BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014L01

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACF17656.1|  putative glutamine synthase 2                           224   5e-68   Capsicum annuum
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           219   3e-66   Solanum tuberosum [potatoes]
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     218   7e-66   Nicotiana sylvestris
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     218   7e-66   Nicotiana tomentosiformis
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     214   3e-64   
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                214   4e-64   Erythranthe guttata [common monkey flower]
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  213   8e-64   Morus notabilis
ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    213   8e-64   Sesamum indicum [beniseed]
ref|XP_002314425.1|  glutamine synthetase family protein                213   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    213   1e-63   Populus euphratica
dbj|BAF62340.1|  glutamine synthetase                                   211   8e-63   Avicennia marina
ref|XP_006380048.1|  hypothetical protein POPTR_0008s20460g             206   2e-62   
ref|XP_007034566.1|  Glutamine synthetase 2                             212   3e-62   
gb|KJB28233.1|  hypothetical protein B456_005G035800                    208   8e-62   Gossypium raimondii
ref|XP_002312733.1|  glutamine synthetase family protein                207   1e-61   
emb|CAA47373.2|  glutamate--ammonia ligase                              205   8e-61   Nicotiana sylvestris
ref|XP_002516801.1|  glutamine synthetase plant, putative               205   9e-61   Ricinus communis
ref|XP_008351243.1|  PREDICTED: glutamine synthetase, chloroplast...    197   1e-60   
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    205   1e-60   Prunus mume [ume]
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        205   1e-60   Gossypium arboreum [tree cotton]
pir||S22527  glutamate-ammonia ligase (EC 6.3.1.2) - tobacco            204   3e-60
gb|KDO74876.1|  hypothetical protein CISIN_1g013478mg                   202   5e-60   Citrus sinensis [apfelsine]
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    203   6e-60   Daucus carota [carrots]
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    203   7e-60   Populus euphratica
emb|CDO98975.1|  unnamed protein product                                203   8e-60   Coffea canephora [robusta coffee]
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             202   1e-59   Citrus clementina [clementine]
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             202   1e-59   Prunus persica
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   202   1e-59   Citrus sinensis [apfelsine]
ref|XP_004174085.1|  PREDICTED: glutamine synthetase, chloroplast...    195   2e-59   
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    202   2e-59   Sesamum indicum [beniseed]
gb|KJB37729.1|  hypothetical protein B456_006G218100                    201   2e-59   Gossypium raimondii
ref|XP_011462784.1|  PREDICTED: glutamine synthetase leaf isozyme...    200   7e-59   Fragaria vesca subsp. vesca
gb|ACU24520.1|  unknown                                                 199   2e-58   Glycine max [soybeans]
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    199   2e-58   Glycine max [soybeans]
ref|NP_001237784.1|  glutamine synthetase precursor                     199   2e-58   
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        199   2e-58   Glycine soja [wild soybean]
gb|KDP40083.1|  hypothetical protein JCGZ_02081                         197   1e-57   Jatropha curcas
gb|ACU18743.1|  unknown                                                 197   1e-57   Glycine max [soybeans]
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    197   1e-57   Glycine max [soybeans]
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    197   1e-57   Pyrus x bretschneideri [bai li]
gb|AAN84538.1|  putative plastidic glutamine synthetase                 197   1e-57   Spiraea nipponica
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    197   1e-57   Pyrus x bretschneideri [bai li]
gb|ADK27329.1|  plastid glutamine synthetase                            196   3e-57   Vigna radiata [mung bean]
ref|XP_008361978.1|  PREDICTED: glutamine synthetase leaf isozyme...    195   4e-57   
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                196   4e-57   Juglans nigra
gb|KCW84320.1|  hypothetical protein EUGRSUZ_B01163                     193   4e-57   Eucalyptus grandis [rose gum]
gb|AAF17703.1|AF031082_1  glutamine synthetase                          196   4e-57   Canavalia lineata
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    196   4e-57   Malus domestica [apple tree]
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    195   9e-57   
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    195   1e-56   Cucumis sativus [cucumbers]
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    194   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    194   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    194   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    194   2e-56   Eucalyptus grandis [rose gum]
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    194   2e-56   Cucumis melo [Oriental melon]
gb|AAN84537.1|  putative plastidic glutamine synthetase                 194   2e-56   Crataegus crus-galli
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    194   2e-56   Cucumis melo [Oriental melon]
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    194   3e-56   Pisum sativum [garden pea]
gb|AGV54414.1|  glutamine synthetase                                    193   3e-56   Phaseolus vulgaris [French bean]
prf||1601519A  Gln synthetase                                           192   6e-56
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             192   6e-56   Phaseolus vulgaris [French bean]
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    192   1e-55   Cicer arietinum [garbanzo]
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   191   3e-55   Citrus sinensis [apfelsine]
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   190   6e-55   Citrus sinensis [apfelsine]
gb|AJD14836.1|  plastid glutamine synthetase                            190   8e-55   Boehmeria nivea [Chinese silk-plant]
gb|AJI44225.1|  plastid glutamine synthetase                            190   8e-55   Boehmeria nivea [Chinese silk-plant]
ref|XP_006593065.1|  PREDICTED: glutamine synthetase leaf isozyme...    181   3e-54   Glycine max [soybeans]
gb|KCW44355.1|  hypothetical protein EUGRSUZ_L021751                    180   4e-54   Eucalyptus grandis [rose gum]
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         188   4e-54   Lotus japonicus
gb|AAN84563.1|  glutamine synthetase                                    188   4e-54   Lotus japonicus
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    188   4e-54   Vitis vinifera
gb|AAL67439.1|  glutamine synthetase precursor                          188   4e-54   Lotus japonicus
gb|ACJ84875.1|  unknown                                                 184   1e-53   Medicago truncatula
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    186   2e-53   Medicago sativa [alfalfa]
gb|KEH36742.1|  glutamine synthetase domain protein                     184   3e-53   Medicago truncatula
gb|AAO37651.1|  glutamine synthetase                                    185   5e-53   Medicago truncatula
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         184   8e-53   Lotus japonicus
gb|AFH88076.1|  chloroplast glutamine synthetase protein                183   2e-52   Sesuvium portulacastrum [sea-purslane]
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        183   3e-52   Medicago truncatula
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    180   5e-51   Vitis vinifera
ref|XP_003594092.1|  Glutamine synthetase                               186   1e-50   
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    176   2e-49   Tarenaya hassleriana [spider flower]
gb|ABL89188.2|  plastid glutamine synthetase 2                          175   3e-49   Spinacia oleracea
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    174   7e-49   Mesembryanthemum crystallinum
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    174   9e-49   Tarenaya hassleriana [spider flower]
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    171   1e-47   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN61808.1|  hypothetical protein VITISV_014295                     170   2e-47   Vitis vinifera
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    163   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    163   9e-45   
dbj|BAH56878.1|  AT5G35630                                              157   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    161   7e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             160   9e-44   
ref|XP_006850815.1|  hypothetical protein AMTR_s00025p00120730          159   2e-43   Amborella trichopoda
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     159   3e-43   Brassica rapa
ref|XP_008779349.1|  PREDICTED: glutamine synthetase leaf isozyme...    155   3e-43   
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             159   3e-43   Eutrema salsugineum [saltwater cress]
ref|NP_198413.1|  glutamine synthetase 2                                159   4e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ABY87178.1|  chloroplast glutamine synthetase                        158   9e-43   Brassica rapa subsp. chinensis [bok-choy]
gb|AAY33511.1|  glutamine synthetase precursor                          147   4e-42   Lotus japonicus
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    156   4e-42   Elaeis guineensis
emb|CAB72423.1|  glutamine synthetase                                   156   5e-42   Brassica napus [oilseed rape]
emb|CDY33684.1|  BnaC04g29670D                                          156   6e-42   Brassica napus [oilseed rape]
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             155   8e-42   Capsella rubella
emb|CDY49365.1|  BnaA08g29950D                                          154   1e-41   Brassica napus [oilseed rape]
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    154   2e-41   Brassica rapa
emb|CAA73062.1|  plastidic glutamine synthetase precursor               153   6e-41   Brassica napus [oilseed rape]
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    152   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    150   4e-40   
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    150   8e-40   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX84116.1|  BnaC08g07930D                                          140   9e-38   
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     144   2e-37   Brachypodium distachyon [annual false brome]
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            141   1e-36   Secale cereale
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               141   2e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               140   2e-36   Triticum aestivum [Canadian hard winter wheat]
gb|ACT22496.1|  plastid glutamine synthetase 2                          140   2e-36   Triticum aestivum [Canadian hard winter wheat]
gb|ACT22500.1|  plastid glutamine synthetase 2                          140   2e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    139   1e-35   Setaria italica
dbj|BAJ91545.1|  predicted protein                                      138   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95492.1|  predicted protein                                      138   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               138   2e-35   Triticum aestivum [Canadian hard winter wheat]
gb|KHN31946.1|  Glutamine synthetase leaf isozyme, chloroplastic        132   3e-35   Glycine soja [wild soybean]
emb|CAA34131.1|  unnamed protein product                                135   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001241708.1|  uncharacterized protein LOC100856886               134   2e-34   
dbj|BAG88835.1|  unnamed protein product                                133   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    134   4e-34   
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      134   4e-34   
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    135   4e-34   Zea mays [maize]
gb|AAL87183.1|AF480497_11  putative precursor chloroplastic gluta...    134   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054133.1|  Os04g0659100                                       134   5e-34   
dbj|BAD12057.1|  plastidic glutamine synthetase                         134   5e-34   Phragmites australis
prf||1804333B  Gln synthetase                                           132   2e-33
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    130   1e-32   Hordeum vulgare [barley]
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        130   2e-32   Triticum urartu
gb|EPS57543.1|  glutamine synthetase                                    125   3e-32   Genlisea aurea
dbj|BAD12059.1|  plastidic glutamine synthetase                         128   6e-32   Phragmites australis
prf||1804333C  Gln synthetase                                           127   2e-31
emb|CAA29057.1|  gluthamine synthetase                                  125   4e-31   Pisum sativum [garden pea]
prf||1804333D  Gln synthetase                                           125   7e-31
gb|ACG35376.1|  glutamine synthetase                                    124   2e-30   Zea mays [maize]
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    122   6e-30   
gb|ACG31728.1|  hypothetical protein                                    122   8e-30   Zea mays [maize]
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2            109   3e-25   Lemna minor
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1            109   4e-25   Lemna minor
gb|AFW89160.1|  glutamine synthetase3 isoform 1                         101   3e-24   
emb|CDY49656.1|  BnaC09g41340D                                          103   2e-23   Brassica napus [oilseed rape]
gb|AAP33476.1|  cytosolic glutamine synthetase                        98.6    3e-23   Securigera parviflora
ref|XP_010492570.1|  PREDICTED: glutamine synthetase cytosolic is...    102   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010420355.1|  PREDICTED: glutamine synthetase cytosolic is...    103   5e-23   Camelina sativa [gold-of-pleasure]
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...    103   5e-23   Lactuca sativa [cultivated lettuce]
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...    102   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...    102   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...    102   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg             102   7e-23   
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg                102   9e-23   Erythranthe guttata [common monkey flower]
ref|XP_004162638.1|  PREDICTED: glutamine synthetase nodule isozy...    102   1e-22   
gb|KGN51032.1|  Glutamine synthetase                                    102   1e-22   Cucumis sativus [cucumbers]
ref|XP_004140309.1|  PREDICTED: glutamine synthetase nodule isozy...    102   1e-22   
