon]
gb|KDO43603.1|  hypothetical protein CISIN_1g012506mg                   256   1e-80   Citrus sinensis [apfelsine]
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                   256   1e-80   Citrus sinensis [apfelsine]
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    258   1e-80   Tarenaya hassleriana [spider flower]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             257   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             257   2e-80   
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    256   4e-80   Eucalyptus grandis [rose gum]
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        256   4e-80   Cucumis sativus [cucumbers]
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   256   5e-80   Citrus sinensis [apfelsine]
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             256   7e-80   Citrus clementina [clementine]
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   255   7e-80   Citrus sinensis [apfelsine]
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                255   7e-80   Helianthus annuus
emb|CDO99410.1|  unnamed protein product                                255   1e-79   Coffea canephora [robusta coffee]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             254   2e-79   Capsella rubella
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              253   3e-79   Mangifera indica
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    253   1e-78   Sesamum indicum [beniseed]
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    252   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    251   4e-78   
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    251   5e-78   Brassica rapa
emb|CDY19452.1|  BnaC04g11470D                                          251   6e-78   Brassica napus [oilseed rape]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    251   7e-78   Brassica rapa
gb|KJB72151.1|  hypothetical protein B456_011G161700                    249   9e-78   Gossypium raimondii
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    250   1e-77   Camelina sativa [gold-of-pleasure]
emb|CAN81585.1|  hypothetical protein VITISV_023191                     250   1e-77   Vitis vinifera
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    250   1e-77   Camelina sativa [gold-of-pleasure]
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    249   2e-77   Gossypium arboreum [tree cotton]
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             249   2e-77   Eutrema salsugineum [saltwater cress]
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    249   2e-77   
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    249   2e-77   Vitis vinifera
gb|KJB72150.1|  hypothetical protein B456_011G161700                    249   4e-77   Gossypium raimondii
emb|CDY37750.1|  BnaA04g19180D                                          248   5e-77   Brassica napus [oilseed rape]
gb|KJB72152.1|  hypothetical protein B456_011G161700                    248   6e-77   Gossypium raimondii
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   7e-77   Nelumbo nucifera [Indian lotus]
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     248   7e-77   Brassica napus [oilseed rape]
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   7e-77   Pyrus x bretschneideri [bai li]
gb|EPS68937.1|  hypothetical protein M569_05826                         248   8e-77   Genlisea aurea
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             248   8e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   8e-77   Populus euphratica
emb|CDX84701.1|  BnaA03g15290D                                          247   1e-76   
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    247   2e-76   Brassica rapa
emb|CDY23766.1|  BnaC04g43560D                                          247   2e-76   Brassica napus [oilseed rape]
emb|CDX79511.1|  BnaC03g18470D                                          247   2e-76   
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    247   2e-76   Elaeis guineensis
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    246   6e-76   Cucumis melo [Oriental melon]
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    245   8e-76
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         244   2e-75   Jatropha curcas
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             243   4e-75   Prunus persica
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    243   6e-75   Prunus mume [ume]
gb|ACU21519.1|  unknown                                                 239   7e-75   Glycine max [soybeans]
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    241   3e-74   Sesamum indicum [beniseed]
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    241   3e-74   
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    241   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    241   6e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    240   6e-74   
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    240   6e-74   Cucumis sativus [cucumbers]
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    240   6e-74   Fragaria vesca subsp. vesca
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    240   1e-73   Fragaria vesca subsp. vesca
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               240   1e-73   Petunia x hybrida [garden petunia]
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    239   1e-73   Phoenix dactylifera
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    239   3e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    238   5e-73   Prunus mume [ume]
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                238   5e-73   Glycine max [soybeans]
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    238   6e-73   
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    238   7e-73   Populus euphratica
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                238   8e-73   
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    237   9e-73   Populus euphratica
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    236   2e-72   Solanum tuberosum [potatoes]
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             236   5e-72   Prunus persica
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         235   7e-72   Jatropha curcas
gb|ACJ84483.1|  unknown                                                 229   9e-72   Medicago truncatula
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    234   1e-71   Phoenix dactylifera
ref|XP_006605730.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    232   2e-71   
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    234   3e-71   Nicotiana sylvestris
gb|KDO65878.1|  hypothetical protein CISIN_1g0125222mg                  229   4e-71   Citrus sinensis [apfelsine]
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    232   1e-70   Glycine max [soybeans]
gb|KDO65876.1|  hypothetical protein CISIN_1g0125222mg                  229   2e-70   Citrus sinensis [apfelsine]
gb|AFW74040.1|  hypothetical protein ZEAMMB73_080325                    228   3e-70   
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    230   3e-70   Oryza brachyantha
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    231   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                231   4e-70   Erythranthe guttata [common monkey flower]
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    230   4e-70   Helianthus annuus
gb|ABR16781.1|  unknown                                                 231   4e-70   Picea sitchensis
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    231   6e-70   Nicotiana tomentosiformis
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    230   6e-70   Populus euphratica
gb|KDO65875.1|  hypothetical protein CISIN_1g0125222mg                  228   6e-70   Citrus sinensis [apfelsine]
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             230   7e-70   Populus trichocarpa [western balsam poplar]
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    229   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW74041.1|  hypothetical protein ZEAMMB73_080325                    228   1e-69   
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    229   1e-69   Phoenix dactylifera
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          229   2e-69   
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          229   2e-69   Amborella trichopoda
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          228   2e-69   Zea mays [maize]
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     228   2e-69   Medicago truncatula
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    228   3e-69   
gb|ACN39947.1|  unknown                                                 228   4e-69   Picea sitchensis
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    228   4e-69   Elaeis guineensis
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             228   4e-69   
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             228   5e-69   Selaginella moellendorffii
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             228   5e-69   Citrus clementina [clementine]
dbj|BAJ85217.1|  predicted protein                                      225   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP03848.1|  unnamed protein product                                227   1e-68   Coffea canephora [robusta coffee]
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    226   1e-68   Elaeis guineensis
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          226   2e-68   Morus notabilis
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    225   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    225   4e-68   Pyrus x bretschneideri [bai li]
gb|ABR17647.1|  unknown                                                 225   5e-68   Picea sitchensis
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                224   9e-68   Ricinus communis
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   1e-67   Cicer arietinum [garbanzo]
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    224   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   1e-67   Brachypodium distachyon [annual false brome]
dbj|BAJ87577.1|  predicted protein                                      224   1e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   1e-67   Malus domestica [apple tree]
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    223   2e-67   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   222   5e-67   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             222   6e-67   Phaseolus vulgaris [French bean]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  222   6e-67   
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    221   2e-66   Setaria italica
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    220   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10129.1|  hypothetical protein B456_001G185200                    218   3e-66   Gossypium raimondii
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    220   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    219   4e-66   Camelina sativa [gold-of-pleasure]
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    219   7e-66   Gossypium arboreum [tree cotton]
emb|CDX86611.1|  BnaC08g00920D                                          218   1e-65   
pdb|2C7Y|A  Chain A, Plant Enzyme                                       216   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    217   4e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB10128.1|  hypothetical protein B456_001G185200                    218   5e-65   Gossypium raimondii
gb|AFW74043.1|  hypothetical protein ZEAMMB73_080325                    207   5e-65   
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     217   6e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             216   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    216   8e-65   Brassica rapa
ref|XP_001764272.1|  predicted protein                                  216   2e-64   
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             215   2e-64   Medicago truncatula
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    214   7e-64   Elaeis guineensis
gb|AFK40880.1|  unknown                                                 213   1e-63   Medicago truncatula
ref|XP_006307516.1|  hypothetical protein CARUB_v10009140mg             209   1e-63   
gb|ACN29136.1|  unknown                                                 213   2e-63   Zea mays [maize]
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    213   2e-63   Arabis alpina [alpine rockcress]
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             213   3e-63   
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    213   3e-63   Gossypium arboreum [tree cotton]
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    212   4e-63   Populus euphratica
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    212   4e-63   Cicer arietinum [garbanzo]
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    212   4e-63   
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    212   4e-63   Populus euphratica
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             212   5e-63   Phaseolus vulgaris [French bean]
ref|NP_001048523.1|  Os02g0817700                                       212   6e-63   
gb|AEQ94132.1|  putative 3-ketoacyl CoA thiolase                        208   7e-63   Elaeis guineensis
emb|CDY15520.1|  BnaA08g28040D                                          211   1e-62   Brassica napus [oilseed rape]
gb|KCW50170.1|  hypothetical protein EUGRSUZ_K03601                     209   1e-62   Eucalyptus grandis [rose gum]
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          211   1e-62   Sorghum bicolor [broomcorn]
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    211   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    211   1e-62   Tarenaya hassleriana [spider flower]
gb|KCW50169.1|  hypothetical protein EUGRSUZ_K03601                     209   2e-62   Eucalyptus grandis [rose gum]
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    210   2e-62   Cicer arietinum [garbanzo]
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    211   2e-62   Setaria italica
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    211   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    210   4e-62   Nicotiana sylvestris
gb|KJB42404.1|  hypothetical protein B456_007G152600                    209   7e-62   Gossypium raimondii
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             209   8e-62   Capsella rubella
gb|KJB42405.1|  hypothetical protein B456_007G152600                    209   9e-62   Gossypium raimondii
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     209   1e-61   Eucalyptus grandis [rose gum]
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    209   1e-61   Eucalyptus grandis [rose gum]
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    207   2e-61   
ref|XP_001762605.1|  predicted protein                                  207   3e-61   
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  207   3e-61   Glycine soja [wild soybean]
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    206   8e-61   
ref|NP_001242568.1|  uncharacterized protein LOC100789930               206   8e-61   
ref|XP_007049828.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4    203   2e-60   
ref|XP_007049827.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    203   2e-60   
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    206   2e-60   
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             204   3e-60   
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            204   4e-60   Glycine max [soybeans]
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   6e-60   Oryza brachyantha
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    204   7e-60   Cucumis sativus [cucumbers]
ref|NP_001064764.1|  Os10g0457600                                       203   1e-59   
gb|EEC67095.1|  hypothetical protein OsI_33888                          203   1e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             203   2e-59   Capsella rubella
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    203   2e-59   
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    202   2e-59   
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             202   4e-59   Eutrema salsugineum [saltwater cress]
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  202   4e-59   Triticum urartu
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    201   8e-59   Arabidopsis lyrata subsp. lyrata
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  199   4e-58   Triticum urartu
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            199   7e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             197   9e-58   
ref|XP_008349049.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    188   1e-57   
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    198   1e-57   Camelina sativa [gold-of-pleasure]
emb|CDY33940.1|  BnaA02g30470D                                          196   5e-57   Brassica napus [oilseed rape]
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   194   2e-56   Citrus sinensis [apfelsine]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    194   3e-56   Brassica rapa
ref|XP_007049829.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5    189   1e-55   
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    192   2e-55   Camelina sativa [gold-of-pleasure]
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 191   3e-55   Vanda hybrid cultivar
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    191   5e-55   Camelina sativa [gold-of-pleasure]
emb|CDY05657.1|  BnaC02g38800D                                          191   9e-55   
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    190   1e-54   Brachypodium distachyon [annual false brome]
gb|ADE77908.1|  unknown                                                 189   2e-54   Picea sitchensis
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    185   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    185   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    184   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             183   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    182   4e-52   Brassica rapa
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            182   7e-52   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 182   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    177   6e-50   Tarenaya hassleriana [spider flower]
ref|XP_005646163.1|  thiolase                                           176   3e-49   Coccomyxa subellipsoidea C-169
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             171   1e-47   Volvox carteri f. nagariensis
dbj|BAA25250.1|  mutated 3-ketoacyl-CoA thiolase                        161   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             167   3e-46   
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         167   5e-46   Chlamydomonas reinhardtii
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             165   9e-46   
gb|KIY92728.1|  acetyl-CoA acyltransferase 1                            157   4e-43   Monoraphidium neglectum
ref|XP_005845320.1|  hypothetical protein CHLNCDRAFT_25846              154   6e-42   Chlorella variabilis
gb|ACJ84675.1|  unknown                                                 145   9e-40   Medicago truncatula
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             143   4e-37   Auxenochlorella protothecoides
emb|CEF98532.1|  Thiolase-like, subgroup                                133   1e-33   Ostreococcus tauri
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              132   4e-33   Helicosporidium sp. ATCC 50920
ref|XP_007513169.1|  unknown                                            132   4e-33   Bathycoccus prasinos
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   131   4e-33   Citrus sinensis [apfelsine]
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             130   1e-32   Branchiostoma floridae
ref|XP_960422.1|  3-ketoacyl-CoA thiolase                               130   2e-32   Neurospora crassa OR74A
gb|KDO65879.1|  hypothetical protein CISIN_1g0125222mg                  128   4e-32   Citrus sinensis [apfelsine]
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    133   5e-32   
ref|XP_005082434.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    127   5e-32   
ref|XP_003353115.1|  hypothetical protein SMAC_03432                    129   6e-32   Sordaria macrospora k-hell
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal               128   1e-31   Xenopus tropicalis [western clawed frog]
ref|XP_004349337.1|  peroxisomal 3-ketoacyl-CoA thiolase B              127   1e-31   Capsaspora owczarzaki ATCC 30864
ref|XP_643924.1|  acetyl-CoA C-acyltransferase                          127   2e-31   Dictyostelium discoideum AX4
gb|EIE80258.1|  hypothetical protein RO3G_04963                         127   2e-31   Rhizopus delemar RA 99-880
ref|XP_005348136.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    125   3e-31   
ref|XP_005348141.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    125   3e-31   
ref|XP_001418570.1|  predicted protein                                  126   5e-31   Ostreococcus lucimarinus CCE9901
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    126   5e-31   
ref|XP_009262137.1|  hypothetical protein FPSE_10745                    125   7e-31   Fusarium pseudograminearum CS3096
ref|XP_011328216.1|  3-ketoacyl-CoA thiolase                            125   7e-31   Fusarium graminearum PH-1
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    125   8e-31   Microtus ochrogaster [prairie voles]
ref|XP_003664280.1|  3-ketoacyl-CoA thiolase                            125   9e-31   Thermothelomyces thermophila ATCC 42464