ref|XP_010435596.1|  PREDICTED: glutamine synthetase cytosolic is...    100   2e-22   Camelina sativa [gold-of-pleasure]
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1              101   2e-22   Lemna minor
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450          100   3e-22   Sorghum bicolor [broomcorn]
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2              100   3e-22   Lemna minor
gb|ACN36710.1|  unknown                                               99.4    3e-22   Zea mays [maize]
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                    100   3e-22   Arabis alpina [alpine rockcress]
ref|XP_002873784.1|  GLN1_4                                             100   3e-22   
gb|AAW21274.1|  glutamine synthetase                                    100   3e-22   Saccharum officinarum [noble cane]
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...    100   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...    100   3e-22   Camelina sativa [gold-of-pleasure]
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...    100   4e-22   Alnus glutinosa
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...    100   4e-22   Zea mays [maize]
ref|XP_010419001.1|  PREDICTED: glutamine synthetase cytosolic is...  97.4    4e-22   
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...    100   5e-22   Brassica rapa
emb|CDX69442.1|  BnaA10g17910D                                          100   5e-22   
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like               100   5e-22   Nicotiana sylvestris
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like               100   6e-22   Nicotiana tomentosiformis
tpg|DAA44141.1|  TPA: glutamine synthetase6                             100   7e-22   
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...  99.8    7e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGC24244.1|  glutamine synthetase 1                                96.3    7e-22   Brassica napus [oilseed rape]
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...  99.8    8e-22   Cucumis melo [Oriental melon]
ref|NP_001105297.1|  glutamine synthetase root isozyme 5              99.8    8e-22   
gb|ACG47508.1|  glutamine synthetase root isozyme 5                   99.8    9e-22   Zea mays [maize]
emb|CAG27625.1|  putative glutamine synthetase                        94.4    9e-22   Populus x canadensis [Canadian poplar]
tpg|DAA44139.1|  TPA: glutamine synthetase6                           99.4    1e-21   
gb|KJB10478.1|  hypothetical protein B456_001G203300                  98.6    1e-21   Gossypium raimondii
ref|NP_001105538.1|  glutamine synthetase root isozyme 1              99.4    1e-21   Zea mays [maize]
gb|AFK46766.1|  unknown                                               97.4    1e-21   Medicago truncatula
gb|KDP25795.1|  hypothetical protein JCGZ_22517                       99.4    1e-21   Jatropha curcas
gb|KJB10479.1|  hypothetical protein B456_001G203300                  99.0    1e-21   Gossypium raimondii
gb|AAB61597.1|  glutamine synthetase                                  99.0    1e-21   Hevea brasiliensis [jebe]
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...  99.0    1e-21   
gb|ABW89461.1|  glutamine synthetase                                  99.0    1e-21   Gossypium hirsutum [American cotton]
gb|AFW90613.1|  glutamine synthetase GS1                              98.2    1e-21   Solanum tuberosum [potatoes]
gb|ABW89460.1|  glutamine synthetase                                  99.0    1e-21   Gossypium herbaceum [Arabian cotton]
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozyme   99.0    1e-21   Fragaria vesca subsp. vesca
emb|CCO25538.1|  glutamine synthetase                                 99.0    1e-21   Pinus pinaster [cluster pine]
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1              99.0    1e-21   Gossypium arboreum [tree cotton]
gb|ABW89462.1|  glutamine synthetase                                  99.0    1e-21   Gossypium hirsutum [American cotton]
gb|ABW89464.1|  glutamine synthetase                                  99.0    1e-21   Gossypium hirsutum [American cotton]
gb|ABW89463.1|  glutamine synthetase                                  99.0    1e-21   Gossypium raimondii
emb|CDY38104.1|  BnaC02g06690D                                        99.0    2e-21   Brassica napus [oilseed rape]
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...  99.0    2e-21   Brassica rapa
gb|AGC24239.1|  glutamine synthetase 1                                99.0    2e-21   Brassica napus [oilseed rape]
ref|NP_568335.1|  glutamine synthetase 1;4                            98.6    2e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA04995.1|  glutamine synthetase                                 98.6    2e-21   Raphanus sativus
dbj|BAA04996.1|  glutamine synthetase                                 98.6    2e-21   Raphanus sativus
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg           98.6    2e-21   Capsella rubella
gb|AGT16433.1|  glutamine synthetase                                  98.6    2e-21   Saccharum hybrid cultivar R570
gb|AAW21275.1|  glutamine synthetase                                  98.6    2e-21   Saccharum officinarum [noble cane]
emb|CAJ87510.1|  putative glutamine synthetase                        98.2    2e-21   Pisum sativum [garden pea]
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...  98.2    2e-21   Pisum sativum [garden pea]
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1       98.2    2e-21   Nicotiana sylvestris
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...  98.2    2e-21   Populus euphratica
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...  98.2    3e-21   Phaseolus vulgaris [French bean]
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2       98.2    3e-21   Nicotiana sylvestris
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...  98.2    3e-21   Lotus japonicus
emb|CAA71317.1|  glutamine synthetase                                 98.2    3e-21   Medicago truncatula
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...  98.2    3e-21   Medicago sativa [alfalfa]
emb|CAA63963.1|  glutamate synthetase                                 98.2    3e-21   Lotus japonicus
ref|XP_003600702.1|  Glutamine synthetase                             98.2    3e-21   Medicago truncatula
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...  98.2    3e-21   Camelina sativa [gold-of-pleasure]
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                    98.2    3e-21   Solanum tuberosum [potatoes]
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...  98.2    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010415164.1|  PREDICTED: glutamine synthetase cytosolic is...  97.4    3e-21   Camelina sativa [gold-of-pleasure]
emb|CAA58118.1|  glutamate--ammonia ligase                            98.2    3e-21   Brassica napus [oilseed rape]
sp|P14636.1|GLNA3_LUPAN  RecName: Full=Glutamine synthetase nodul...  97.8    3e-21   Lupinus angustifolius
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg           98.2    3e-21   Capsella rubella
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...  98.2    3e-21   Camelina sativa [gold-of-pleasure]
emb|CDY01727.1|  BnaC04g30250D                                        97.8    3e-21   
ref|XP_010470494.1|  PREDICTED: glutamine synthetase cytosolic is...  97.4    3e-21   Camelina sativa [gold-of-pleasure]
gb|AAR86718.1|  glutamine synthetase GS56                             97.8    3e-21   Nicotiana attenuata
gb|AAK49029.1|  cytosolic glutamine synthetase                        97.8    4e-21   Populus tremula x Populus alba [gray poplar]
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...  97.8    4e-21   Sesamum indicum [beniseed]
gb|AAP33167.1|  cytosolic glutamine synthetase                        97.8    4e-21   Securigera parviflora
emb|CAN68162.1|  hypothetical protein VITISV_015673                   97.8    4e-21   Vitis vinifera
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...  97.8    4e-21   Lupinus luteus
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...  97.8    4e-21   
gb|AJD14835.1|  glutamine synthetase                                  97.4    4e-21   Boehmeria nivea [Chinese silk-plant]
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...  97.4    5e-21   Elaeis guineensis
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...  97.4    5e-21   Brassica rapa
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme   97.4    5e-21   Elaeis guineensis
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...  97.4    5e-21   
gb|AAD28469.1|AF130882_1  glutamine synthetase                        95.1    5e-21   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AAT46062.1|  glutamine synthetase GS2                              94.4    5e-21   Apium graveolens Dulce Group [celery]
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...  97.4    5e-21   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA73366.1|  glutamine synthetase                                 97.4    6e-21   Lotus japonicus
gb|AFN42876.1|  glutamine synthetase                                  97.1    7e-21   Camellia sinensis [black tea]
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...  97.1    7e-21   Fragaria vesca subsp. vesca
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...  97.1    7e-21   Zea mays [maize]
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...  97.1    7e-21   Cicer arietinum [garbanzo]
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme   97.1    7e-21   Phoenix dactylifera
emb|CAA65173.1|  glutamine synthetase                                 97.1    7e-21   Nicotiana tabacum [American tobacco]
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like      97.1    7e-21   Cucumis sativus [cucumbers]
gb|EMS46544.1|  Glutamine synthetase cytosolic isozyme 1-2            97.1    7e-21   Triticum urartu
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg           97.1    7e-21   Prunus persica
gb|EEC73954.1|  hypothetical protein OsI_08842                        97.1    8e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg           97.1    8e-21   Eutrema salsugineum [saltwater cress]
ref|NP_001105443.1|  glutamine synthetase root isozyme 2              97.1    8e-21   
gb|ACL54769.1|  unknown                                               97.1    8e-21   Zea mays [maize]
gb|AGV54248.1|  glutamine synthetase                                  96.7    8e-21   Phaseolus vulgaris [French bean]
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme   96.7    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...  96.7    8e-21   Nicotiana tomentosiformis
gb|ACA50923.1|  glutamine synthetase                                  96.7    8e-21   Zea mays [maize]
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...  97.1    8e-21   
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...  96.7    8e-21   Setaria italica
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...  96.7    9e-21   Zea mays [maize]
ref|NP_001105296.1|  glutamine synthetase root isozyme 3              96.7    9e-21   Zea mays [maize]
ref|XP_002888488.1|  ATGSR2                                           96.7    9e-21   
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1      96.7    9e-21   Glycine max [soybeans]
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1         96.7    9e-21   
gb|ACF78695.1|  unknown                                               96.7    9e-21   Zea mays [maize]
ref|NP_001048045.1|  Os02g0735200                                     96.7    9e-21   
ref|XP_002870545.1|  ATGSR1                                           96.7    9e-21   Arabidopsis lyrata subsp. lyrata
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                  96.7    1e-20   Arabis alpina [alpine rockcress]
ref|XP_010450519.1|  PREDICTED: glutamine synthetase cytosolic is...  95.9    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_007141924.1|  hypothetical protein PHAVU_008G237500g           96.7    1e-20   Phaseolus vulgaris [French bean]
ref|XP_006590378.1|  PREDICTED: glutamine synthetase cytosolic is...  95.9    1e-20   Glycine max [soybeans]
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...  96.3    1e-20   Pyrus x bretschneideri [bai li]
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...  96.3    1e-20   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...  96.3    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg           96.3    1e-20   Eutrema salsugineum [saltwater cress]
emb|CAA57216.1|  glutamate--ammonia ligase                            96.3    1e-20   
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...  96.3    1e-20   
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...  96.3    1e-20   
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg           96.3    1e-20   
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2         96.3    1e-20   
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g           96.3    1e-20   
emb|CBI33470.3|  unnamed protein product                              96.3    1e-20   
ref|NP_198576.1|  glutamine synthetase 1;1                            96.3    1e-20   
gb|EMT23121.1|  Glutamine synthetase cytosolic isozyme 1-2            96.3    1e-20   
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1       96.3    1e-20   
emb|CAA65174.1|  glutamine synthetase                                 96.3    1e-20   
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...  96.3    1e-20   
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...  96.3    1e-20   
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...  96.3    1e-20   
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...  96.3    1e-20   
gb|AGC24238.1|  glutamine synthetase 1                                96.3    1e-20   
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...  95.9    2e-20   
ref|XP_009631593.1|  PREDICTED: glutamine synthetase isoform X2       95.5    2e-20   
gb|ABU45501.1|  cytosolic glutamine synthetase                        95.9    2e-20   
gb|ACD13217.1|  glutamine synthetase                                  95.9    2e-20   
gb|KDP24824.1|  hypothetical protein JCGZ_25308                       95.9    2e-20   
emb|CAA54151.1|  glutamine                                            95.9    2e-20   
emb|CAA73063.1|  cytosolic glutamine synthetase                       95.9    2e-20   
gb|ACF42116.1|  cytosolic glutamine synthetase                        95.9    2e-20   
gb|AAW21273.1|  glutamine synthetase                                  95.9    2e-20   
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...  95.9    2e-20   
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme              95.9    2e-20   
gb|AAR84348.1|  glutamine synthetase isoform GSr2                     95.9    2e-20   
gb|AEH16645.1|  glutamine synthetase                                  95.9    2e-20   
gb|AAR84347.1|  glutamine synthetase isoform GSr1                     95.9    2e-20   
ref|XP_002305885.1|  glutamate-ammonia ligase family protein          95.9    2e-20   
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...  95.9    2e-20   
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...  95.9    2e-20   
gb|ABK21449.1|  unknown                                               95.9    2e-20   
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...  95.9    2e-20   
gb|AID48673.1|  theanine synthetase                                   95.5    2e-20   
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g           95.5    2e-20   
gb|ACU15915.1|  unknown                                               94.4    2e-20   
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...  95.5    2e-20   
gb|ABK93921.1|  unknown                                               94.0    2e-20   
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...  95.5    2e-20   
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme   95.5    2e-20   
dbj|BAH56851.1|  AT1G66200                                            94.7    2e-20   
emb|CAA73064.1|  cytosolic glutamine synthetase                       95.5    3e-20   
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                  95.5    3e-20   
ref|NP_001031240.1|  glutamine synthetase                             94.7    3e-20   
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...  95.5    3e-20   
gb|AAM63710.1|  glutamine synthetase, putative                        95.5    3e-20   
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme           95.5    3e-20   
gb|AGV07415.1|  glutamine synthetase                                  95.1    3e-20   
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g           95.1    3e-20   
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...  95.1    3e-20   
ref|NP_176794.1|  glutamine synthetase                                95.1    3e-20   
ref|NP_001185327.1|  glutamine synthetase                             95.5    3e-20   
gb|AAG40237.2|  glutamine synthetase GS1                              95.1    3e-20   
emb|CDO98315.1|  unnamed protein product                              95.1    3e-20   
dbj|BAE98486.1|  glutamine synthetase like protein                    95.1    3e-20   
gb|AIK03054.1|  glutamine synthetase                                  95.1    3e-20   
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...  95.1    3e-20   
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...  95.1    3e-20   
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                  95.1    3e-20   
gb|ACU19484.1|  unknown                                               95.1    3e-20   
dbj|BAD99525.1|  glutamine synthetase                                 95.1    3e-20   
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...  95.1    3e-20   
gb|ACR38147.1|  unknown                                               95.1    3e-20   
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like             95.1    3e-20   
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like             95.1    3e-20   
gb|AFB69880.1|  glutamine synthetase isoform 1r                       95.1    3e-20   
gb|AFW63835.1|  glutamine synthetase5                                 94.7    4e-20   
ref|XP_002318305.1|  glutamine synthetase family protein              95.1    4e-20   
gb|AAR29057.1|  glutamine synthetase 1                                95.1    4e-20   
ref|NP_001105444.1|  glutamine synthetase root isozyme 4              95.1    4e-20   
gb|ABX79672.1|  glutamine synthetase                                  95.1    4e-20   
dbj|BAD99526.1|  glutamine synthetase                                 95.1    4e-20   
ref|NP_001241743.1|  glutamine synthetase root isozyme 3              95.1    4e-20   
gb|ACB06727.1|  glutamine synthetase                                  94.7    4e-20   
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...  94.7    4e-20   
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                   94.7    4e-20   
gb|ABK95973.1|  unknown                                               94.7    4e-20   
gb|ACF74298.1|  glutamine synthetase GS56                             92.0    4e-20   
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2             94.7    4e-20   
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg              94.7    4e-20   
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...  94.7    5e-20   
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...  94.7    5e-20   
gb|ABK51388.1|  cytosolic glutamine synthetase                        94.4    5e-20   
emb|CAA06383.1|  glutamine synthetase                                 94.4    5e-20   
gb|AGG19203.1|  glutamine synthetase                                  94.4    5e-20   
gb|AGI78873.1|  glutamine synthetase                                  94.4    6e-20   
dbj|BAD11327.1|  glutamine synthetase                                 94.4    6e-20   
gb|KHN41059.1|  Glutamine synthetase N-1                              94.0    6e-20   
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...  94.4    6e-20   
gb|EEC76061.1|  hypothetical protein OsI_13264                        94.4    6e-20   
emb|CAA57346.1|  glutamate--ammonia ligase                            94.4    6e-20   
ref|NP_001051067.1|  Os03g0712800                                     94.4    6e-20   
ref|XP_006372556.1|  glutamate-ammonia ligase family protein          94.4    6e-20   
ref|XP_006576095.1|  PREDICTED: glutamine synthetase nodule isozy...  94.0    8e-20   
gb|ACR45960.1|  glutamine synthetase 1b                               94.0    8e-20   
ref|XP_002883089.1|  ATGSKB6                                          94.0    8e-20   
gb|KJB43163.1|  hypothetical protein B456_007G187300                  94.0    9e-20   
gb|AGI78872.1|  glutamine synthetase                                  94.0    9e-20   
ref|XP_006298020.1|  hypothetical protein CARUB_v10014064mg           93.6    1e-19   
ref|XP_002310666.1|  glutamine synthetase family protein              94.0    1e-19   
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...  93.6    1e-19   
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg              93.6    1e-19   
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...  93.6    1e-19   
emb|CDP01645.1|  unnamed protein product                              93.6    1e-19   
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...  93.6    1e-19   
ref|XP_006828438.1|  hypothetical protein AMTR_s00060p00109730        93.6    1e-19   
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1         93.6    1e-19   
ref|XP_009127475.1|  PREDICTED: glutamine synthetase cytosolic is...  93.2    1e-19   
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme   93.6    1e-19   
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...  93.6    1e-19   
ref|NP_001049424.1|  Os03g0223400                                     93.6    1e-19   
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...  93.6    1e-19   
gb|AFP20991.1|  glutamine synthetase isozyme                          93.6    1e-19   
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...  93.6    1e-19   
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...  93.6    1e-19   
gb|KCW69393.1|  hypothetical protein EUGRSUZ_F02872                   92.8    1e-19   
ref|XP_007043312.1|  Glutamine synthetase 1,4                         93.2    1e-19   
ref|XP_006374208.1|  glutamine synthetase family protein              93.2    1e-19   
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                    93.2    1e-19   
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg           93.2    2e-19   
ref|XP_002306385.1|  glutamine synthetase family protein              93.2    2e-19   
gb|ACN40288.1|  unknown                                               93.2    2e-19   
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...  93.2    2e-19   
gb|ABK23723.1|  unknown                                               93.2    2e-19   
ref|XP_006651743.1|  PREDICTED: glutamine synthetase cytosolic is...  93.2    2e-19   
gb|ABK94916.1|  unknown                                               93.2    2e-19   
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme   93.2    2e-19   
ref|XP_001782920.1|  predicted protein                                93.2    2e-19   
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...  92.8    2e-19   
gb|EPS73857.1|  glutamine synthetase                                  88.2    2e-19   
ref|XP_010549036.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...  93.2    2e-19   
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...  92.8    2e-19   
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...  92.8    2e-19   
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...  92.8    2e-19   
dbj|BAA04994.1|  glutamine synthetase                                 92.4    2e-19   
emb|CAL07995.1|  cytosolic glutamine synthetase                       91.7    3e-19   
emb|CAA52448.1|  glutamate--ammonia ligase                            92.4    3e-19   
sp|P52783.1|GLNA_PINSY  RecName: Full=Glutamine synthetase cytoso...  92.4    3e-19   
ref|NP_188409.1|  glutamine synthetase cytosolic isozyme 1-3          92.4    3e-19   
gb|AGC24234.1|  glutamine synthetase 1                                92.4    3e-19   
ref|XP_009145973.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...  92.4    3e-19   
gb|AAO42253.1|  putative glutamine synthetase                         92.4    3e-19   
ref|XP_006406687.1|  hypothetical protein EUTSA_v10021026mg           92.4    3e-19   
gb|KFK39112.1|  hypothetical protein AALP_AA3G202500                  92.0    3e-19   
ref|XP_003616263.1|  Glutamine synthetase                             92.0    4e-19   
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...  92.0    4e-19   
ref|NP_001268104.1|  glutamine synthetase                             92.0    4e-19   
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...  92.4    4e-19   
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1       92.0    4e-19   
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2             92.0    4e-19   
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...  92.0    5e-19   
ref|XP_010505938.1|  PREDICTED: glutamine synthetase cytosolic is...  91.7    5e-19   
ref|XP_010465841.1|  PREDICTED: glutamine synthetase cytosolic is...  91.7    5e-19   
gb|AFK48742.1|  unknown                                               91.7    5e-19   
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme   91.7    5e-19   
ref|XP_007036934.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...  90.9    6e-19   
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944           91.7    6e-19   
ref|XP_002527139.1|  glutamine synthetase plant, putative             91.7    6e-19   
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...  91.7    7e-19   
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...  91.3    7e-19   
ref|XP_006844043.1|  hypothetical protein AMTR_s00006p00241880        91.3    7e-19   
gb|AAB03492.1|  cytosolic glutamine synthetase                        91.3    7e-19   
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...  91.3    7e-19   
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...  91.3    8e-19   
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g           91.3    8e-19   
gb|KHG00904.1|  Glutamine synthetase nodule isozyme                   91.3    8e-19   
gb|AGZ15411.1|  glutamine synthetase PR-2                             91.3    8e-19   
gb|AAD52008.1|  cytosolic glutamine synthetase                        90.9    9e-19   
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...  90.9    9e-19   
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase              90.9    9e-19   
gb|AAP33169.1|  cytosolic glutamine synthetase                        90.9    1e-18   
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg           90.9    1e-18   
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2             90.9    1e-18   
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817           90.9    1e-18   
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...  90.5    1e-18   
ref|XP_003619869.1|  Glutamine synthetase                             90.5    1e-18   
gb|KDO50821.1|  hypothetical protein CISIN_1g018434mg                 89.7    1e-18   
gb|AGW24652.1|  cytosolic glutamine synthetase                        90.5    1e-18   
gb|AGW24651.1|  cytosolic glutamine synthetase                        90.5    2e-18   
ref|XP_010066985.1|  PREDICTED: glutamine synthetase cytosolic is...  90.1    2e-18   
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...  90.5    2e-18   
gb|ACR38893.1|  glutamine synthetase                                  90.1    2e-18   
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...  90.5    2e-18   
emb|CDY68590.1|  BnaAnng27730D                                        90.1    2e-18   
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha             90.1    2e-18   
ref|XP_009113719.1|  PREDICTED: glutamine synthetase cytosolic is...  90.1    2e-18   
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...  90.1    2e-18   
gb|EMS45858.1|  Glutamine synthetase cytosolic isozyme 1-3            90.1    2e-18   
pir||S18603  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic (cl...  90.5    2e-18
ref|XP_001782914.1|  predicted protein                                90.1    2e-18   
emb|CDX82343.1|  BnaA03g34780D                                        90.1    2e-18   
gb|KDP43303.1|  hypothetical protein JCGZ_24224                       90.1    2e-18   
emb|CDX75942.1|  BnaC03g40250D                                        90.1    2e-18   
gb|KDO50819.1|  hypothetical protein CISIN_1g018434mg                 89.7    2e-18   
gb|KDO50820.1|  hypothetical protein CISIN_1g018434mg                 89.7    2e-18   
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...  89.7    2e-18   
ref|XP_009135551.1|  PREDICTED: glutamine synthetase cytosolic is...  89.7    3e-18   
gb|AFB69879.1|  glutamine synthetase isoform 1-1                      89.7    3e-18   
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...  89.7    3e-18   
gb|AAK08103.1|AF338444_1  glutamine synthetase                        89.7    3e-18   
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...  89.7    3e-18   
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg           90.5    3e-18   
ref|XP_010500377.1|  PREDICTED: glutamine synthetase cytosolic is...  89.4    3e-18   
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...  89.4    3e-18   
sp|Q06378.1|GLNA3_HORVU  RecName: Full=Glutamine synthetase; AltN...  89.4    4e-18   
pir||S30569  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic - b...  89.4    5e-18
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...  89.0    6e-18   
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme   88.6    6e-18   
ref|XP_006306121.1|  hypothetical protein CARUB_v10011565mg           88.6    7e-18   
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...  88.6    8e-18   
dbj|BAM84282.1|  glutamine synthetase                                 88.2    8e-18   
gb|ACR45959.1|  glutamine synthetase 1a                               88.2    9e-18   
ref|XP_010250142.1|  PREDICTED: glutamine synthetase nodule isozyme   88.2    9e-18   
ref|XP_009401139.1|  PREDICTED: glutamine synthetase nodule isozy...  88.2    1e-17   
gb|AEM42902.1|  cytosolic glutamine synthetase isoform                88.2    1e-17   
gb|AAZ30058.1|  glutamine synthetase isoform GS1b                     88.2    1e-17   
gb|AAZ30059.1|  glutamine synthetase isoform GS1c                     88.2    1e-17   
gb|AAZ30057.1|  glutamine synthetase isoform GS1a                     88.2    1e-17   
dbj|BAK01909.1|  predicted protein                                    87.8    1e-17   



>gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum]
Length=432

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQMR+ KSST+ASP+ SKMW SVV+K NK++AVKSSAKFRVFAL S+N+T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKKLAVKSSAKFRVFALQSDNAT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPVQH SELPKWNYDGSST
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVQHASELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum]
 gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum]
Length=432

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQMR+ KSST+ASP+ SKMW SVV+K NKR+AVKSSAKFRVFAL S+N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDNGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNRMEQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDGSST
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVKDASELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_009773609.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana sylvestris]
Length=432

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQMR+ KSST+A+P+ SKMW SVV+K NKR+AVKSSAKFRVFAL S++ T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_009629915.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana tomentosiformis]
 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata]
Length=432

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQMR+ KSST+A+P+ SKMW SVV+K NKR+AVKSSAKFRVFAL S++ T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
 ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
Length=432

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQMR+ KSST+ASP+ SKMW SVV+K NKR A+KSSAKFRVFAL S+N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRHALKSSAKFRVFALQSDNGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+EQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVKDASELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|EYU45601.1| hypothetical protein MIMGU_mgv1a007136mg [Erythranthe guttata]
Length=418

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQMRI K+ST+AS + SKMW S+VMK NK+ +V++SAKFRVFA+ SE+ T
Sbjct  1    MAQILAPSAQWQMRIGKNSTDASALNSKMWSSLVMKQNKKGSVRTSAKFRVFAVKSEDGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRMEQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTLSKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_010105702.1| Glutamine synthetase leaf isozyme [Morus notabilis]
 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis]
Length=433

 Score =   213 bits (543),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPN-KRVAVKSSAKFRVFAL-SENS  294
            MAQILAPS QWQMRI K+ST+ASPM SKMWGS+VMK N K+ A+KSS KFRVFAL S+N 
Sbjct  1    MAQILAPSTQWQMRITKASTDASPMTSKMWGSLVMKQNNKKGAMKSSTKFRVFALKSDNG  60

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            T+NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSK+RTISKPV+HPSELPKWN+DGSS
Sbjct  61   TINRLEDLLNLDVTPYTDKIIAEYIWIGGSGIDVRSKARTISKPVEHPSELPKWNFDGSS  120

Query  475  TGQAPG  492
            TGQAPG
Sbjct  121  TGQAPG  126



>ref|XP_011090823.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090824.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090825.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090827.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
Length=432

 Score =   213 bits (542),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MA ILAPSAQWQMRIAK+ST+ASP+ SKMW S+V+K NK+ AVK+SAKFRV A+ SEN T
Sbjct  1    MAHILAPSAQWQMRIAKNSTDASPLTSKMWSSLVLKQNKKGAVKTSAKFRVLAVQSENGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRMEQ+LNLDV+P TDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEQMLNLDVSPITDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_002314425.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEF00596.1| glutamine synthetase family protein [Populus trichocarpa]
Length=432

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS+QWQMRIAK+S  A PM +KMW S+V+K NK+   KSSAKFRVFAL SENST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLD+TPYTDK IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_011006593.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Populus 
euphratica]
Length=432

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS+QWQMRIAK+S  A PM +KMW S+V+K NK+   KSSAKFRVFAL SENST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLD+TPYTDK IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>dbj|BAF62340.1| glutamine synthetase [Avicennia marina]
Length=432

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQMRIAK+S +ASP+++K W S+++K NK+ AVKS  KFRV A+ SENST
Sbjct  1    MAQILAPSAQWQMRIAKNSIDASPLSTKTWSSLILKQNKKEAVKSPGKFRVLAVKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+EQ+LNLDVTPYTDKIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTIPKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_006380048.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ERP57845.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=306

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS+QWQMRIAK+S  ASPM +KMW S+V+K NK+   KSSAKFRVFA+ SEN T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLD+TPYT+  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_007034566.1| Glutamine synthetase 2 [Theobroma cacao]
 gb|EOY05492.1| Glutamine synthetase 2 [Theobroma cacao]
Length=549

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = +1

Query  106  WE*VNMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-  282
            WE   MAQILAPS QWQMR+ K+ST  SP+A+KMW S+V+K NK+ A KS  KFRVFAL 
Sbjct  113  WEKRKMAQILAPSTQWQMRLPKTSTYGSPIATKMWNSLVLKQNKQGAAKSCGKFRVFALQ  172

Query  283  SENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNY  462
            SENSTVNR+E+LLN+D+TPYTDKIIAEYIWIGGSGID RSKS+TI+KPV+HPSELPKWNY
Sbjct  173  SENSTVNRLEKLLNMDITPYTDKIIAEYIWIGGSGIDLRSKSKTIAKPVEHPSELPKWNY  232