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    125   9e-31   Microtus ochrogaster [prairie voles]
emb|CCF32753.1|  acetyl-CoA acetyltransferase                           125   1e-30   Colletotrichum higginsianum
emb|CEF85217.1|  unnamed protein product                                125   1e-30   
gb|ETO19211.1|  hypothetical protein RFI_18020                          119   1e-30   Reticulomyxa filosa
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    125   1e-30   
gb|ERZ96342.1|  hypothetical protein GLOINDRAFT_71751                   124   2e-30   
gb|KJB42403.1|  hypothetical protein B456_007G152600                    124   2e-30   Gossypium raimondii
gb|KIL93411.1|  hypothetical protein FAVG1_03392                        124   2e-30   Fusarium avenaceum
gb|EFQ33554.1|  acetyl-CoA acetyltransferase                            124   3e-30   Colletotrichum graminicola M1.001
ref|XP_007595974.1|  acetyl-CoA acetyltransferase                       124   3e-30   
gb|KDN71907.1|  putative acetyl-CoA acetyltransferase                   124   3e-30   Colletotrichum sublineola
ref|XP_003001876.1|  3-ketoacyl-CoA thiolase                            123   4e-30   Verticillium alfalfae VaMs.102
ref|XP_002904159.1|  3-ketoacyl-CoA thiolase A                          123   4e-30   Phytophthora infestans T30-4
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    124   4e-30   Strongylocentrotus purpuratus [purple urchin]
gb|EFA76209.1|  acetyl-CoA C-acyltransferase                            123   5e-30   Heterostelium album PN500
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    123   5e-30   Chrysemys picta bellii
ref|XP_005852686.1|  3-ketoacyl- thiolase peroxisomal                   123   5e-30   Nannochloropsis gaditana CCMP526
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    123   5e-30   
gb|KEY69142.1|  hypothetical protein S7711_04925                        123   5e-30   Stachybotrys chartarum IBT 7711
gb|KFA63582.1|  hypothetical protein S40285_04144                       123   6e-30   Stachybotrys chlorohalonata IBT 40285
gb|ETI53494.1|  hypothetical protein F443_03599                         123   6e-30   Phytophthora parasitica P1569
gb|EGU82326.1|  hypothetical protein FOXB_07155                         123   6e-30   Fusarium oxysporum Fo5176
gb|ETK93319.1|  hypothetical protein L915_03492                         123   6e-30   Phytophthora parasitica
dbj|GAM22408.1|  hypothetical protein SAMD00019534_055830               123   7e-30   Acytostelium subglobosum LB1
gb|EWG42127.1|  acetyl-CoA acyltransferase                              123   7e-30   Fusarium verticillioides 7600
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                        123   7e-30   Nannochloropsis gaditana
ref|XP_005854303.1|  beta-ketoacyl-CoA thiolase                         123   7e-30   Nannochloropsis gaditana CCMP526
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal               122   8e-30   Xenopus laevis [clawed frog]
dbj|BAG62666.1|  unnamed protein product                                117   9e-30   Homo sapiens [man]
ref|XP_001226866.1|  conserved hypothetical protein                     122   9e-30   Chaetomium globosum CBS 148.51
gb|EDL76922.1|  rCG25918, isoform CRA_a                                 119   9e-30   Rattus norvegicus [brown rat]
emb|CDO68177.1|  hypothetical protein BN946_scf184938.g29               122   1e-29   Trametes cinnabarina
ref|XP_006512179.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    119   1e-29   
gb|ENH84024.1|  3-ketoacyl-thiolase                                     122   1e-29   
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572             122   1e-29   
ref|XP_002564709.1|  Pc22g06820                                         122   1e-29   
gb|EHK49858.1|  putative 3-ketoacyl-CoA thiolase                        122   1e-29   
ref|XP_004635292.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    121   1e-29   
ref|XP_009648812.1|  3-ketoacyl-CoA thiolase                            122   1e-29   
ref|XP_007913467.1|  putative 3-ketoacyl- thiolase protein              122   2e-29   
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                122   2e-29   
emb|CCA76233.1|  probable POT1-acetyl-CoA C-acyltransferase, pero...    121   2e-29   
gb|AAB88181.1|  similar to 3-oxoacyl-CoA thiolase                       116   2e-29   
gb|EPE04951.1|  3-ketoacyl- thiolase                                    121   2e-29   
gb|EKV04734.1|  hypothetical protein PDIG_87260                         121   3e-29   
gb|KGG50758.1|  hypothetical protein DI09_57p130                        121   3e-29   
dbj|BAK63365.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor         115   3e-29   
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    121   3e-29   
ref|XP_001247762.1|  hypothetical protein CIMG_01533                    120   3e-29   
ref|XP_006986814.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    118   4e-29   
ref|XP_003065696.1|  3-ketoacyl-CoA thiolase, peroxisomal precurs...    120   4e-29   
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    121   4e-29   
ref|XP_005096572.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    121   4e-29   
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             121   4e-29   
ref|XP_003650647.1|  hypothetical protein THITE_2110329                 120   4e-29   
ref|XP_002742159.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    120   5e-29   
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    120   5e-29   
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    120   5e-29   
ref|XP_001905889.1|  hypothetical protein                               120   5e-29   
ref|XP_007943892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    119   6e-29   
gb|EFX04324.1|  3-ketoacyl-CoA thiolase peroxisomal a precursor         120   7e-29   
ref|XP_005813530.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    120   7e-29   
ref|XP_003712230.1|  3-ketoacyl-CoA thiolase                            120   7e-29   
ref|XP_002500295.1|  acetyl-coa acyltransferase                         120   7e-29   
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      120   8e-29   
dbj|BAE25296.1|  unnamed protein product                                120   8e-29   
gb|AAH89821.1|  Acaa1 protein                                           119   8e-29   
ref|XP_002626309.1|  3-ketoacyl-coA thiolase peroxisomal A              120   9e-29   
ref|XP_007276712.1|  3-ketoacyl- thiolase                               119   9e-29   
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    119   1e-28   
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  119   1e-28   
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      119   1e-28   
gb|KGO78426.1|  Thiolase-like, subgroup                                 119   1e-28   
ref|XP_010355558.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    119   1e-28   
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    120   1e-28   
ref|XP_005386653.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    119   1e-28   
gb|ENH73947.1|  3-ketoacyl-CoA thiolase, peroxisomal                    122   1e-28   
ref|XP_006986793.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    119   1e-28   
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 119   1e-28   
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    119   1e-28   
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  119   1e-28   
ref|XP_004471222.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    115   1e-28   
gb|EQB52382.1|  acetyl-CoA acetyltransferase                            119   1e-28   
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    119   2e-28   
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                119   2e-28   
gb|KGO37526.1|  Thiolase-like, subgroup                                 119   2e-28   
ref|XP_006694648.1|  3-ketoacyl-CoA thiolase-like protein               119   2e-28   
ref|XP_008314704.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    119   2e-28   
dbj|GAA82972.1|  3-ketoacyl-coA thiolase peroxisomal A precursor        119   2e-28   
gb|KEY75796.1|  3 ketoacyl coA thiolase peroxisomal A                   119   2e-28   
ref|XP_008421414.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    119   2e-28   
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    119   2e-28   
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  119   2e-28   
ref|XP_001932756.1|  3-ketoacyl-CoA thiolase B                          119   2e-28   
ref|XP_751733.1|  3-ketoacyl-coA thiolase peroxisomal A precursor       119   2e-28   
ref|XP_007836703.1|  3-ketoacyl-CoA thiolase                            119   2e-28   
ref|XP_001544549.1|  hypothetical protein HCAG_01596                    119   2e-28   
ref|XP_005546712.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    118   2e-28   
gb|EEH08158.1|  3-ketoacyl-coA thiolase peroxisomal A                   119   2e-28   
gb|EGC43203.1|  3-ketoacyl-CoA thiolase                                 119   2e-28   
gb|KIH94193.1|  acetyl-CoA acyltransferase                              119   2e-28   
gb|KHN99131.1|  3-ketoacyl-CoA thiolase                                 119   2e-28   
emb|CEG63739.1|  Putative Acetyl-CoA acyltransferase                    119   2e-28   
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    119   2e-28   
ref|XP_007366726.1|  thiolase                                           118   2e-28   
ref|XP_005001163.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    118   2e-28   
ref|XP_008900800.1|  hypothetical protein PPTG_08457                    118   2e-28   
ref|XP_011121603.1|  hypothetical protein AOL_s00078g38                 118   2e-28   
emb|CEI96344.1|  Putative Acetyl-CoA acyltransferase                    118   3e-28   
ref|XP_001271962.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    118   3e-28   
ref|XP_009216548.1|  3-ketoacyl-CoA thiolase                            118   3e-28   
ref|XP_003894723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    118   3e-28   
gb|AAH14474.1|  ACAA1 protein                                           117   3e-28   
ref|NP_001123882.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform b     117   3e-28   
ref|XP_001088834.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    118   3e-28   
ref|XP_005546711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    118   3e-28   
ref|XP_007969955.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    118   3e-28   
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    118   4e-28   
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    118   4e-28   
ref|XP_007000547.1|  hypothetical protein TREMEDRAFT_24802              118   4e-28   
ref|XP_004033893.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    117   4e-28   
gb|ACJ02108.1|  3-ketoacyl-coenzyme A thiolase                          114   4e-28   
ref|XP_006713185.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    117   4e-28   
gb|ERS99148.1|  hypothetical protein HMPREF1624_04344                   117   4e-28   
gb|KIS00576.1|  acetyl-CoA acyltransferase                              117   5e-28   
ref|XP_007517130.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    117   5e-28   
gb|KIM26928.1|  hypothetical protein M408DRAFT_72087                    117   5e-28   
gb|KIR31004.1|  acetyl-CoA acyltransferase                              117   5e-28   
ref|XP_005940527.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    118   5e-28   
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       117   6e-28   
emb|CEJ90926.1|  Putative 3-ketoacyl-coA thiolase peroxisomal A         117   6e-28   
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        117   6e-28   
gb|EPS33443.1|  hypothetical protein PDE_08405                          117   6e-28   
ref|XP_009443455.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    117   6e-28   
dbj|BAE72965.1|  hypothetical protein                                   117   6e-28   
gb|EWC45293.1|  peroxisomal 3-ketoacyl-CoA thiolase                     117   6e-28   
gb|ACF24566.1|  acetyl-CoA acyltransferase                              115   6e-28   
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    117   6e-28   
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    117   6e-28   
ref|XP_009833032.1|  hypothetical protein, variant 3                    116   6e-28   
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    117   6e-28   
ref|XP_003306063.1|  hypothetical protein PTT_19080                     117   7e-28   
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    117   7e-28   
ref|XP_003170852.1|  3-ketoacyl-CoA thiolase                            117   8e-28   
ref|XP_009833030.1|  hypothetical protein, variant 1                    116   8e-28   
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    117   8e-28   
ref|XP_566859.1|  acetyl-CoA C-acyltransferase                          117   9e-28   
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    117   9e-28   
gb|KID77958.1|  3-ketoacyl-CoA thiolase                                 117   9e-28   
gb|KID67493.1|  3-ketoacyl-CoA thiolase                                 117   9e-28   
ref|XP_001401936.1|  acetyl-CoA C-acyltransferase                       117   9e-28   
ref|XP_007818295.1|  3-ketoacyl-CoA thiolase                            117   9e-28   
gb|KIR35530.1|  acetyl-CoA acyltransferase                              117   9e-28   
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    117   9e-28   
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    117   9e-28   
gb|EGD97916.1|  3-ketoacyl-CoA thiolase peroxisomal A                   117   1e-27   
emb|CCE27342.1|  uncharacterized protein CPUR_00816                     117   1e-27   
gb|KFH47479.1|  3-ketoacyl-CoA thiolase, peroxisomal-like protein       117   1e-27   
ref|XP_007582372.1|  putative 3-ketoacyl-coa thiolase peroxisomal...    117   1e-27   
ref|XP_003232365.1|  3-ketoacyl-CoA thiolase peroxisomal A              117   1e-27   
gb|KDB27199.1|  hypothetical protein H109_01068                         116   1e-27   
gb|EZF34509.1|  hypothetical protein H101_01942                         116   1e-27   
ref|XP_009549597.1|  hypothetical protein HETIRDRAFT_441328             116   1e-27   
ref|XP_001836176.2|  3-ketoacyl-CoA thiolase                            116   1e-27   
ref|XP_009833029.1|  hypothetical protein H257_08703                    116   1e-27   
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    116   1e-27   
ref|XP_004538713.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    116   1e-27   
ref|XP_002766693.1|  Acetyl-CoA acetyltransferase, putative             111   1e-27   
ref|XP_003046188.1|  predicted protein                                  116   1e-27   
ref|XP_002111185.1|  expressed hypothetical protein                     116   1e-27   
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    116   1e-27   
ref|XP_001213158.1|  3-ketoacyl-CoA thiolase                            116   1e-27   
ref|XP_005317423.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    115   2e-27   
ref|XP_001820215.1|  acetyl-CoA C-acyltransferase                       116   2e-27   
ref|XP_006806602.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    116   2e-27   
emb|CCX07864.1|  Similar to 3-ketoacyl-CoA thiolase B, peroxisoma...    116   2e-27   
dbj|GAM41679.1|  3-ketoacyl-CoA thiolase                                116   2e-27   
ref|XP_003020839.1|  3-ketoacyl-CoA thiolase (POT1), putative           116   2e-27   
gb|KFX48527.1|  3-ketoacyl-CoA thiolase, peroxisomal                    116   2e-27   
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  116   2e-27   
ref|XP_004538712.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    116   2e-27   
gb|KGB75585.1|  acetyl-CoA C-acyltransferase                            116   2e-27   
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    116   2e-27   
ref|XP_003011454.1|  3-ketoacyl-CoA thiolase (POT1), putative           116   2e-27   
emb|CDM36619.1|  3-ketoacyl-CoA thiolase, peroxisomal                   116   2e-27   
ref|XP_004676370.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    115   2e-27   
gb|AFR92621.1|  acetyl-CoA acyltransferase                              115   2e-27   
gb|KDO30583.1|  hypothetical protein SPRG_04484                         115   2e-27   
ref|XP_006634258.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    115   2e-27   
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    116   2e-27   
emb|CCM03113.1|  predicted protein                                      115   2e-27   
ref|XP_001266900.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    115   2e-27   
ref|XP_002374205.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    115   2e-27   
gb|EIT80840.1|  3-oxoacyl CoA thiolase                                  115   2e-27   
ref|XP_004377453.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    115   2e-27   
ref|XP_007925002.1|  hypothetical protein MYCFIDRAFT_210863             115   2e-27   
ref|XP_006869211.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    115   3e-27   
ref|XP_663250.1|  hypothetical protein AN5646.2                         115   3e-27   
ref|XP_008616222.1|  acetyl-CoA acyltransferase 1                       115   3e-27   
ref|XP_003132152.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    115   3e-27   
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    115   3e-27   
dbj|BAE35878.1|  unnamed protein product                                115   3e-27   
gb|KIR48491.1|  acetyl-CoA acyltransferase                              115   3e-27   
dbj|GAD94451.1|  acetyl-CoA C-acyltransferase                           115   3e-27   
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    115   3e-27   
gb|KIY37061.1|  acetyl-CoA acyltransferase                              115   3e-27   
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    115   3e-27   
ref|XP_007674965.1|  hypothetical protein BAUCODRAFT_146808             115   3e-27   
gb|KIR86712.1|  acetyl-CoA acyltransferase                              115   4e-27   
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               115   4e-27   
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    115   4e-27   
ref|XP_006910841.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    115   4e-27   
ref|XP_004419564.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    114   4e-27   
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    115   4e-27   
ref|XP_002151257.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    115   4e-27   
gb|KDB18023.1|  3-ketoacyl-CoA thiolase                                 115   5e-27   
gb|EYE99809.1|  thiolase                                                115   5e-27   
ref|XP_005317429.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    114   5e-27   
ref|XP_002844427.1|  3-ketoacyl-CoA thiolase                            115   5e-27   
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    114   6e-27   
ref|XP_004854314.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    114   6e-27   
gb|KFY51958.1|  hypothetical protein V497_08728                         114   6e-27   
ref|XP_003191423.1|  acetyl-CoA C-acyltransferase                       114   6e-27   
gb|EHK18224.1|  hypothetical protein TRIVIDRAFT_80821                   114   6e-27   
ref|XP_004835308.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    114   6e-27   
ref|XP_002341780.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    114   7e-27   
gb|KIR50795.1|  acetyl-CoA acyltransferase                              114   7e-27   
gb|ELR08725.1|  hypothetical protein GMDG_03407                         114   7e-27   
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    114   8e-27   
ref|XP_005317428.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    114   8e-27   
gb|KEZ40268.1|  3-ketoacyl-CoA thiolase, peroxisomal                    114   9e-27   
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    114   9e-27   
ref|XP_004614629.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    113   9e-27   
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    114   1e-26   
ref|XP_006462290.1|  hypothetical protein AGABI2DRAFT_193507            114   1e-26   
ref|XP_004704132.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    113   1e-26   
gb|ELK13640.1|  3-ketoacyl-CoA thiolase, peroxisomal                    114   1e-26   
ref|XP_011110053.1|  hypothetical protein H072_4093                     114   1e-26   
ref|XP_005040596.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    113   1e-26   
ref|XP_002584604.1|  3-ketoacyl-CoA thiolase                            114   1e-26   
gb|KDQ50409.1|  hypothetical protein JAAARDRAFT_584417                  114   1e-26   
dbj|BAK06976.1|  predicted protein                                      114   1e-26   
ref|XP_005718521.1|  Fatty acid beta-oxydation multifunctional pr...    117   1e-26   
ref|XP_008877314.1|  hypothetical protein H310_12126                    114   1e-26   
ref|XP_004854313.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    114   1e-26   
ref|XP_008153145.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    113   1e-26   
ref|XP_004835307.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    114   1e-26   
ref|XP_006680802.1|  hypothetical protein BATDEDRAFT_37225              114   1e-26   
dbj|GAN09045.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor         114   1e-26   
gb|KFH68616.1|  acetyl-CoA acyltransferase                              114   1e-26   
ref|XP_005901201.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    113   1e-26   
ref|XP_004412370.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    113   1e-26   
emb|CCU81710.1|  3-ketoacyl-coA thiolase/POT1                           114   1e-26   