Query  463  DGSSTGQAPG  492
            DGSSTGQAPG
Sbjct  233  DGSSTGQAPG  242



>gb|KJB28233.1| hypothetical protein B456_005G035800 [Gossypium raimondii]
Length=431

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            MAQ+LAPS QWQM + K+ST  SP+A+KMW S+V+K NK+ A KSS KF+V ALSENSTV
Sbjct  1    MAQLLAPSTQWQMTLPKTSTYGSPIATKMWSSLVLKQNKKGAAKSSGKFKVVALSENSTV  60

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            NR+E LLN+DVTPYTDKIIAEY+WIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  61   NRLENLLNMDVTPYTDKIIAEYVWIGGSGLDMRSKSRTISKPVKHPSELPKWNYDGSSTG  120

Query  481  QAPG  492
            QAPG
Sbjct  121  QAPG  124



>ref|XP_002312733.1| glutamine synthetase family protein [Populus trichocarpa]
 ref|XP_006380049.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ABK94955.1| unknown [Populus trichocarpa]
 gb|EEE90100.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP57846.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=432

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS+QWQMRIAK+S  ASPM +KMW S+V+K NK+   KSSAKFRVFA+ SEN T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLD+TPYT+  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>emb|CAA47373.2| glutamate--ammonia ligase [Nicotiana sylvestris]
Length=432

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS +WQMR+ KSST+A+P+ SKMW SVV+K  K +AVKSSAKFR FAL S++ T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVLKIIKELAVKSSAKFRFFALESDSGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VN+ EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNQSEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis]
Length=432

 Score =   205 bits (522),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ K+S  ASP+ +KMW S+++K NK+V  K+S + RVFAL SENST
Sbjct  1    MAQILAPSPQWQMRLPKNSMPASPLTTKMWSSLLLKQNKKVTAKNSGRLRVFALKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TPYTD+IIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEDLLNLDITPYTDRIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_008351243.1| PREDICTED: glutamine synthetase, chloroplastic-like [Malus domestica]
Length=180

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQM+I +SST ASPM +KMWGS+V+K NK+   +SS KFRV A  +E  T
Sbjct  1    MAQILAPNSQWQMKITRSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_008223033.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Prunus 
mume]
Length=432

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQMRI KSST ASPM +KMW S+++K NKR   KSSAKFRV A+ SE+ T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKMWSSLLLKQNKRGPTKSSAKFRVLAVKSEDYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|KHG04493.1| Glutamine synthetase leaf isozyme, chloroplastic [Gossypium arboreum]
Length=432

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ KSST  SP+A+KMW S+++K N + A KS+ KFRV AL SENST
Sbjct  1    MAQILAPSTQWQMRVPKSSTFGSPIATKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR E+LLN+D+TPYTDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco
Length=432

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS +WQMR+ KSST+A+P+ SKMW SVV+K  K +AVKSSAKFRVFAL S++ T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVIKIIKELAVKSSAKFRVFALESDSGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VN+ EQLLNLDVTPYTD IIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNQSEQLLNLDVTPYTDLIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|KDO74876.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=375

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Daucus carota]
 gb|AAB71693.1| glutamine synthetase [Daucus carota]
Length=432

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR  K+STE S M SKMWGS+ +K NK+   +SS K+R  A+ SE+ T
Sbjct  1    MAQILAPSVQWQMRFTKNSTEVSSMTSKMWGSLFLKQNKKAPARSSTKYRALAVKSEDGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLDVTPYTDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_011009035.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009036.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=432

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS+QWQMRI K+S  ASPM +KMW S+V+K NK+   KSSAKFRVFA+ SEN T
Sbjct  1    MAQILAPSSQWQMRIPKNSAPASPMTAKMWSSLVLKQNKKGIAKSSAKFRVFAVKSENGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TPYT+  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRVEDLLNLDLTPYTNSFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>emb|CDO98975.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ K+  + SP+ SKMW S+V+K +K+ A+K+S+KF+V+AL SEN T
Sbjct  1    MAQILAPSPQWQMRVTKNLMDVSPLTSKMWSSLVLKQSKKGAIKTSSKFKVYALQSENGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+EQLLNLDVTPYTDKIIAEYIWIGGSG D RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGTDVRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
 ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
Length=432

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
 gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
Length=432

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQMRI KSST ASPM +K+W S+++K NKR   KSSAKFRV A+ SE  T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKVWSSLLLKQNKRGPTKSSAKFRVLAVKSEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|KDO74872.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74873.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74874.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=432

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_004174085.1| PREDICTED: glutamine synthetase, chloroplastic-like, partial 
[Cucumis sativus]
Length=196

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ+R   +   +SP+  KMW S+++K NK+ AVKSS+K+RV ++ SE  T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_011071523.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Sesamum indicum]
Length=429

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 4/125 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPSAQWQM I+K  T+A+P+ +KMWGS+ +K   + +VKSSAKF VFA+ S+NST
Sbjct  1    MAQILAPSAQWQMGISKGLTDATPLTTKMWGSLALK---QGSVKSSAKFGVFAVKSDNST  57

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+EQ+LNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  478  GQAPG  492
            GQAPG
Sbjct  118  GQAPG  122



>gb|KJB37729.1| hypothetical protein B456_006G218100 [Gossypium raimondii]
Length=432

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQIL PS QWQMR+ K ST  SP+ +KMW S+++K N + A KS+ KFRV AL SENST
Sbjct  1    MAQILVPSTQWQMRVPKCSTFGSPIVTKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR E+LLN+D+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_011462784.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   200 bits (509),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALS-ENST  297
            MAQILAP++QWQMRI KSS  +SPM  KMW S+V+K NK+ A+KSS KFRVFA   E+ T
Sbjct  1    MAQILAPTSQWQMRITKSSIPSSPMTGKMWSSLVLKQNKKGAIKSS-KFRVFASKYEDYT  59

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  60   INRVEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  119

Query  478  GQAPG  492
            GQAPG
Sbjct  120  GQAPG  124



>gb|ACU24520.1| unknown [Glycine max]
Length=432

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI+KSS  ASP+ S MW S++ K NK+V+  SSAKFRV A+ S+NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_003546121.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597566.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN33081.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=432

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI+KSS  ASP+ S MW S++ K NK+V+  SSAKFRV A+ S+NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|NP_001237784.1| glutamine synthetase precursor [Glycine max]
 gb|AAK43833.1|AF353620_1 glutamine synthetase precursor [Glycine max]
Length=432

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI+KSS  ASP+ S MW S++ K NK+V+  SSAKFRV A+ S+NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|KHN37551.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=434

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI+KSS  A+P+ S MW S++ K NK+V++ SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas]
Length=432

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI K+ST  SP+ +KM+ S+ +K NK+   +++A+ RVFA+ S+NST
Sbjct  1    MAQILAPSTQWQMRIQKNSTPMSPLTAKMFNSLFLKQNKKGTARNTARLRVFAMKSDNST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  61   INRLEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVGHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|ACU18743.1| unknown [Glycine max]
Length=420

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI+KSS  A+P+ S MW S++ K NK+V+  SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_006593484.1| PREDICTED: glutamine synthetase precursor isoform X1 [Glycine 
max]
Length=432

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI+KSS  A+P+ S MW S++ K NK+V+  SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_009339932.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Pyrus 
x bretschneideri]
Length=432

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQM++ KSS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSGID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|AAN84538.1| putative plastidic glutamine synthetase [Spiraea nipponica]
Length=429

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MA ILAP+ QWQ RI K++T ASPM +KMWGS+++K NK+   K+S KFRV A+ SE  T
Sbjct  1    MAHILAPTTQWQTRITKNATSASPMTAKMWGSLLLKQNKKGPTKTSTKFRVLAVKSEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_009352136.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=432

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQM+I KSST ASPM +KMWGS+V+K NK+   +SS KFRV A  +E  T
Sbjct  1    MAQILAPTSQWQMKITKSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata]
Length=429

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRVTKSSLHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDNST  57

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  478  GQAPG  492
            GQAPG
Sbjct  118  GQAPG  122



>ref|XP_008361978.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=396

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQM++ KSS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra]
Length=432

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MA IL P+ +WQMRI K+S  ASPM +KMWGS+++K NK+ + KSSAKFRVFA  SENST
Sbjct  1    MAHILTPTTRWQMRITKNSANASPMTAKMWGSLLLKQNKKGSSKSSAKFRVFATKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E+LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRIEKLLNLDLTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|KCW84320.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=322

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQI+AP+ Q QMRI K+S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  126

Query  478  GQAPG  492
            GQAPG
Sbjct  127  GQAPG  131



>gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata]
Length=430

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI K+S  ASP+ S MW S++MK NK+    SSAKFRV A+ SEN T
Sbjct  1    MAQILAPSTQWQMRITKTSPNASPVTSNMWSSLLMKQNKKAT--SSAKFRVLAIKSENGT  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LL+LD+TPYTDKIIAEYIW+GG+GID RSKSRTI++PV+HPSELPKWNYDGSST
Sbjct  59   INRLENLLDLDITPYTDKIIAEYIWVGGTGIDVRSKSRTIARPVEHPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>ref|XP_008390805.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQM+I +SST ASPM +KMWGS+V+K NK+   +SS KFRV A  +E  T
Sbjct  1    MAQILAPNSQWQMKITRSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TD+IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_008353244.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   195 bits (495),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QWQM++ KSS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57036.1| Glutamine synthetase [Cucumis sativus]
Length=432

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ+R   +   +SP+  KMW S+++K NK+ AVKSS+K+RV ++ SE  T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=432

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQI+AP+ Q QMRI K S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  1    MAQIMAPTTQCQMRITKHSLNASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_010255852.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Nelumbo 
nucifera]
Length=432

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ+++ K+S+ A P+ +KMW S+++   ++ A K SAKFRVFAL SE+ST
Sbjct  1    MAQILAPSIQWQIKMTKNSSSARPITAKMWSSLLLNQKRKGAAKGSAKFRVFALQSESST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LL LD TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLKLDTTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=432

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQI+AP+ Q QMRI K+S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  1    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_010035896.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW84319.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=438

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQI+AP+ Q QMRI K+S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  126

Query  478  GQAPG  492
            GQAPG
Sbjct  127  GQAPG  131



>ref|NP_001284439.1| glutamine synthetase leaf isozyme, chloroplastic [Cucumis melo]
 gb|AAX35343.1| glutamine synthetase [Cucumis melo]
Length=432

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ+R   +S  +SP+  KMW S+++K NK+ AVKSS+K+RV ++ S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli]
Length=432

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAP++QW+M++ +SS  ASPM +KMWGS+V+K NK+   +SS KFRV A  SE  T
Sbjct  1    MAQILAPTSQWRMKVTRSSATASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKSEGYT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>ref|XP_008438737.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
melo]
Length=432

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ+R   +S  +SP+  KMW S+++K NK+ AVKSS+K+RV ++ S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NRME LLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Pisum sativum]
 gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum]
Length=430

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI K+S  A+P+ SKMW S+VMK  K+VA   SAKFRV A+ SEN T
Sbjct  1    MAQILAPSTQWQMRITKTSPCATPITSKMWSSLVMKQTKKVA--HSAKFRVMAVNSENGT  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDGSST
Sbjct  59   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris]
Length=429

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR  KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQMRFTKSSHHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  478  GQAPG  492
            GQAPG
Sbjct  118  GQAPG  122



>prf||1601519A Gln synthetase
Length=429

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR  KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  478  GQAPG  492
            GQAPG
Sbjct  118  GQAPG  122



>ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme 
delta; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
Length=429

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR  KSS  ASP+ S  W S++MK NK+    SSAKFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  478  GQAPG  492
            GQAPG
Sbjct  118  GQAPG  122



>ref|XP_004486102.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cicer arietinum]
Length=430

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALS-ENST  297
            MAQILAPS QWQMRI K+S   +P+ SKMW S+V+K NK+VA   SAKFRV A+  +NST
Sbjct  1    MAQILAPSTQWQMRITKTSPCVTPITSKMWSSLVVKQNKKVA--RSAKFRVMAIKPDNST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>gb|KDO74871.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=428

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 5/125 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD+TPYTDKIIAEYIWIGG+GID RSK    SKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSK----SKPVEHPSELPKWNYDGSST  116

Query  478  GQAPG  492
            GQAPG
Sbjct  117  GQAPG  121



>gb|KDO74875.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=442

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 11/135 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMR+ K S  ASPM +KMW S++MK NK+   +SSAKFRV AL SE+ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYI--------W--IGGSGIDTRSKSRTISKPVQHPSEL  447
            VNR+E LLNLD+TPYTDKIIAEYI        W  IGG+GID RSKS+TISKPV+HPSEL
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYICQNNTISCWNRIGGTGIDMRSKSKTISKPVEHPSEL  120

Query  448  PKWNYDGSSTGQAPG  492
            PKWNYDGSSTGQAPG
Sbjct  121  PKWNYDGSSTGQAPG  135



>gb|AJD14836.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   190 bits (482),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS Q QMRI K+S+  SP+ SKMW S+V+K +KRV  K S+K++V  + SE+ T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>gb|AJI44225.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   190 bits (482),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS Q QMRI K+S+  SP+ SKMW S+V+K +KRV  K S+K++V  + SE+ T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD+TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>ref|XP_006593065.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Glycine max]
Length=198

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 12/136 (9%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQMRI+KSS  A+P+ S MWGS++ K NK+V++ SSAKFRV A+ S+NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWGSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIW-----------IGGSGIDTRSKSRTISKPVQHPSE  444
            +NR+E LLNLD+TP+TDKIIAEYIW           + G GID RSKSRTISKPV+ PS+
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWYLKLIFFFETGLRGIGIDVRSKSRTISKPVEDPSK  120

Query  445  LPKWNYDGSSTGQAPG  492
            LP+WNYDGSSTGQA G
Sbjct  121  LPRWNYDGSSTGQAQG  136



>gb|KCW44355.1| hypothetical protein EUGRSUZ_L021751, partial [Eucalyptus grandis]
Length=165

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 106/158 (67%), Gaps = 34/158 (22%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQI+AP+ Q QMRI K S  ASPM +K W S+++K  K    KS +KFRV+AL SENST
Sbjct  1    MAQIMAPTTQCQMRITKHSLNASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIW---------------------------------IG  378
            +NR+E LLNLDVTPYTDKIIAEYIW                                 IG
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWYVLMPETFDGGAQKDGNTRTVLYSKFAFFFNLLIG  120

Query  379  GSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPG  492
            GSGID RSKSRTIS+PV+HPSELPKWNYDGSSTGQAPG
Sbjct  121  GSGIDLRSKSRTISRPVEHPSELPKWNYDGSSTGQAPG  158



>gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus]
Length=430

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDK IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>gb|AAN84563.1| glutamine synthetase [Lotus japonicus]
Length=430

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDK IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI26165.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFA-LSENST  297
            MAQILAPS QWQMR+ K+   ASP  +KMWGS+ +K   +   K S KFRV A  SE+ST
Sbjct  1    MAQILAPSTQWQMRMTKNPANASPFTTKMWGSLFLKQKTKGTAKFSTKFRVCASKSESST  60

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR++ LLN+D+ PYTDKIIAEY+WIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLDDLLNMDIRPYTDKIIAEYVWIGGTGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  478  GQAPG  492
            GQAPG
Sbjct  121  GQAPG  125



>gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus]
Length=430

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDK IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>gb|ACJ84875.1| unknown [Medicago truncatula]
Length=321

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  481  QAPG  492
            QAPG
Sbjct  118  QAPG  121



>sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Medicago sativa]
 gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa]
Length=428

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 3/124 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            MAQILAPS Q Q RI K+S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSIQCQTRITKTSPLATPISSKMWSSLVMKQNKKVA--RSAKFRVMAIN-SGTI  57

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  481  QAPG  492
            QAPG
Sbjct  118  QAPG  121



>gb|KEH36742.1| glutamine synthetase domain protein [Medicago truncatula]
Length=393

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  481  QAPG  492
            QAPG
Sbjct  118  QAPG  121



>gb|AAO37651.1| glutamine synthetase [Medicago truncatula]
 gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  481  QAPG  492
            QAPG
Sbjct  118  QAPG  121



>gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus]
Length=430

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLDVTPYTDK IAEYIWI G+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIRGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>gb|AFH88076.1| chloroplast glutamine synthetase protein, partial [Sesuvium portulacastrum]
Length=433

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SENS  294
            MAQILAPS Q QM I KSS  A+ +    W SVV+K +++ ++K+S KF+V A   SE+S
Sbjct  1    MAQILAPSMQLQMGIPKSSVLANSVMPNKWTSVVLKQSRKGSIKNSTKFKVCATFKSEDS  60

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            TVNR+EQLLNLDVTPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSS
Sbjct  61   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSS  120

Query  475  TGQAPG  492
            TGQAPG
Sbjct  121  TGQAPG  126



>gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula]
 gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula]
 gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 3/124 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            MAQILAPS Q Q RI K+S  A+P++SKMW S+VMK NK+VA   SA FR  A++ + T+
Sbjct  1    MAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAIN-SGTI  57

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  481  QAPG  492
            QAPG
Sbjct  118  QAPG  121



>ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI32325.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 104/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  294
            MA I APS Q Q+R+   SS  A PM +K+W S+++   K+   +SSA+FRV AL SE+S
Sbjct  1    MAHITAPSVQCQVRVVPTSSFTARPMTAKLWNSLLLNQRKKGTSRSSARFRVLALQSESS  60

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            TVNR++ LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSS
Sbjct  61   TVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDGSS  120

Query  475  TGQAPG  492
            TGQAPG
Sbjct  121  TGQAPG  126



>ref|XP_003594092.1| Glutamine synthetase [Medicago truncatula]
Length=1639

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  118   NMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
             NMAQILAPS Q Q RI K+S  A+P++SKMW S+VMK NK+VA   SA FR  A++ + T
Sbjct  1211  NMAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAIN-SGT  1267

Query  298   VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
             +NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  1268  INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  1327

Query  478   GQAPG  492
             GQAPG
Sbjct  1328  GQAPG  1332


 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            MAQILAPS Q Q RI K S  A+P++SKMW S+VMK NK+VA   SAKFRV A++ + T+
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVN-SGTI  57

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSSTG
Sbjct  58   NRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTG  117

Query  481  QAPG  492
            QAPG
Sbjct  118  QAPG  121



>ref|XP_010557680.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=434

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 103/127 (81%), Gaps = 3/127 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMAS-KMWGSVVMKPNKRVA-VKSSAKFRVFAL-SEN  291
            MAQILAPS + QM + K S  +SP AS K+W SVV++ NK+   +  S KFRV AL S++
Sbjct  1    MAQILAPSPKCQMGVPKHSVISSPAASSKLWSSVVLRQNKQSGKLNCSNKFRVLALQSDD  60

Query  292  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
            STVNR+E LLNLD  PYTDKIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGS
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDGS  120

Query  472  STGQAPG  492
            STGQAPG
Sbjct  121  STGQAPG  127



>gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea]
Length=431

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 103/126 (82%), Gaps = 4/126 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFA--LSENS  294
            MAQILAPS Q QM+++K  T  S M    W S+++K  ++ ++K S KFRV A   S++ 
Sbjct  1    MAQILAPSMQCQMKLSKGLT--SSMTPSPWTSILLKQGQKGSIKCSTKFRVCASLQSDHG  58

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            TVNR+EQLLNLDVTPYTDKIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSS
Sbjct  59   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDLRSKSRTLSKPVEHPSELPKWNYDGSS  118

Query  475  TGQAPG  492
            TGQAPG
Sbjct  119  TGQAPG  124



>gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum 
crystallinum]
Length=433

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFA--LSENS  294
            MAQILAPS Q +M I KSST AS M    W SVV+K +++ ++K+S KF+V A    + S
Sbjct  1    MAQILAPSLQVKMSITKSSTPASSMLPNTWTSVVLKQSRKGSIKNSTKFKVCASIKPDVS  60

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
              NR+EQLLNLDVTP+TDKIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSS
Sbjct  61   VQNRVEQLLNLDVTPFTDKIIAEYIWIGGAGIDLRSKSRTLSKPVEHPSELPKWNYDGSS  120