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  153



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTNL+PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNLSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+K+GGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKKGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  153



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTN++PSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNVSPSEIGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            +IERQRVLLQHLRP+  +SSL++++SS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    SIERQRVLLQHLRPSQTSSSLENLDSSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VLKAL+EKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGSFKDTYPDDLLAPVLKALMEKTNVSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHLRP+  +SSL+ IESS+SAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIESSLSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVMEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLLQHLRP+  +S+L+ I SSVSAS+C AGDSAAY R+SV+GDD+VIVAA+RT 
Sbjct  4    AIDRQRVLLQHLRPSFTSSTLEDIGSSVSASICLAGDSAAYHRSSVFGDDVVIVAAHRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>gb|AAL25590.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
Length=390

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>gb|KCW57292.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=380

 Score =   256 bits (654),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  153



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLRP+   SSL S +S +SAS C AGDSAAYQRNSV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPS---SSLHSHDSPLSASACLAGDSAAYQRNSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDI+VG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLGPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>gb|KDO43603.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=415

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>gb|KDO43602.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=406

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP+++ S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSPSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  153



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ +LL HLRP+   SS  + ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPS---SSAYTNESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   ICKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 139/150 (93%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+P
Sbjct  4    AIERQRVLLEHLRPSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGG KDTYPDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAF
Sbjct  60   LCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  120  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  149



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRV+LQHL+P+  +SSL++++SS+SASVCAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVVLQHLKPSFTSSSLENLDSSLSASVCAAGDSAAYHRTSAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YA   ETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YA---ETVPVRTVNRQCSSGLQAVADVAAA  150



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP   ASS  + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRP--CASSSHNFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG  KDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNLKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHLRP+N++S   + ES+++ASVCAAGDSAAY R SVYGDD+VIVAA+RT 
Sbjct  4    AINRQQVLLQHLRPSNSSSH--NYESALAASVCAAGDSAAYHRASVYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNL+PSEVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLDPSEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPDTVPLRTVNRQCSSGLQAVADVAAA  151



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHLRP+  +SSL+ I+SS+SAS+C+AGDS+AY R++V+GDD+VIVAAYRTP
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIDSSISASICSAGDSSAYHRSTVFGDDVVIVAAYRTP  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSA+YQR S+YGDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NFEASLSASACLAGDSASYQRASLYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEK N+NP+EVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKKNVNPAEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LLQHL P+  +S+  +  S++SAS C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AINRQQILLQHLNPSAPSSADQNYNSALSASACLAGDSAAYQRTNAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPGEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP    SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRP----SSSHSFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  60   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  120  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  149



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 1/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSSH-SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  63   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  122

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  152



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>gb|KJB72151.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=415

 Score =   249 bits (636),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++ S     S++SAS C AGDSAAY R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFSSHQNNSALSASACLAGDSAAYLRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPKEVGDIVVGTVLAPGSLRAMECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAAA  153



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   249 bits (635),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLLQHLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLQHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  153



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 133/150 (89%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP    SS    +SS+SASVC AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLDHLRP----SSQTHHQSSLSASVCLAGDSAAYHRTAAFGDDVVIVAAYRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGG+KDT+PDDLLA VLKALIEKTNLNP+EVGDIIVGTVLAPGS RA+ECRMAAF
Sbjct  60   LCKSKRGGYKDTHPDDLLAPVLKALIEKTNLNPNEVGDIIVGTVLAPGSQRATECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  120  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  149



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AMERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTV APGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVWAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPNEVGDIVVGTVLAPGSLRAIECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVAD+AAA
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADIAAA  153



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 137/150 (91%), Gaps = 6/150 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQRVLL+HLRP      +++ ESS+SAS+CAAGDSA Y R+SV+GDD+VIVAAYR+ 
Sbjct  4    AVDRQRVLLRHLRP------IENTESSISASICAAGDSAPYHRSSVFGDDVVIVAAYRSA  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYP+D+LA VL+ALI+KTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  58   LCKSKRGSFKDTYPEDILAPVLRALIDKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  117

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  118  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  147



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL+HLRP    SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLEHLRP----SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  60   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  120  YAGFPETVPIRTVNRQCSSGLQAVADVAAS  149



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 133/150 (89%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP+   SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPS---SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAS  150



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P+    SLD   S +SAS+CAAGDS AYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPST--PSLDE-SSMLSASICAAGDSTAYQRSSCFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAS  150



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQNILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTY DDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYADDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   245 bits (626),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMA F
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMATF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            Y GFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YPGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP++++S   + ESS+SAS C AGDSAAYQR +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPSSSSSH--NYESSLSASACLAGDSAAYQRTAVFGDDVVIVAAYRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNLN SEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLNASEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            FYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  122  FYAGFPETVPIRTVNRQCSSGLQAVADVAAS  152



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A  RQRVLL HLRP+  +SSL   +SS +SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDSSSLSASACVAGDSAAYARTNVFGDDVVIVAAYRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            FYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  122  FYAGFPETVPIRTVNRQCSSGLQAVADVAAS  152