Query  475  TGQAPG  492
            TGQAPG
Sbjct  121  TGQAPG  126



>ref|XP_010542001.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010542002.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=434

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 103/127 (81%), Gaps = 3/127 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMAS-KMWGSVVMKPNKRVA-VKSSAKFRVFAL-SEN  291
            MAQILAPS + QM   K S   SP AS ++W SVV+K NK+   +K S+KFRV A+ S++
Sbjct  1    MAQILAPSPKCQMGAPKHSFITSPAASSRLWSSVVLKQNKQSGKLKYSSKFRVLAVQSDD  60

Query  292  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
            STVNR+E LLNLD  PYTDKIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGS
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDGS  120

Query  472  STGQAPG  492
            STGQAPG
Sbjct  121  STGQAPG  127



>ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris]
 gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris]
Length=431

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 104/126 (83%), Gaps = 4/126 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SENS  294
            MAQILAP+ Q QM+++KS T +  M    W S+++K +++ ++K S KF+V A   +E+ 
Sbjct  1    MAQILAPNMQCQMKLSKSLTNS--MIPNSWTSILLKGSQKGSIKCSTKFKVCAALKTEHG  58

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            TVNRMEQLLNLDVTP+TDKIIAEYIWIGGSGID RSKSRT+S+PV+ PSELPKWNYDGSS
Sbjct  59   TVNRMEQLLNLDVTPFTDKIIAEYIWIGGSGIDLRSKSRTLSRPVEDPSELPKWNYDGSS  118

Query  475  TGQAPG  492
            TGQAPG
Sbjct  119  TGQAPG  124



>emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera]
Length=433

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  294
            MA I APS Q Q+R+   SS  A  M +K+W S++    K+   +SSA+ RV AL SE+ 
Sbjct  1    MAHIXAPSVQCQVRVVPTSSFTARXMTAKLWNSLLXNQRKKGTSRSSARXRVLALQSESX  60

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            TVNR++ LLNLD+TPYTDKIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSS
Sbjct  61   TVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDGSS  120

Query  475  TGQAPG  492
            TGQAPG
Sbjct  121  TGQAPG  126



>ref|XP_010435449.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
 ref|XP_010435451.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X4 [Camelina sativa]
 ref|XP_010440748.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=430

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+ +S + +K+W SVV+K  K+ + K    FRVFAL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>ref|XP_010435447.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010435448.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
 ref|XP_010435454.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X7 [Camelina sativa]
 ref|XP_010440747.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=441

 Score =   163 bits (413),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+ +S + +K+W SVV+K  K+ + K    FRVFAL S+NST
Sbjct  12   MAQILAASPTCQMRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  69

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  70   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  129

Query  478  GQAPG  492
            GQAPG
Sbjct  130  GQAPG  134



>dbj|BAH56878.1| AT5G35630 [Arabidopsis thaliana]
Length=278

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIA-SSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>ref|XP_010450396.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
 ref|XP_010450397.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=430

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+ +S + +K+W SVV+K  K+ + K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVLALQSDNST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIA--SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  57

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD  PYTD+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  58   VNRVETLLNLDTKPYTDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  117

Query  478  GQAPG  492
            GQAPG
Sbjct  118  GQAPG  122



>ref|XP_006850815.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
 gb|ERN12396.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
Length=433

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 98/129 (76%), Gaps = 5/129 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVM--KPNKRVAVKSSAKFRVF---ALS  285
            MAQILAPS Q QM  AK S +A P+ +KMW S+V+  + + R + KS++KFR F   A S
Sbjct  1    MAQILAPSMQCQMGSAKISIKAGPVTAKMWNSLVLNHRLSGRNSFKSASKFRAFSVKAAS  60

Query  286  ENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  465
            +N  VNR+E LL LD+TP TDKIIAEYIWIGGSG D RSKSRTIS+PV+    LPKWNYD
Sbjct  61   DNGVVNRLEDLLKLDLTPITDKIIAEYIWIGGSGTDLRSKSRTISRPVESALGLPKWNYD  120

Query  466  GSSTGQAPG  492
            GSSTGQAPG
Sbjct  121  GSSTGQAPG  129



>ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa]
 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Brassica napus]
 emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus]
 emb|CDX74644.1| BnaA04g07450D [Brassica napus]
Length=428

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 5/125 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+ AS   SK+W SVV+K  K+ + K  + F+V AL S+NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSKVRS-FKVMALQSDNST  56

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  478  GQAPG  492
            GQAPG
Sbjct  117  GQAPG  121



>ref|XP_008779349.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, 
partial [Phoenix dactylifera]
Length=259

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASP-MASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SEN  291
            MA +L PS Q +M I  +S +A P M +K W S++    +    KS++ F+V AL    N
Sbjct  1    MAHMLVPSMQCRMGITSNSIQARPIMTAKTWNSLLSNARRPKTKKSTSTFKVLALKSDNN  60

Query  292  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              V+R+E LLNLD+TP+TDKIIAEYIWIGG+GID RSK+RT+ +PV+HPSELPKWNYDGS
Sbjct  61   GAVSRLENLLNLDITPFTDKIIAEYIWIGGTGIDIRSKARTVPRPVEHPSELPKWNYDGS  120

Query  472  STGQAPG  492
            STGQAPG
Sbjct  121  STGQAPG  127



>ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
Length=426

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+ AS   SK+W SV++K  K+     S  FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVTKPSSIAS---SKLWSSVMLKQKKQ---SRSTSFRVMALQSDNST  54

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  55   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  114

Query  478  GQAPG  492
            GQAPG
Sbjct  115  GQAPG  119



>ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana]
 sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana]
 dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana]
 dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
(clone lambdaAtgsl1) [Arabidopsis thaliana]
 gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana]
 gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
[Arabidopsis thaliana]
 gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana]
 gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana]
 prf||1804333A Gln synthetase
Length=430

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIAS-SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis]
Length=428

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 5/125 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+ AS   SK+W SVV+K  ++ + K  + F+V AL S+NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKEQSSSKVRS-FKVMALQSDNST  56

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  478  GQAPG  492
            GQAPG
Sbjct  117  GQAPG  121



>gb|AAY33511.1| glutamine synthetase precursor, partial [Lotus japonicus]
Length=104

 Score =   147 bits (372),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILAPS QWQ RI K+S  ASP+ S MW S++ K NK+VA   ++KFRV A+ S+ ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVA--RASKFRVLAIKSDGST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQH  435
            +NR+E LLNLDVTPYTDK IAEYIWIGG+G+D RSKSRTISKPV H
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSH  104



>ref|XP_010938796.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Elaeis 
guineensis]
Length=434

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPM-ASKMWGSVVMKPNKRVAVKSSAKFRVFAL--SEN  291
            MA++L PS Q QM +  +S +A P+  +K W S+++   +    KS++ F+V AL    N
Sbjct  1    MARMLVPSMQCQMGMTSNSIQARPIITTKSWNSLLLNSQRPKTKKSTSTFKVLALKYDNN  60

Query  292  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
             TV+R+E LLN+D+TP+TDKIIAEYIWIGG+GID RSK RTI +PV+HPSELPKWNYDGS
Sbjct  61   GTVSRLENLLNMDITPFTDKIIAEYIWIGGTGIDIRSKPRTIPRPVEHPSELPKWNYDGS  120

Query  472  STGQAPG  492
            STGQAPG
Sbjct  121  STGQAPG  127



>emb|CAB72423.1| glutamine synthetase [Brassica napus]
Length=428

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+ AS   SK+W SVV+K  K+ + K  + F+V A+ S+NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSKVRS-FKVMAIQSDNST  56

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD  P+TD+IIAEYIW GGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWYGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  478  GQAPG  492
            GQAPG
Sbjct  117  GQAPG  121



>emb|CDY33684.1| BnaC04g29670D [Brassica napus]
Length=489

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = +1

Query  115  VNMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SEN  291
            + MAQILA S   QMR+ K S+ AS   SK+W SVV+K  K+ +      F+V AL S+N
Sbjct  59   IKMAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSSKVRSFKVMALQSDN  115

Query  292  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
            ST+NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGS
Sbjct  116  STINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGS  175

Query  472  STGQAPG  492
            STGQAPG
Sbjct  176  STGQAPG  182



>ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
 gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
Length=429

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 97/126 (77%), Gaps = 6/126 (5%)
 Frame = +1

Query  121  MAQILAPS-AQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  294
            MAQILA S    QMR+ K S   S + +K+W SVV+K  K+ + K    FRV AL S+NS
Sbjct  1    MAQILAASPTTCQMRVPKHS---SVITNKLWSSVVLKQKKQSSNKHRG-FRVLALQSDNS  56

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            TVNR+E LLNLD  PY+D+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSS
Sbjct  57   TVNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSS  116

Query  475  TGQAPG  492
            TGQAPG
Sbjct  117  TGQAPG  122



>emb|CDY49365.1| BnaA08g29950D [Brassica napus]
Length=394

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QM++ K S  AS   SK+W SV++K  K+ + K  + F+V AL S+NST
Sbjct  1    MAQILAASPTCQMKLTKPSPIAS---SKLWSSVMLKQKKQNSSKLRS-FKVMALQSDNST  56

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  478  GQAPG  492
            GQAPG
Sbjct  117  GQAPG  121



>ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica 
rapa]
Length=428

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QM++ K S  AS   SK+W SV++K  K+ + K    F+V AL S+NST
Sbjct  1    MAQILAASPTCQMKLTKPSPIAS---SKLWSSVMLKQKKQNSSKLRG-FKVMALQSDNST  56

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  478  GQAPG  492
            GQAPG
Sbjct  117  GQAPG  121



>emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus]
Length=428

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QM++ K S  AS   SK+W SV++K  K+ + K  + F+  AL S+NST
Sbjct  1    MAQILAASPTCQMKLTKPSPIAS---SKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNST  56

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +NR+E LLNLD  P+TD+IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  478  GQAPG  492
            GQAPG
Sbjct  117  GQAPG  121



>ref|XP_009391592.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391594.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPM-ASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  294
            MA+++    Q QM    +S +  PM  SKMW S+++   +    +  + F+V A+ SEN 
Sbjct  1    MAKMMVSPMQCQMGFPSNSLQGRPMITSKMWNSLLLNAQRPKTRRGISAFKVLAVKSENG  60