>gb|ACU21519.1| unknown [Glycine max]
Length=349

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQR+LLQHLRPT++ S   S +SS+S S+C AGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    ATNRQRILLQHLRPTSSVSHQTS-DSSLSPSICLAGDSAAYHRTAAFGDDIVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT PDDLLA+VLKALI++TNLNP+EVGDIIVGTVLAPGS+RA ECRMAA 
Sbjct  63   ICKSKRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIIVGTVLAPGSLRAIECRMAAL  122

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP++VPVRTVNRQCSSGLQAVADVAA
Sbjct  123  YAGFPDSVPVRTVNRQCSSGLQAVADVAA  151



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLLQHLRP ++ SS +     +SAS+CAAGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNYESDPLSASICAAGDSAAYHRTAAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV+APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVMAPGSLRATECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAAS  153



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL+HLRP+ ++S   S    +SASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AIDRQRVLLRHLRPSPSSSPNGS--HLISASVCAAGDSAAYQRNSCFGDDVVVVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP++LL  VLKAL++KTNLNP+EVGDI+VGTVLAPG+ RA+ECRMAAF
Sbjct  62   ICKSKRGGFKDTYPEELLTVVLKALLDKTNLNPNEVGDIVVGTVLAPGAQRATECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP +++S   S ESS+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFESSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VL+ALI+KTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIDKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLR    +SSL S +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLR---PSSSLPSHDSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLR    +SSL S +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLR---PSSSLPSHDSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 2/151 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASS-LDSIESSV-SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            A+ RQ+VLLQHLRP ++ SS + + ESSV SA +CAAGDSAAY R   +GDDIVIVAAYR
Sbjct  4    ALNRQKVLLQHLRPNSSLSSAIQTHESSVLSAEICAAGDSAAYHRTGAFGDDIVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK+KRGGFKDT  DDLLA VLKA+IE+TNLNPSEVGDI+VGTVLAPGS+RA ECRMA
Sbjct  64   TAVCKAKRGGFKDTLADDLLAPVLKAVIERTNLNPSEVGDIVVGTVLAPGSLRAIECRMA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AFYAGFP+TVP+RTVNRQCSSGLQAVADVAA
Sbjct  124  AFYAGFPDTVPIRTVNRQCSSGLQAVADVAA  154



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 135/150 (90%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HLRP++++       SS+SASVCAAGDSAAY RN V+GDD+VIVAAYRTP
Sbjct  4    AINRQKVLLDHLRPSSSSDD-----SSLSASVCAAGDSAAYARNHVFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDTY DDLLA VLKA++EKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTYADDLLAPVLKAVVEKTNLNPKEVGDIVVGTVLAPGSQRASECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  119  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  148



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL+HL+P    +   S  SS++ S+CAAGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AIQRQRVLLEHLQPIRHHTHDHS--SSLTTSICAAGDSAAYQRTAAFGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  DDLLA VLKA+IEKTNL+P EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  62   ICKSKRGGFKDTLSDDLLAPVLKAVIEKTNLDPKEVGDIVVGTVLAPGSIRAMECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVAAS  151



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P++ + +   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPSSPSPNESPM---LSASICAAGDSAAYQRSSCFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPE VPVRTVNRQCSSGLQAVADVAA+
Sbjct  121  YAGFPENVPVRTVNRQCSSGLQAVADVAAS  150



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HLRP   +SS  + E+ +SAS CAAGDS+AY R + +GDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPP--SSSDHNYEAFLSASNCAAGDSSAYHRTTAFGDDVVIVAAHRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLA VLKALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKAKRGSFKDTYPDDLLAPVLKALIEKTNVNPAEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPE VPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPEIVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 3/153 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            A  RQRVLLQHL P ++ SS        +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4    AHNRQRVLLQHLLPNSSFSSAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNPSEVGDI+VGTV+APGS+RA+ECRM
Sbjct  64   RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPSEVGDIVVGTVMAPGSLRATECRM  123

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AAFYAGFPDTVPIRTVNRQCSSGLQAVADVAAS  156



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 130/150 (87%), Gaps = 8/150 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNPSEVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPSEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  116  YAGFPDTVPIRTVNRQCSSGLQAVADVAAA  145



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADV A+
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVVAS  151



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 1/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HLRP+ ++SSL + +SS+SAS C+AGDSAAYQR SVYGDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPS-SSSSLHNYDSSLSASACSAGDSAAYQRTSVYGDDVVIVAAHRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKALIEKT LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63   LCKSKRGGFKDTFADDLLAPVLKALIEKTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  123  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  152



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADV A+
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVVAS  151



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 130/150 (87%), Gaps = 8/150 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNP+EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPNEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  116  YAGFPDTVPIRTVNRQCSSGLQAVADVAAA  145



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 3/153 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPT---NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            A  RQRVLLQHL P    +AA       +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4    AHNRQRVLLQHLLPNCSFSAAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNP EVGDI+VGTV+APGS+RA+ECRM
Sbjct  64   RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPGEVGDIVVGTVMAPGSLRATECRM  123

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AAFYAGFPDTVPIRTVNRQCSSGLQAVADVAAS  156



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIE--SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            RQ+VLL HL+P +++S L   +  SS+S S+CAAG+ AAY+R +V GDD+VIVAAYRT +
Sbjct  7    RQKVLLGHLQPNSSSSFLSHTQKSSSLSTSICAAGNGAAYRRTAVSGDDVVIVAAYRTAI  66

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+K+GGFKDT PDDL+ SVLKALIEKTN+NPSEVGDI+VGTVLAPGS+RA ECRM AFY
Sbjct  67   CKAKKGGFKDTLPDDLIGSVLKALIEKTNVNPSEVGDIVVGTVLAPGSLRAIECRMGAFY  126

Query  421  AGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  127  AGFPETVPIRTVNRQCSSGLQAVADVAAS  155



>gb|ACJ84483.1| unknown [Medicago truncatula]
Length=259

 Score =   229 bits (583),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  152



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL P++ +        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AIGRQRVLLQHLHPSSGSDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVAD+AA+
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAAS  149



>ref|XP_006605730.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Glycine max]
Length=410

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HL+P  ++S      SS++ S+C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  29   AIERQRVLLEHLQPIRSSSHQ---FSSLTPSICLAGDSAAYQRTAAFGDDVVIVAAYRTA  85

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFK+T  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  86   ICKAKRGGFKNTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAAF  145

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  146  YAGFPETVPIRTVNRQCSSGLQAVADVAAS  175



>gb|KDO65878.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=320

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 130/150 (87%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+++ +S DS   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPSSSQTS-DS--PAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVA A
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATA  150



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  151



>gb|KDO65876.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
 gb|KDO65877.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=374

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 130/150 (87%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+++ +S DS   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPSSSQTS-DS--PAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVA A
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATA  150



>gb|AFW74040.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=378

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 131/150 (87%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P++++S+    +  +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSSSSSN----QPLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +C++KRGGFKDTYP+DLL +VLKA+++ T +NP E+GDI+VG+VL PGS RA ECR AAF
Sbjct  60   ICRAKRGGFKDTYPEDLLTTVLKAVLDNTRINPGEIGDIVVGSVLGPGSQRAVECRAAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  120  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  149



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P  ++SS     S VSASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AINRQRVLLQHLQPFPSSSS-----SLVSASVCAAGDSAAYQRNSSFGDDVVVVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            + KSKRGGFKDTYP++LL +VLKAL++KTNLNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  59   ISKSKRGGFKDTYPEELLTAVLKALLDKTNLNPNEVGDIVVGTVLAPGSQRATECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAAS  148



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ++LL HLRPT++   L S + S+S +VC AGDSAAY R   +GDDIVIVAAYRT 
Sbjct  4    AANRQKILLDHLRPTSSVPHLIS-QPSLSRAVCLAGDSAAYHRTPAFGDDIVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKS RGGFKDT PDDLLA+VLKALI++TNLNP+EVGDI+VGTVLAPGS+RA ECRMAA 
Sbjct  63   LCKSTRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIVVGTVLAPGSLRAIECRMAAL  122

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+ VP+RTVNRQCSSGLQAVADVAA
Sbjct  123  YAGFPDKVPIRTVNRQCSSGLQAVADVAA  151



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 4/137 (3%)
 Frame = +1

Query  97   PTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTY  276
            P++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+PLCK+KRGG KDTY
Sbjct  2    PSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSPLCKAKRGGLKDTY  57

Query  277  PDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTV  456
            PDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAFYAGFPETVPVRTV
Sbjct  58   PDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTV  117

Query  457  NRQCSSGLQAVADVAAA  507
            NRQCSSGLQAVADVAAA
Sbjct  118  NRQCSSGLQAVADVAAA  134



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 4/147 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+VLL HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVLLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  65   AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRASECRMAAFYAG  124

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            FPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            AIERQRVLL+HL+P  ++S     +SS ++ S+C AGDSAAY+R + + DD+VIVAAYRT
Sbjct  33   AIERQRVLLEHLQPIRSSSHHTHDQSSSLTPSICLAGDSAAYRRTAAFDDDVVIVAAYRT  92

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
             +CK+KRGGFKDT  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAA
Sbjct  93   AICKAKRGGFKDTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAA  152

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            FYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  153  FYAGFPETVPIRTVNRQCSSGLQAVADVAAS  183



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 129/150 (86%), Gaps = 7/150 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  117  YAGFPDTVPLRTVNRQCSSGLQAVADVAAS  146



>gb|KDO65875.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=397

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVA A
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATA  150



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 129/150 (86%), Gaps = 7/150 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  117  YAGFPDTVPLRTVNRQCSSGLQAVADVAAS  146



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL HL+P+    S       +S  VCAAGDSA YQR+S +GDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPSPPLRS-----PILSTEVCAAGDSAKYQRSSCFGDDVVIVAACRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTHPEDLLAPVLKALLDKTQLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  119  YAGFPDTVPLRTVNRQCSSGLQAVADVAAA  148



>gb|AFW74041.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=407

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 130/150 (87%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ VLLQHLRP    SS      ++SAS+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQSVLLQHLRP----SSDFGDRPALSASICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKS RGGF++T+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSSRGGFRNTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVAD+AAA
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAAA  149



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +1

Query  145  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  324
            ASVC AGDSAAYQR +V+GDD+VIVAAYRTPLCKSKRGGFKDT+ DDLLA VLKALIEKT
Sbjct  33   ASVCLAGDSAAYQRTNVFGDDVVIVAAYRTPLCKSKRGGFKDTHADDLLAPVLKALIEKT  92

Query  325  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            NLNPSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  93   NLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAA  152

Query  505  A  507
            A
Sbjct  153  A  153



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 4/147 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HLRP+  ASS ++  S++ ASVC AGDSAAY R++ +GDD+VIVAAYRT  CK
Sbjct  7    RQKILLDHLRPS--ASSQEN--SNLQASVCLAGDSAAYARSAPFGDDVVIVAAYRTAQCK  62

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            SKRGGFKDT+P+DLLA VLKALI+KT L+P EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  63   SKRGGFKDTFPEDLLAPVLKALIDKTKLDPREVGDIVVGTVLAPGSQRASECRMAAFYAG  122

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            +PETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  123  YPETVPVRTVNRQCSSGLQAVADVAAA  149



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  152



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPHLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 4/147 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+VLL HLRP    +      + + ASVC+AGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVLLDHLRP----ARFPKASTDLVASVCSAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDT PDDLLA VLKALI+KT +NP+EV DI+VGTVLAPGS RASECRMA+FYAG
Sbjct  65   AKRGGFKDTLPDDLLAPVLKALIDKTGINPNEVRDIVVGTVLAPGSQRASECRMASFYAG  124

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            FPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 138/150 (92%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHL+P +++S+   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPPSSSSNDAPM---LSASICAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDTYP+DLLA+VLKAL++KT LNP EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLAAVLKALLDKTKLNPREVGDIVVGTVLAPGSQRANECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAS  150



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 5/147 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  2    RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  56

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  57   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  116

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            FPETVPVRTVNRQCSSGLQAVADV AA
Sbjct  117  FPETVPVRTVNRQCSSGLQAVADVVAA  143



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 5/147 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  10   RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  65   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  124

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            FPETVPVRTVNRQCSSGLQAVADV AA
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVVAA  151



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVA A
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATA  150



>dbj|BAJ85217.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQR+LL+HL P   A+  +   S+VSASVCAAGDSAAY R   + DDIVIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP---AAGANPTASAVSASVCAAGDSAAYHRGPCFADDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDT P+DLL  V KAL+EKT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVEKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP++TVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAA  150



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 131/151 (87%), Gaps = 2/151 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASS--LDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            AI RQ+VLL+HL+PT+  S        SS+S S+C AGDSAAYQR + +GDD+VIVAAYR
Sbjct  4    AIFRQKVLLEHLQPTSCFSHQLTHEESSSISPSICLAGDSAAYQRTAAFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKSKRGGFKDT  DDLLA VLKALI+KTN+NPSEVGDI+VGTV+APGS RA+ECRMA
Sbjct  64   TAICKSKRGGFKDTLADDLLAPVLKALIDKTNINPSEVGDIVVGTVVAPGSQRATECRMA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  124  AFYAGFPETVPIRTVNRQCSSGLQAVADVAA  154



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQH  P++A+        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AISRQRVLLQHFHPSSASDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT+P+DLLA VLK L++KT LNPSEVGDI+VGTVLA GS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKELLDKTKLNPSEVGDIVVGTVLASGSQRAIECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETV ++TVNRQCSSGLQAVAD+AAA
Sbjct  120  YAGFPETVSLKTVNRQCSSGLQAVADIAAA  149



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQRVLLQHL PT   SS  +  +S+SAS+CAAG S AYQR + +GDDIVIVAA RT 
Sbjct  4    AAERQRVLLQHLSPT---SSQTNDTASLSASICAAGQSGAYQRTAAFGDDIVIVAACRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA+VLKA+IE+TNL+PSE+GDI+VGTVLAPGS+RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTPVDDLLAAVLKAVIERTNLDPSEIGDIVVGTVLAPGSVRAIECRMAAI  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAG P+TVPVRTVNRQCSSGLQAVAD+AA+
Sbjct  121  YAGIPDTVPVRTVNRQCSSGLQAVADIAAS  150



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 13/149 (9%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+KRG FKDTYPDDLLASVL+ALIEKTN+NP+EVGDI+VGTVL PGS RASECRMAAFY
Sbjct  52   CKAKRGSFKDTYPDDLLASVLRALIEKTNVNPTEVGDIVVGTVLGPGSQRASECRMAAFY  111

Query  421  AGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  112  AGFPQTVPIRTVNRQCSSGLQAVADVAAA  140



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTNVFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ DDLLA VLKA++EKTN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVEKTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAAS  148



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 123/147 (84%), Gaps = 4/147 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+V L HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVSLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RA ECRMAAFYAG
Sbjct  65   AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRAIECRMAAFYAG  124

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            FPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVAAA  151



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSV--SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            A+ RQ++LL HL+P++  SSL   + SV  S S+CAAGDS AY R + + DD+VIVAAYR
Sbjct  4    AVNRQKILLGHLQPSSPLSSLSQTQESVRLSTSICAAGDSTAYHRTAAFNDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKSKR GFKDT+PDDLL SVLKALIEKTN+NP+EVGDI+VGTVLAPGS+RA+ECRMA
Sbjct  64   TAICKSKRRGFKDTHPDDLLGSVLKALIEKTNVNPNEVGDIVVGTVLAPGSVRATECRMA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AF+AGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AFFAGFPETVPIRTVNRQCSSGLQAVADVAAS  155



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 131/150 (87%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P+ ++SS     +S+SAS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSQSSSS-----TSLSASACLAGDSAAYHRTASFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT+ DDLLA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTHADDLLAPVLKAVIEKTNLNPSEVGDIVVGSVLGGGSQRASECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  119  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  148



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 127/149 (85%), Gaps = 13/149 (9%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+KRG FKDTYP+DLLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RA+ECRMAAFY
Sbjct  52   CKAKRGSFKDTYPEDLLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRATECRMAAFY  111

Query  421  AGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  112  AGFPQTVPIRTVNRQCSSGLQAVADVAAA  140



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ ++S+       +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLAPSASSSAQGQ---QLSASACAAGDSAAYQRSSCFGDDVVIVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR A+ 
Sbjct  61   ICKAKRGGFKDTYPEDLLTPVLKAVLDNTGINPGEIGDIVVGTVLGPGSQRAIECRTASL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
             AGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  LAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 127/150 (85%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ A++      S +SAS CAAGDSAAYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPASAG-----SQLSASACAAGDSAAYQRTSCFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  59   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
             AG PETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  119  LAGIPETVPVRTVNRQCSSGLQAVADVAAA  148



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 134/150 (89%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R  V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTHVFGDDVVIVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ DDLLA VLKA++E+TN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVERTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAAS  148



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 4/149 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQ+VLLQHL PT    S      + S SVC++GD   Y RN+ +GDD+VIVAA RTP
Sbjct  4    ALNRQKVLLQHLNPT----STRPHNVTFSTSVCSSGDDGTYHRNAAFGDDVVIVAACRTP  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI+KTN+ PSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKAKRGGFKDTLADDLLAPVLKALIQKTNVKPSEVGDIVVGTVLAPGSARAMECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA
Sbjct  120  YAGFPDTVPIRTVNRQCSSGLQAVADVAA  148



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 6/150 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
             AG PETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  118  LAGIPETVPVRTVNRQCSSGLQAVADVAAA  147



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 132/150 (88%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ++LL HL P+++  S     SS+SAS CAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSNHS-----SSLSASACAAGDSAAYHRTSTFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKA+IE+TN+NPSEVGDIIVGTVLAPGS RASECRM+AF
Sbjct  59   LCKSKRGGFKDTHADDLLAPVLKAVIERTNVNPSEVGDIIVGTVLAPGSQRASECRMSAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  148



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 129/150 (86%), Gaps = 6/150 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
             AG PETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  118  LAGIPETVPVRTVNRQCSSGLQAVADVAAA  147



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 128/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL H      +SS  S +  ++AS CAAGDSAAYQR S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH---LLPSSSSPSSQPQLAASECAAGDSAAYQRTSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP ++GDI+VGTVL PGS RA+ECRMAAF
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGDIGDIVVGTVLGPGSQRANECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +1

Query  160  AGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPS  339
            AGDSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS
Sbjct  16   AGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPS  75

Query  340  EVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            EVGDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  76   EVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAA  131



>gb|KJB10129.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=371

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAAS  153



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 13/150 (9%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  111  YAGFPQTVPIRTVNRQCSSGLQAVADVAAA  140



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 13/150 (9%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  111  YAGFPQTVPIRTVNRQCSSGLQAVADVAAA  140



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HL+P++   S  S  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSS--QSHQSPAAILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKA+I++T LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLKAVIDRTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAA  150



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL HLRP   +SS     SS+S S C AGDSAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLRPPPPSSSQ---ASSLSVSACLAGDSAAYQRTSLYGDDVVIVAAQRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLA VL+A+IEKT LNPSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLAPVLRAVIEKTKLNPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  150



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  166  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  345
            DSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEV
Sbjct  1    DSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEV  60

Query  346  GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            GDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAA
Sbjct  61   GDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAA  114



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 6/150 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQR+LL HLRP+ +A        S+S +VC+A  SA   R+S +GDD+VIVAA RT 
Sbjct  4    AIERQRILLHHLRPSPSADP-----PSISTAVCSASGSAK-DRSSCFGDDVVIVAACRTA  57

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+++GGFKDTYPDDLLA VLKAL++KT LNPSEVGDIIVGTVLAPGS RA ECRM AF
Sbjct  58   LCKARKGGFKDTYPDDLLAPVLKALLDKTRLNPSEVGDIIVGTVLAPGSQRAIECRMGAF  117

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVAD+AAA
Sbjct  118  YAGFPDTVPLRTVNRQCSSGLQAVADIAAA  147



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAAS  153



>gb|AFW74043.1| hypothetical protein ZEAMMB73_080325, partial [Zea mays]
Length=145

 Score =   207 bits (527),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAAS---SQPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCS  471
            +AGFPETVPVRTVNRQCS
Sbjct  121  FAGFPETVPVRTVNRQCS  138



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 10/150 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  114  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  143



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 10/150 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  114  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  143



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   216 bits (551),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLL HL+P  ++SS     SS+S S C AGDS AYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHHLQPLPSSSSQ---ASSLSVSACLAGDSNAYQRTSLYGDDVVIVAAQRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  150



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 124/147 (84%), Gaps = 4/147 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ++LL HL+P     +     ++V  S+C+A DSA Y R + + DD+VIVAAYRTP+CK
Sbjct  7    RQQLLLDHLKPETGRRA----AANVVTSICSANDSAPYARTTDFLDDVVIVAAYRTPICK  62

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDTYPDDLLA VL+A++EKT +NP+E+GDI++GTVLAPG+ RA+ECRMAAFYAG
Sbjct  63   AKRGGFKDTYPDDLLAPVLRAVVEKTGVNPAEIGDIVIGTVLAPGAQRANECRMAAFYAG  122

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            FPETVP+RTVNRQCSSGLQAVADV AA
Sbjct  123  FPETVPIRTVNRQCSSGLQAVADVVAA  149



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 124/149 (83%), Gaps = 8/149 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA
Sbjct  116  YAGFPDTVPLRTVNRQCSSGLQAVADVAA  144



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 131/150 (87%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLLQHLRP++ +        +++ S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQRVLLQHLRPSSGSDD----RPALTTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKS RGGFK+T+P+DLLA +LKAL++KT +NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSNRGGFKNTHPEDLLAPLLKALLDKTKVNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVAD+AAA
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAAA  149



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 123/149 (83%), Gaps = 8/149 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+T P+RTVNRQCSSGLQAVADVAA
Sbjct  116  YAGFPDTAPLRTVNRQCSSGLQAVADVAA  144



>ref|XP_006307516.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40414.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=315

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 125/150 (83%), Gaps = 10/150 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP TVP+RTVNRQC+SGLQAVADVAAA
Sbjct  114  YAGFPLTVPIRTVNRQCASGLQAVADVAAA  143



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQRVLL+HL   N A++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AVDRQRVLLRHL---NPAAAGSPAPPAISASACAAGDSAAYHRRPAFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP++TVNRQCSSGLQAVADVA A
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVATA  150



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 128/150 (85%), Gaps = 7/150 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL HL+P +++S+     +S+S S C AG++   QR S Y DD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPLSSSSN----AASLSVSACFAGEN---QRTSQYEDDVVIVAAQRTA  56

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLA VL+ALIEKT+LNPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  57   LCKAKRGSFKDTYPDELLAPVLRALIEKTHLNPSEVGDIVVGTVLGPGSQRASECRMAAF  116

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  117  YAGFPETVPIRTVNRQCSSGLQAVADVAAA  146



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 125/150 (83%), Gaps = 9/150 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQRVLL HLR   ++SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHLR---SSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAAS  144



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSH-ESAAALFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  63   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  122

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  123  YAGFPDTVPIRTVNRQCSSGLQAVADVAAS  152



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 125/150 (83%), Gaps = 9/150 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAAS  144



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 9/152 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AIERQRVLL+HL+P ++ S+  S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSAFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDIIVGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIIVGTVLGPGSEKATECRM  117

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  118  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAA  149



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSI-ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            AI RQRVLL+HLRP++++ S   I ESS+SAS+C AG+ A    +S  GDDIV+VAA RT
Sbjct  4    AINRQRVLLEHLRPSSSSPSPSPINESSLSASICLAGNRATNPVDS--GDDIVVVAACRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
             +CK+KRGGFKDT PDD+LA VLKALIEKTN++PSEVGDI+VGTVLAPGS RA ECRMAA
Sbjct  62   AICKAKRGGFKDTLPDDILAPVLKALIEKTNVDPSEVGDIVVGTVLAPGSQRAIECRMAA  121

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            FYAGFP+TVP+RTVNRQCSSGLQAV DV AA
Sbjct  122  FYAGFPDTVPIRTVNRQCSSGLQAVVDVVAA  152



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 125/150 (83%), Gaps = 9/150 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAAS  144



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL+HL+P++++S+        + +SAS C AG+S+  QR     DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPSSSSSNFSHQTHQSTDLSASSCFAGNSSHGQRGGSE-DDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAA  154



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL H        S  S +S +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH-----LLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR AAF
Sbjct  59   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAG PE VPVRTVNRQCSSGLQAVADVAAA
Sbjct  119  YAGVPENVPVRTVNRQCSSGLQAVADVAAA  148



>gb|AEQ94132.1| putative 3-ketoacyl CoA thiolase [Elaeis guineensis]
Length=324

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  166  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  345
            DSAAYQR+S +GDD+V+VAAYRTP+CKSKRGGFKDT+P+DLLA+VLK L++KT LNP+EV
Sbjct  1    DSAAYQRSSSFGDDVVVVAAYRTPICKSKRGGFKDTHPEDLLATVLKGLLDKTKLNPNEV  60

Query  346  GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
             DI+VGTVLAPGS RA+ECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAA+
Sbjct  61   SDIVVGTVLAPGSQRATECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAS  114



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLL H           S ++S+S S C AG SAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHH---LQPPLPSSSSQASLSVSACLAGGSAAYQRTSLYGDDVVIVAAQRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  150



>gb|KCW50170.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAAS  155



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 125/150 (83%), Gaps = 2/150 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQRVLL+HL  + AA++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AIDRQRVLLRHL--SPAAAAESPAPPAISASACAAGDSAAYHRTPAFADDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  62   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP++TVNRQCSSGLQAVADVA A
Sbjct  122  YAGFPDTVPLKTVNRQCSSGLQAVADVATA  151



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AYYAGFPDSVPIRTVNRQCSSGLQAVADVAAS  155



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AYYAGFPDSVPIRTVNRQCSSGLQAVADVAAS  155



>gb|KCW50169.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAAS  155



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 9/152 (6%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAAS---SLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AIERQRVLL+HL+P ++ S   S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSVFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDI+VGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIVVGTVLGPGSEKATECRM  117

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  118  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAA  149



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQR+LL+HL   + A++      ++SAS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AIDRQRILLRHL---DPAAAPSPAPPAISASACAAGDSAAYHRRAAFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT+ +DLL  VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVLKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP++TVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAA  150



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 130/153 (85%), Gaps = 13/153 (8%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLK---ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            LCK+KRG FKDT+PD+LLASVL+   ALIEKTN+NPSEVGDI+VGTVL PGS RASECRM
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRVCLALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRM  113

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  114  AAFYAGFPETVPIRTVNRQCSSGLQAVADVAAA  146



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  148  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  327
            S+C AGDSAAYQR + +GDD+VIVAAYRT +CK+KRGGFK+T  DDLLA VLKA++EKTN
Sbjct  32   SICLAGDSAAYQRTAAFGDDVVIVAAYRTAICKAKRGGFKNTLADDLLAPVLKAVVEKTN  91

Query  328  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            L+P+EVGDI+VGTVLAPGS+RA ECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  92   LSPNEVGDIVVGTVLAPGSLRAMECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAS  151



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAA  150



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 125/150 (83%), Gaps = 10/150 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP TVP+RTVNRQC+SGLQAVADVAAA
Sbjct  114  YAGFPLTVPIRTVNRQCASGLQAVADVAAA  143



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAA  150



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAAS  155



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  231
            A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAAS  155



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ +Q+VLLQHLRP ++ SS +   + +SAS+CAAGDSAAY R + +   I++  AYRT 
Sbjct  4    AMNKQKVLLQHLRPNSSVSSSNYESAPLSASICAAGDSAAYHRTAAFAVKIMLNRAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLL  VLKA+IE+TNLNPS V D++VGTV+APGS+RA+E RM AF
Sbjct  64   ICKAKRGGFKDTLPDDLLPPVLKAVIERTNLNPSAVADVVVGTVMAPGSLRATESRMVAF  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YA FP+TVP+RTVNRQCSSGLQAV DVAA+
Sbjct  124  YASFPDTVPIRTVNRQCSSGLQAVFDVAAS  153



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 9/147 (6%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  246
            RQ+VLL HL+P     +         +S+C+A DSA Y R + + DD+VIVAAYRT +C+
Sbjct  7    RQQVLLDHLKPETGRRA---------SSICSANDSAPYARTTDFLDDVVIVAAYRTAICR  57

Query  247  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  426
            +KRGGFKDTYPDDLLA VL+A++EKT ++P+E+GDI++G+VLAPG+ RA+ECRMAAF+AG
Sbjct  58   AKRGGFKDTYPDDLLAPVLRAVVEKTGVSPAEIGDIVIGSVLAPGAQRANECRMAAFFAG  117

Query  427  FPETVPVRTVNRQCSSGLQAVADVAAA  507
            FPETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  118  FPETVPVRTVNRQCSSGLQAVADVAAA  144



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL+HL+P +++S+        + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAA  154



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 131/152 (86%), Gaps = 7/152 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  231
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  13   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  67

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  68   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  127

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAA
Sbjct  128  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAA  159



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL+HL+P +++S+        + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTPPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAA  154



>ref|XP_007049828.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
 gb|EOX93985.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
Length=374

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAGFPETVPVRTVNRQCSSGLQAVADVA  501
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVA  156



>ref|XP_007049827.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOX93984.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=376

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAGFPETVPVRTVNRQCSSGLQAVADVA  501
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVA  156



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 131/152 (86%), Gaps = 7/152 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  231
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  54   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  108

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  109  TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  168

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAA
Sbjct  169  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAA  200



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 108/121 (89%), Gaps = 4/121 (3%)
 Frame = +1

Query  145  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  324
            AS C A +SAAYQ    YGDD+VIVAA RTPLCK+KRG FKDTYPD+LLASVL+ LIEKT
Sbjct  1    ASPCLAKESAAYQ----YGDDVVIVAAQRTPLCKAKRGSFKDTYPDELLASVLRGLIEKT  56

Query  325  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            N+NPSEVGDI+VGTVL PGS RASECRMAAFYAGFPETVP+R VNRQCSSGLQAVADVAA
Sbjct  57   NVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAGFPETVPIRIVNRQCSSGLQAVADVAA  116

Query  505  A  507
            A
Sbjct  117  A  117



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 4/152 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  228
            AI+RQRVLL HL+P +++S+        + +SAS+C A +S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLDHLQPISSSSNFSSQTHQSTDLSASLCFAKNSSHGQIGG-SDDDVVIVAAY  62

Query  229  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  408
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN+NP+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVNPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  409  AAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAA  154



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 120/149 (81%), Gaps = 5/149 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HL P    ++      + +AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAATPAA-----PAFTASACAAGDSAAYHRGACFADDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+ TVNRQCSSGLQAV++VA+
Sbjct  119  YAGFPDTVPLMTVNRQCSSGLQAVSNVAS  147



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 129/152 (85%), Gaps = 7/152 (5%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  231
            A  RQ+VLLQHL+P++++ S     +S+S SVC AG+SA+  Y R + +GDDIVIVAA R
Sbjct  4    AFNRQKVLLQHLQPSSSSES-----ASLSTSVCVAGESASNSYHRTAAFGDDIVIVAANR  58

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  59   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  118

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAA
Sbjct  119  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAA  150



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 122/149 (82%), Gaps = 3/149 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HL P  + ++      +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAASPAAA---APAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+ TVNRQCSSGLQAVA+VA+
Sbjct  121  YAGFPDTVPLMTVNRQCSSGLQAVANVAS  149



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 122/149 (82%), Gaps = 3/149 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQRVLL HL P  + ++      +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAASPAAA---APAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAA  504
            YAGFP+TVP+ TVNRQCSSGLQAVA+VA+
Sbjct  121  YAGFPDTVPLMTVNRQCSSGLQAVANVAS  149



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P ++ SS  + E +V +SV  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPISSFSSSLNHEPTVLSSVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  61   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+
Sbjct  121  FAGFPDSVPIRTVNRQCSSGLQAVADVAAS  150



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAGFPETVPVRTVNRQCSSGLQAVADVA  501
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVA  156



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  222
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  223  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  402
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  403  RMAAFYAGFPETVPVRTVNRQCSSGLQAVADVA  501
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVA  156



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P  ++SS  ++     A + A   ++ +   + +GDDIVIVAAYRT 
Sbjct  4    ATERQKILLRHLNPIYSSSSSLTLIKDEPALLSAVNCASEFSPMAAFGDDIVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  FAGFPDTVPIRTVNRQCSSGLQAVADVAAS  153



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +1

Query  145  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  324
            AS CAAGDSAAYQR+S +GDD+VIVAAYRTP+CK+KRGGFKDTYP+DLL  VLKA+++KT
Sbjct  36   ASACAAGDSAAYQRSSCFGDDVVIVAAYRTPICKAKRGGFKDTYPEDLLTPVLKAVLDKT  95

Query  325  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAA  504
             +NP+++GD++VGTVL PGS RA ECR A+  AG PETVPVRTVNRQCSSGLQAVADVAA
Sbjct  96   GINPAQIGDVVVGTVLGPGSQRAIECRTASLLAGIPETVPVRTVNRQCSSGLQAVADVAA  155

Query  505  A  507
            A
Sbjct  156  A  156



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQ++LL+HL P ++ +S  + E S+ + V  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AVERQKILLRHLNPISSTNSSLNHEPSLFSLVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP+TVPVRTVNRQCSSGLQAVADVAA+
Sbjct  121  FAGFPDTVPVRTVNRQCSSGLQAVADVAAS  150



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQR+LL+HL P   AS   S  S+   +   AGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEPAAGASPAASAVSASVCA---AGDSAAYHRGPCFADDVVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRG FKDT P+DLL  V KAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP++TVNRQCSSGLQAVADVAAA
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAA  150



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 126/150 (84%), Gaps = 3/150 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ERQ++LL+HL P ++++S    E S+ + V    + +     + +GDDIVIVAAYRT 
Sbjct  4    AMERQKILLRHLNPVSSSNSSLKHEPSLLSPVNCVSEVSPM---AAFGDDIVIVAAYRTA  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP++VPVRTVNRQCSSGLQAVADVAA+
Sbjct  121  FAGFPDSVPVRTVNRQCSSGLQAVADVAAS  150



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  415  FYAGFP  432
            FYAGFP
Sbjct  122  FYAGFP  127



>ref|XP_008349049.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=129

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A+ RQRVLLQHLRP ++ SS +    ++SAS+CAAG+SAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNFESVALSASICAAGNSAAYHRTAAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVRAPGSLRATECRMAAF  123

Query  418  YAGFPE  435
            YA  P 
Sbjct  124  YASLPR  129



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P  ++SSL+   S +S   CA+  S      + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPIPSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYRTA  59

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  60   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  119

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  120  FAGFPDTVPIRTVNRQCSSGLQAVADVAAS  149



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 125/150 (83%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P  ++S      + +SA  CAA  S+     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLNPL-SSSPPPYKPTLLSAVNCAAELSSM----AAFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AAF
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+
Sbjct  119  FAGFPDSVPIRTVNRQCSSGLQAVADVAAS  148



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 115/150 (77%), Gaps = 26/150 (17%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+V                   
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVV-------------------  102

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
                 ETVPVRTVNRQCSSGLQAVADVAAA
Sbjct  103  -----ETVPVRTVNRQCSSGLQAVADVAAA  127



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 124/150 (83%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++LL+HL P ++ S      + +SA  CAA  S      + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLYPLSS-SPPPYKPTLLSAVNCAAELSPM----ASFGDDVVIVAAYRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  119  FAGFPDTVPIRTVNRQCSSGLQAVADVAAS  148



>ref|XP_007049829.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
 gb|EOX93986.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
Length=333

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  148  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  327
            S+CAAGD +AY   + + +D+VIVAA RT +CK+KRGGFKDT  DDLLA VLKALI++T 
Sbjct  9    SICAAGDGSAYHGTAAFANDVVIVAACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTK  68

Query  328  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVA  501
            LNPSEVGDI+VGTVLAPGS R  ECRMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA
Sbjct  69   LNPSEVGDIVVGTVLAPGSQRGIECRMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVA  126



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESS--VSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  231
            A ERQ++ L+HL P  ++SS      S  +S   CA+  S      + +GDDIVIVAAYR
Sbjct  4    AAERQKIFLRHLNPIPSSSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYR  59

Query  232  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  411
            T +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+A
Sbjct  60   TAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVA  119

Query  412  AFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            A++AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  120  AYFAGFPDTVPIRTVNRQCSSGLQAVADVAAS  151



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 5/150 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI+RQ VL +HL+    +SS D   +S+SASV AAGDS+AYQ+N  + DD+VIVAA RT 
Sbjct  4    AIDRQGVLRRHLQ----SSSYDH-PTSLSASVGAAGDSSAYQKNHGFDDDVVIVAACRTA  58

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            + K+ RGGFKDT+ +DLLA +LKAL+EKT LNP EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   IGKANRGGFKDTHAEDLLAPLLKALLEKTKLNPYEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPETVP+RTVNRQCSSGLQAVADVAAA
Sbjct  119  YAGFPETVPLRTVNRQCSSGLQAVADVAAA  148



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 126/151 (83%), Gaps = 4/151 (3%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTN-AASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            A ERQ++LL+HL P   ++SS  + ESSV   V  A + +     + +GDDIVIVAAYRT
Sbjct  4    AAERQKILLRHLNPIPCSSSSSLNHESSVLYPVNCASEVSPM---AAFGDDIVIVAAYRT  60

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA
Sbjct  61   AICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAA  120

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            ++AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  121  YFAGFPDTVPIRTVNRQCSSGLQAVADVAAS  151



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A ERQ++L++HL P +++ SL SI  +    + A   +A     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILIRHLNPLSSSPSLPSINDNKPTLLSAVNCAAELSPMAAFGDDVVIVAAYRTA  63

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+
Sbjct  124  FAGFPDSVPIRTVNRQCSSGLQAVADVAAS  153



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 120/150 (80%), Gaps = 11/150 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A++RQR+LL+HL P   A+  +   S++SAS CAAG          + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP---AAGPNPAASAISASACAAG--------GCFADDVVIVAAYRTA  52

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            +CKSKRGGFKDT P+DLL  V KAL++KT LNPSE+GDI+VGTVLAPGS RA ECRMAA 
Sbjct  53   ICKSKRGGFKDTLPEDLLVPVFKALVDKTKLNPSEIGDIVVGTVLAPGSQRAIECRMAAL  112

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAA
Sbjct  113  YAGFPDTVPLRTVNRQCSSGLQAVADVAAA  142



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +1

Query  67   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSA---AYQRNSVYGDDIVIVAAYRTP  237
            RQ+VL+ HL   + A  L +    VS SVC  GDS    A    S   DD+VIVAAYRTP
Sbjct  2    RQQVLMGHLTGFSTAP-LVAHNLLVSPSVCMGGDSGIDHARAAESCNDDDVVIVAAYRTP  60

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
             C++KRGGFKDT P+DLL  VLKA++E+T + P EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   QCRAKRGGFKDTRPEDLLDPVLKAVVERTGIRPDEVGDIVVGTVLAPGSRRAMECRMAAF  120

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            YAGFPE+VP+RTVNRQCSSGLQAVADVA+A
Sbjct  121  YAGFPESVPIRTVNRQCSSGLQAVADVASA  150



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLA
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAAS  107



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLA
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAAS  107



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLA
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAAS  107



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAYRTAICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAAS  107



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDD+VIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDVVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAAS  107



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAAS  107



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAAS  107



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  375
            +GDDIVIVAA+RT +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDIVIVAAHRTAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIA  63

Query  376  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            PGS RA ECR+AA+YAGFP++VP+RTVNRQCSSGLQAVADVAA+
Sbjct  64   PGSQRAMECRVAAYYAGFPDSVPIRTVNRQCSSGLQAVADVAAS  107



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 114/148 (77%), Gaps = 3/148 (2%)
 Frame = +1

Query  67   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  243
            RQ+VLL HLRP  N  ++ + ++  + AS CAAGDSAAY+R +   DD+VIV+A RTP+ 
Sbjct  13   RQQVLLNHLRPAGNTEAAFERMQ--LQASACAAGDSAAYERRASGPDDVVIVSALRTPIT  70

Query  244  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  423
            K+KRGGFKDT PDDL+A+V +A +++T +NP+++GDI++G+VL   S RA + R+A F A
Sbjct  71   KAKRGGFKDTLPDDLMAAVFQATLDRTGINPADIGDIVIGSVLGDSSQRAIQVRIAGFLA  130

Query  424  GFPETVPVRTVNRQCSSGLQAVADVAAA  507
            G PE V V TVNRQCSSGLQA+A VAAA
Sbjct  131  GIPENVAVHTVNRQCSSGLQAIASVAAA  158



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 8/148 (5%)
 Frame = +1

Query  67   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  243
            R  VL +H+ P  N    L       S   C+AGDSAAY+R++   DD+VIVAA RTPL 
Sbjct  10   RLSVLAKHICPVPNGVQGL-------SLQGCSAGDSAAYERHNTADDDVVIVAALRTPLT  62

Query  244  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  423
            K++RGG KDT   DLLA+V KA++++T + P  +GDI++G+VL P S RA+ECR+A+F+A
Sbjct  63   KARRGGLKDTDAVDLLATVFKAVLDRTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFA  122

Query  424  GFPETVPVRTVNRQCSSGLQAVADVAAA  507
            G PETVPVRTVNRQCSSGLQA+ADVAAA
Sbjct  123  GIPETVPVRTVNRQCSSGLQAIADVAAA  150



>dbj|BAA25250.1| mutated 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=114

 Score =   161 bits (408),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 91/102 (89%), Gaps = 2/102 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVG  363
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGD+  G
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDMGCG  103



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P+EVGDI+VGTV+APG
Sbjct  16   DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPAEVGDIVVGTVIAPG  75

Query  382  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            S RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAA
Sbjct  76   SHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAA  117



>ref|XP_001697225.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
 gb|EDP00480.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
Length=461

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  136  SVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALI  315
            S+S   C+AGDSAAY+R +   DD+VIVA+ RTPL K+KRGG +DT   DLL+++ KA++
Sbjct  25   SLSLQTCSAGDSAAYERRNTADDDVVIVASLRTPLTKAKRGGLRDTDAADLLSTLFKAVL  84

Query  316  EKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVAD  495
            E+T + P  +GDI++G+VL P S RA+ECR+A+F+AG P+ VPVRTVNRQCSSGLQA+AD
Sbjct  85   ERTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFAGIPDVVPVRTVNRQCSSGLQAIAD  144

Query  496  VAAA  507
            VAAA
Sbjct  145  VAAA  148



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P++VGDI+VGTV+APG
Sbjct  6    DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPADVGDIVVGTVIAPG  65

Query  382  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            S RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAA
Sbjct  66   SHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAA  107



>gb|KIY92728.1| acetyl-CoA acyltransferase 1 [Monoraphidium neglectum]
Length=323

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  133  SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  312
            + +S   C+AGDS+AYQR     DD+VIV+A RTPL K++RGG +DT   DLLA+V +A 
Sbjct  23   AGLSLQSCSAGDSSAYQRQGAALDDVVIVSALRTPLTKARRGGLRDTDAVDLLATVYRAT  82

Query  313  IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVA  492
            +++T + P+ +GD++VG+VL P S RA+E R+A F AG PETVPVRTVNRQCSSGLQAVA
Sbjct  83   LDRTRVEPAALGDVVVGSVLGPSSQRANEARIAMFIAGIPETVPVRTVNRQCSSGLQAVA  142

Query  493  DVAAA  507
            DVAAA
Sbjct  143  DVAAA  147



>ref|XP_005845320.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
 gb|EFN53218.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
Length=354

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 3/151 (2%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A  RQ+VLL HL    ++++      S   +  +AGDSAAY+R ++  DD+VIV+A RT 
Sbjct  4    AAHRQQVLLGHLEAAVSSAAPAPPPMSAHPT--SAGDSAAYERRNLACDDVVIVSACRTA  61

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LCK+KRGGFKDT  DDL+A+VLK  I ++ + P  VGD+  G+V+ P S RA+ECR+A F
Sbjct  62   LCKAKRGGFKDTPVDDLIATVLKETIRRSGVEPEAVGDVCFGSVMGPSSQRANECRIAMF  121

Query  418  YAGFPETVPVRTVNRQCSS-GLQAVADVAAA  507
             AGFP +VPV TVNRQCSS GLQA+A VAA+
Sbjct  122  LAGFPTSVPVHTVNRQCSSAGLQAIAQVAAS  152



>gb|ACJ84675.1| unknown [Medicago truncatula]
Length=234

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            LCK KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  G
Sbjct  63   LCKVKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAG  110



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 98/150 (65%), Gaps = 10/150 (7%)
 Frame = +1

Query  58   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  237
            A +RQ+VLL HL   +    +    +S  +    AGD           DD+VIV+  RT 
Sbjct  4    AAQRQKVLLSHLASAHGTPEVAPQPTSAESHDRRAGDL----------DDVVIVSTCRTA  53

Query  238  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  417
            LC+++RGGFKDT  DDL+A+VLK  + +T + P  VGDI+ G+V+ P S RA+E RMA  
Sbjct  54   LCRARRGGFKDTPVDDLIAAVLKDTLRRTGIEPEAVGDIVFGSVMGPSSQRANELRMAML  113

Query  418  YAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +AGFP TVPV T+NRQCSSGLQA+A VAA+
Sbjct  114  FAGFPHTVPVHTLNRQCSSGLQAMASVAAS  143



>emb|CEF98532.1| Thiolase-like, subgroup [Ostreococcus tauri]
Length=424

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  41   DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  100

Query  382  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            S RA+ECR+A F AGFP+ VPVRT NRQCSSG+QA AD+AA 
Sbjct  101  SQRANECRIAMFLAGFPKEVPVRTTNRQCSSGIQACADIAAG  142



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+ IV+A RTPL KS RGG KDT   DL+A+VL   + +T ++P +VGD+++G+V+   
Sbjct  16   DDVCIVSACRTPLTKSNRGGLKDTPAHDLVAAVLAETVRRTGVDPKDVGDVVLGSVMGHS  75

Query  382  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            S RA+ECR+  F AGFP+TVPV TVNRQCSSGLQA+A VAAA
Sbjct  76   SQRANECRIGMFLAGFPDTVPVHTVNRQCSSGLQAIASVAAA  117



>ref|XP_007513169.1| unknown [Bathycoccus prasinos]
 emb|CCO16727.1| unknown [Bathycoccus prasinos]
Length=448

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +1

Query  196  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT-NLNPSEVGDIIVGTVL  372
            + DD+VIV A RTP+ ++++GG KDT  DDL+A+VL A + +T N+N +++GD++VG+VL
Sbjct  56   HPDDVVIVCALRTPITRARKGGLKDTTADDLVATVLAAALRETENINANDIGDVVVGSVL  115

Query  373  APGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
               S RA+ECR+  F AGFP  VPVRTVNRQCSSGLQA ADVA+A
Sbjct  116  GDSSQRANECRIGMFLAGFPVKVPVRTVNRQCSSGLQACADVASA  160



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +1

Query  301  LKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGL  480
            L+A+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVPVRTVNRQCSSGL
Sbjct  9    LQAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGL  68

Query  481  QAVADVAAA  507
            QAVADVAAA
Sbjct  69   QAVADVAAA  77



>ref|XP_002591918.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
 gb|EEN47929.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
Length=430

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 92/147 (63%), Gaps = 10/147 (7%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            +ER + +  H+   N A +          S  +   +    R +   DD+VI++A RTP+
Sbjct  1    MERMQTIFGHISVPNRAQN---------QSFSSLAQNEVKGRFAESEDDVVIISALRTPI  51

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
             K+ RG FKDT PDDLL SVLKA +E+TN+NPSE+GDI VG VL PG+  A   R+A F 
Sbjct  52   GKAARGSFKDTTPDDLLVSVLKATLERTNVNPSEIGDICVGNVLQPGAGPAV-FRIAQFA  110

Query  421  AGFPETVPVRTVNRQCSSGLQAVADVA  501
            AG PETVP+   NRQCSSGLQAV  VA
Sbjct  111  AGIPETVPLSACNRQCSSGLQAVMHVA  137



>ref|XP_960422.1| 3-ketoacyl-CoA thiolase [Neurospora crassa OR74A]
 ref|XP_009854111.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2508]
 gb|EAA31186.1| 3-ketoacyl-CoA thiolase [Neurospora crassa OR74A]
 gb|EGO54113.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2508]
 gb|EGZ68464.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2509]
 gb|KHE88997.1| hypothetical protein GE21DRAFT_8776 [Neurospora crassa]
Length=419

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 86/135 (64%), Gaps = 4/135 (3%)
 Frame = +1

Query  103  NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPD  282
             A   L  I + +SA V   G     Q+N+   DDIV+  A RTP  K  +GGFKDT+  
Sbjct  2    GALDRLSQIGNQISAGVTGGGRDQILQKNA---DDIVVTCALRTPFTKGGKGGFKDTHAA  58

Query  283  DLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNR  462
            DL+A  L+ LIE++ ++PS V DI VGTVLAPG   A+E R AA  AGFPE+  V T+NR
Sbjct  59   DLMAGALRGLIERSKIDPSLVEDIKVGTVLAPGG-GATEMRAAALVAGFPESTAVHTLNR  117

Query  463  QCSSGLQAVADVAAA  507
            QCSSGLQA  D+A A
Sbjct  118  QCSSGLQACVDIANA  132



>gb|KDO65879.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=335

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = +1

Query  286  LLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQ  465
            LL SV +A+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAFYAGFPETVP+RTVNRQ
Sbjct  16   LLFSV-QAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQ  74

Query  466  CSSGLQAVADVAAA  507
            CSSGLQAVADVA A
Sbjct  75   CSSGLQAVADVATA  88



>ref|XP_003080093.1| Dynein 1-alpha heavy chain, flagellar inner arm (IC) [Ostreococcus 
tauri]
Length=5068

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  202   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
             DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  4685  DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  4744

Query  382   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
             S RA+ECR+A F AGFP+ VPVRT NRQCSSG+QA AD+AA 
Sbjct  4745  SQRANECRIAMFLAGFPKEVPVRTTNRQCSSGIQACADIAAG  4786



>ref|XP_005082434.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Mesocricetus 
auratus]
Length=286

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 98/151 (65%), Gaps = 17/151 (11%)
 Frame = +1

Query  61   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            + R +V+L HL  RP ++        S++ A+ C+AG   A+        D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFRQAW------ASDVVVVHGRRT  46

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+ ++ RGGFKDT PD+LL++VL A+++   L P E+GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPEELGDISVGNVLQPGA-GAIMARIAQ  105

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            F +G PETVP+ T+NRQCSSGLQAVA++A  
Sbjct  106  FLSGIPETVPLSTINRQCSSGLQAVANIAGG  136



>ref|XP_003353115.1| hypothetical protein SMAC_03432 [Sordaria macrospora k-hell]
 emb|CCC09876.1| unnamed protein product [Sordaria macrospora k-hell]
Length=419

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 85/133 (64%), Gaps = 4/133 (3%)
 Frame = +1

Query  103  NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPD  282
             A   L  I + +SA V   G     Q+N+   DDIV+  A RTP  K  +GGFKDT+  
Sbjct  2    GALDRLSQIGNQISAGVTGGGRDKILQKNA---DDIVVTCALRTPFTKGGKGGFKDTHAA  58

Query  283  DLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNR  462
            DL+A  L+ LIE++ ++P+ V DI VGTVLAPG   A+E R AA  AGFPE+  V T+NR
Sbjct  59   DLMAGALRGLIERSKIDPALVEDIKVGTVLAPGG-GATEMRAAALVAGFPESTAVHTLNR  117

Query  463  QCSSGLQAVADVA  501
            QCSSGLQA  D+A
Sbjct  118  QCSSGLQACVDIA  130



>ref|NP_001072686.1| 3-ketoacyl-CoA thiolase, peroxisomal [Xenopus (Silurana) tropicalis]
 gb|AAI24020.1| acetyl-Coenzyme A acyltransferase 1 [Xenopus (Silurana) tropicalis]
Length=419

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 93/149 (62%), Gaps = 18/149 (12%)
 Frame = +1

Query  61   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            + R RV+L HL P N            S  + A   SAA  ++     DIVIVA  RTP+
Sbjct  1    MHRVRVVLGHL-PAN------------SRGIWAENSSAAADKS----QDIVIVAGRRTPI  43

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
            CK+KRGGFK+T PD+LL++V+ A++   NLNP  +GDI VG VL PG+  A   R+  F 
Sbjct  44   CKAKRGGFKETTPDELLSAVMTAVLNDVNLNPELLGDICVGNVLQPGA-GALVARIGQFL  102

Query  421  AGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +G PE+VP+  VNRQCSSGLQA+ ++A  
Sbjct  103  SGIPESVPLHVVNRQCSSGLQAIINIAGG  131



>ref|XP_004349337.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE91455.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
Length=423

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIV+A RTP+ K+KRGGF+DT PDDLLA+ ++A +++ N++P  +GDI+VG VL PG
Sbjct  35   DDVVIVSAVRTPITKAKRGGFRDTPPDDLLAAAMQAAVQRANVDPKLIGDIVVGNVLQPG  94

Query  382  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +  A   R A F+AG PET P+  VNRQCSSGLQA A++A++
Sbjct  95   A-GALTSRFAQFFAGIPETTPIVAVNRQCSSGLQACANIASS  135



>ref|XP_643924.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
 gb|EAL70062.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
Length=416

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  199  GDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAP  378
            GDDIVIVA +RT +CK+KRG FK+T PDDLLA V+K +I+ T L+P  +GD+++G VL  
Sbjct  32   GDDIVIVAPFRTAICKAKRGAFKETAPDDLLAPVIKHIIKVTKLDPKLIGDVVMGAVLPR  91

Query  379  GSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
             S  A+E R+A   AG P+ VP  TVNRQCSSGLQA+A+ AAA
Sbjct  92   SSQGATEVRVATLLAGLPKEVPCYTVNRQCSSGLQAIANCAAA  134



>gb|EIE80258.1| hypothetical protein RO3G_04963 [Rhizopus delemar RA 99-880]
Length=415

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            +D+VIVAA RT + ++++GGFKDT P+++LA V K LIE+T ++P+ V DI VG VL PG
Sbjct  28   EDVVIVAALRTAITRARKGGFKDTLPEEMLAGVFKGLIEQTKIDPAIVNDIAVGNVLPPG  87

Query  382  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
               A+  RMAA YAGFPET  V TVNRQCSSGLQAV  +A A
Sbjct  88   G-GATNARMAALYAGFPETSSVNTVNRQCSSGLQAVVQIATA  128



>ref|XP_005348136.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X1 [Microtus ochrogaster]
Length=331

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = +1

Query  61   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFLQAS------ASDVVVVHGRRT  46

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+ +S RGGFKDT PD+LL++VL A+++  NL P ++GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRSGRGGFKDTTPDELLSAVLTAVLQDVNLRPEQLGDISVGNVLLPGA-GAVTARIAQ  105

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            F +G PETVP  TVNRQCSSGLQAVA++A  
Sbjct  106  FLSGIPETVPSSTVNRQCSSGLQAVANIAGG  136



>ref|XP_005348141.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X2 [Microtus ochrogaster]
Length=331

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = +1

Query  61   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFPQAS------ASDVVVVHGRRT  46

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+ +S RGGFKDT PD+LL++VL A+++  NL P ++GDI VG VL PG+  A   R+  
Sbjct  47   PIGRSGRGGFKDTTPDELLSAVLTAVLQDLNLRPEQLGDISVGNVLQPGA-GAVMARIGQ  105

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            F +G PETVP+ TVNRQCSSGLQAVA++A  
Sbjct  106  FLSGIPETVPLSTVNRQCSSGLQAVANIAGG  136



>ref|XP_001418570.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96863.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=417

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  202  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  381
            DD+VIV+A RTP+ ++KRGG   T  DDL+A+VL+A + +  ++ ++VGDI+VG+VL   
Sbjct  27   DDVVIVSACRTPITRAKRGGLAATPADDLIAAVLQASVARGKIDVNDVGDIVVGSVLGAS  86

Query  382  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            S RA+ECR+  F AGFP+ VPVRT NRQCSSGLQA AD+AA 
Sbjct  87   SQRANECRIGMFLAGFPKEVPVRTTNRQCSSGLQACADIAAG  128



>ref|XP_008844714.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
 ref|XP_008844715.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
Length=424

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 97/149 (65%), Gaps = 17/149 (11%)
 Frame = +1

Query  67   RQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  240
            R +V+L HL  RP ++        S++ A+ C+AG   A        DD+V+V   RTP+
Sbjct  3    RLQVVLGHLAGRPGSS--------SALQAAPCSAGFPQAS------ADDVVVVHGRRTPI  48

Query  241  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  420
             + +RGGFKDT PD+LL++VL A+++   L P ++GDI VG VL PG+  A   R+A F 
Sbjct  49   GRGRRGGFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGA-GALMARIAQFL  107

Query  421  AGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            +G PETVP+ TVNRQCSSGLQAVA++A  
Sbjct  108  SGIPETVPLSTVNRQCSSGLQAVANIAGG  136



>ref|XP_009262137.1| hypothetical protein FPSE_10745 [Fusarium pseudograminearum CS3096]
 gb|EKJ69076.1| hypothetical protein FPSE_10745 [Fusarium pseudograminearum CS3096]
Length=418

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = +1

Query  127  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  306
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT+  DL+A VLK
Sbjct  10   IGGQISGNPTAGGREKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTHAADLMAGVLK  66

Query  307  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQA  486
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  67   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  125

Query  487  VADVA  501
              DVA
Sbjct  126  TVDVA  130



>ref|XP_011328216.1| 3-ketoacyl-CoA thiolase [Fusarium graminearum PH-1]
 gb|ESU16100.1| 3-ketoacyl-CoA thiolase [Fusarium graminearum PH-1]
 gb|EYB31146.1| hypothetical protein FG05_09503 [Fusarium graminearum]
Length=418

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = +1

Query  127  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  306
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT+  DL+A VLK
Sbjct  10   IGGQISGNPTAGGREKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTHAADLMAGVLK  66

Query  307  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQA  486
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  67   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  125

Query  487  VADVA  501
              DVA
Sbjct  126  TVDVA  130



>ref|XP_005348140.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X1 [Microtus ochrogaster]
Length=424

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = +1

Query  61   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFPQAS------ASDVVVVHGRRT  46

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+ +S RGGFKDT PD+LL++VL A+++  NL P ++GDI VG VL PG+  A   R+  
Sbjct  47   PIGRSGRGGFKDTTPDELLSAVLTAVLQDLNLRPEQLGDISVGNVLQPGA-GAVMARIGQ  105

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            F +G PETVP+ TVNRQCSSGLQAVA++A  
Sbjct  106  FLSGIPETVPLSTVNRQCSSGLQAVANIAGG  136



>ref|XP_003664280.1| 3-ketoacyl-CoA thiolase [Myceliophthora thermophila ATCC 42464]
 gb|AEO59035.1| 3-ketoacyl-CoA thiolase [Myceliophthora thermophila ATCC 42464]
Length=419

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 85/133 (64%), Gaps = 4/133 (3%)
 Frame = +1

Query  103  NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPD  282
             A   L  + S +S +  A G +   ++N    DDIV+ AA RT +CK  +G FKDT+  
Sbjct  2    GALDRLSQLGSQISGTASAGGKAKLLEKNP---DDIVVTAALRTAICKGGKGFFKDTFAA  58

Query  283  DLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNR  462
            DL+A  LK +IE++ +NP+ V DI VGTVLAPG   A+E R AA  AGFP    VRT+NR
Sbjct  59   DLMAGALKGIIERSKINPALVQDIAVGTVLAPGG-GATEMRAAALVAGFPVETAVRTLNR  117

Query  463  QCSSGLQAVADVA  501
            QCSSGLQA  D+A
Sbjct  118  QCSSGLQACVDIA  130



>ref|XP_005348137.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X2 [Microtus ochrogaster]
Length=424

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = +1

Query  61   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  234
            + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFLQAS------ASDVVVVHGRRT  46

Query  235  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  414
            P+ +S RGGFKDT PD+LL++VL A+++  NL P ++GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRSGRGGFKDTTPDELLSAVLTAVLQDVNLRPEQLGDISVGNVLLPGA-GAVTARIAQ  105

Query  415  FYAGFPETVPVRTVNRQCSSGLQAVADVAAA  507
            F +G PETVP  TVNRQCSSGLQAVA++A  
Sbjct  106  FLSGIPETVPSSTVNRQCSSGLQAVANIAGG  136



>emb|CCF32753.1| acetyl-CoA acetyltransferase [Colletotrichum higginsianum]
Length=415

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 81/122 (66%), Gaps = 4/122 (3%)
 Frame = +1

Query  133  SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  312
            + +     A G     Q+N+   DD+V+ AA RTP  K  +GGFKDT   DL+A  LKAL
Sbjct  8    TQLGGQFTAGGKDKILQKNA---DDVVVTAALRTPFTKGGKGGFKDTQAADLMAGALKAL  64

Query  313  IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVA  492
            +E++ ++P+ V DI VGTVLAPG   A+E R AA  AGFP+T  VRT+NRQCSSGLQA  
Sbjct  65   LERSKIDPALVEDIAVGTVLAPGG-GATEMRAAALVAGFPQTTAVRTLNRQCSSGLQASV  123

Query  493  DV  498
            D+
Sbjct  124  DI  125



>emb|CEF85217.1| unnamed protein product [Fusarium graminearum]
Length=439

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = +1

Query  127  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  306
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT+  DL+A VLK
Sbjct  31   IGGQISGNPTAGGREKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTHAADLMAGVLK  87

Query  307  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQA  486
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  88   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  146

Query  487  VADVA  501
              DVA
Sbjct  147  TVDVA  151



Lambda      K        H        a         alpha
   0.316    0.129    0.362    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510