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
             V+R+E LLNLD TP+TDKIIAEYIWIGG+GID RSKSRTISKPV+H SELPKWNYDGSS
Sbjct  61   VVSRLEDLLNLDTTPFTDKIIAEYIWIGGTGIDIRSKSRTISKPVEHASELPKWNYDGSS  120

Query  475  TGQAPG  492
            TGQAPG
Sbjct  121  TGQAPG  126



>ref|XP_010435452.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X5 [Camelina sativa]
 ref|XP_010435453.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X6 [Camelina sativa]
 ref|XP_010440749.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
Length=418

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +1

Query  157  MRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENSTVNRMEQLLNLDV  333
            MR+ K S+ +S + +K+W SVV+K  K+ + K    FRVFAL S+NSTVNR+E LLNLD 
Sbjct  1    MRVPKHSS-SSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNSTVNRVETLLNLDT  58

Query  334  TPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPG  492
             PY+D+IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSSTGQAPG
Sbjct  59   KPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSSTGQAPG  111



>ref|XP_009417914.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417915.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPM-ASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  294
            MAQ++    Q Q+R    S +  PM  SKMW S+++   +    +S + F+V A+ S+N 
Sbjct  1    MAQMMVSPMQCQIRFPSKSLQGKPMITSKMWNSLLLNAQRFKTKRSVSAFKVLAVKSDNG  60

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
             V+R+E LL LD+ P+TDKIIAEYIWIGG+GID RSKSRTI++PV++PSELPKWNYDGSS
Sbjct  61   VVSRLEDLLKLDMAPFTDKIIAEYIWIGGTGIDIRSKSRTITRPVEYPSELPKWNYDGSS  120

Query  475  TGQAPG  492
            TGQAPG
Sbjct  121  TGQAPG  126



>emb|CDX84116.1| BnaC08g07930D [Brassica napus]
Length=247

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +1

Query  178  TEASPMAS-KMWGSVVMKPNKRVAVKSSAKFRVFAL-SENSTVNRMEQLLNLDVTPYTDK  351
            T+ SP+AS K+W SV++K  K+ + K  + F+  AL S+NST+NR+E LLNLD  P+TD+
Sbjct  4    TKPSPIASSKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNSTINRVESLLNLDTKPFTDR  62

Query  352  IIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPG  492
            IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSSTGQAPG
Sbjct  63   IIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSSTGQAPG  109



>ref|XP_003580719.1| PREDICTED: glutamine synthetase, chloroplastic [Brachypodium 
distachyon]
Length=430

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 92/129 (71%), Gaps = 11/129 (9%)
 Frame = +1

Query  121  MAQILAPSAQWQM-RIAKSSTEASPMAS--KMWGSVVMKPNKRVAVKSSAKFRVFALSEN  291
            MAQ + P+ Q QM  + KS+  A P A+  ++WG       +R   + ++ F+V AL   
Sbjct  1    MAQAVVPAMQCQMGALGKSAVRARPAAAGGRVWGV------RRSGARGTSGFKVLALGTE  54

Query  292  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  465
            +T  V R+EQLLN+D  PY+DKIIAEYIW+GGSGID RSKSRTISKPV  PSELPKWNYD
Sbjct  55   TTGVVPRLEQLLNMDTKPYSDKIIAEYIWVGGSGIDIRSKSRTISKPVADPSELPKWNYD  114

Query  466  GSSTGQAPG  492
            GSSTGQAPG
Sbjct  115  GSSTGQAPG  123



>gb|AFB69878.1| chloroplast glutamine synthetase isoform 2-1 [Secale cereale]
Length=427

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRLWGV-------RRTARATSGFKVLALGPETT  53

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  472  STGQAPG  492
            STGQAPG
Sbjct  114  STGQAPG  120



>gb|AAZ30061.1| plastid glutamine synthetase isoform GS2b [Triticum aestivum]
Length=427

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  472  STGQAPG  492
            STGQAPG
Sbjct  114  STGQAPG  120



>gb|AAZ30062.1| plastid glutamine synthetase isoform GS2c [Triticum aestivum]
 gb|AAZ80474.1| GS2 [Triticum aestivum]
 gb|ACT22493.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22495.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22498.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|AEH16638.1| glutamine synthetase [Triticum aestivum]
 gb|AEM42904.1| plastid glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|EMT11272.1| Glutamine synthetase leaf isozyme, chloroplastic [Aegilops tauschii]
Length=427

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  472  STGQAPG  492
            STGQAPG
Sbjct  114  STGQAPG  120



>gb|ACT22496.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22497.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  472  STGQAPG  492
            STGQAPG
Sbjct  114  STGQAPG  120



>gb|ACT22500.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F+V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  472  STGQAPG  492
            STGQAPG
Sbjct  114  STGQAPG  120



>ref|XP_004960149.1| PREDICTED: glutamine synthetase, chloroplastic-like [Setaria 
italica]
Length=428

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 91/129 (71%), Gaps = 13/129 (10%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMAS---KMWGSVVMKPNKRVAVKSSAKFRVFALSEN  291
            MAQ + P+ Q Q+  AK++  A P A    ++WG        R   + ++ F+V A+S  
Sbjct  1    MAQAVVPAMQCQVG-AKAAVRARPAAGAGGRVWGV-------RRTGRGTSGFKVMAISTA  52

Query  292  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  465
            ST  V R+EQ+LNLD  PYTDKIIAEYIW+GGSGID RSKSRTI KPV+ PSELPKWNYD
Sbjct  53   STGVVPRLEQMLNLDTKPYTDKIIAEYIWVGGSGIDLRSKSRTIEKPVEDPSELPKWNYD  112

Query  466  GSSTGQAPG  492
            GSSTGQAPG
Sbjct  113  GSSTGQAPG  121



>dbj|BAJ91545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ +  + Q Q+ +  +++  A   A ++WG        R A ++++ F+V AL   +T
Sbjct  9    MAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGPETT  61

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  62   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  121

Query  472  STGQAPG  492
            STGQAPG
Sbjct  122  STGQAPG  128



>dbj|BAJ95492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ +  + Q Q+ +  +++  A   A ++WG        R A ++++ F+V AL   +T
Sbjct  9    MAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGPETT  61

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  62   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  121

Query  472  STGQAPG  492
            STGQAPG
Sbjct  122  STGQAPG  128



>gb|AAZ30060.1| plastid glutamine synthetase isoform GS2a [Triticum aestivum]
Length=427

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 10/127 (8%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
            MAQ + P+ Q Q+ +  +S+  A   A ++WG        R   ++++ F V AL   +T
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFEVLALGPETT  53

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  472  STGQAPG  492
            STGQ PG
Sbjct  114  STGQPPG  120



>gb|KHN31946.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=190

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (70%), Gaps = 24/126 (19%)
 Frame = +1

Query  118  NMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENS  294
            NMAQILAPS QWQMRI+KSS  A+P+ S MWGS++ K NK+V++ SSAKFRV A+ S+NS
Sbjct  10   NMAQILAPSTQWQMRISKSSPNATPITSNMWGSLLWKQNKKVSLTSSAKFRVLAIKSDNS  69

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            T+NR+E L                    G+GID RSKSR    PV+ PS+LP+WNYDGSS
Sbjct  70   TINRLEGLR-------------------GTGIDVRSKSR----PVEDPSKLPRWNYDGSS  106

Query  475  TGQAPG  492
            TGQA G
Sbjct  107  TGQAQG  112



>emb|CAA34131.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 91/126 (72%), Gaps = 10/126 (8%)
 Frame = +1

Query  124  AQILAPSAQWQMRI-AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  297
            AQ +  + Q Q+ +  +++  A   A ++WG        R A ++++ F+V AL   +T 
Sbjct  1    AQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGPETTG  53

Query  298  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
             + RM+QLL++D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  54   VIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGSS  113

Query  475  TGQAPG  492
            TGQAPG
Sbjct  114  TGQAPG  119



>ref|NP_001241708.1| uncharacterized protein LOC100856886 [Zea mays]
 gb|ACF85271.1| unknown [Zea mays]
 gb|AFW59722.1| glutamine synthetase1 [Zea mays]
Length=380

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 12/126 (10%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  297
            MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST 
Sbjct  1    MAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  298  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
             V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  475  TGQAPG  492
            TGQAPG
Sbjct  111  TGQAPG  116



>dbj|BAG88835.1| unnamed protein product [Oryza sativa Japonica Group]
Length=322

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 11/128 (9%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKM--WGSVVMKPNKRVAVKSSAKFRVFALSENS  294
            MAQ + P+ Q Q+   ++   A+  A+    WG        R   + ++ FRV A+S  +
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  295  T--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  468
            T  V RMEQLLN+D TP+TDKIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  469  SSTGQAPG  492
            SSTGQAPG
Sbjct  114  SSTGQAPG  121



>ref|XP_008662331.1| PREDICTED: glutamine synthetase, chloroplastic isoform X1 [Zea 
mays]
 gb|ACF83467.1| unknown [Zea mays]
 gb|ACN27769.1| unknown [Zea mays]
 gb|ACF86733.2| unknown [Zea mays]
 gb|AFW59720.1| glutamine synthetase1 isoform 1 [Zea mays]
 gb|AFW59721.1| glutamine synthetase1 isoform 2 [Zea mays]
Length=423

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 12/126 (10%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  297
            MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST 
Sbjct  1    MAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  298  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
             V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  475  TGQAPG  492
            TGQAPG
Sbjct  111  TGQAPG  116



>ref|NP_001105725.1| glutamine synthetase, chloroplastic precursor [Zea mays]
 sp|P25462.1|GLNAC_MAIZE RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Zea mays]
 emb|CAA46724.1| glutamine synthetase [Zea mays]
Length=423

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 12/126 (10%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST-  297
            MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST 
Sbjct  1    MAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  298  -VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
             V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  475  TGQAPG  492
            TGQAPG
Sbjct  111  TGQAPG  116



>ref|XP_008662330.1| PREDICTED: glutamine synthetase, chloroplastic isoform X2 [Zea 
mays]
Length=512

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 12/127 (9%)
 Frame = +1

Query  118  NMAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST  297
             MAQ + P+ Q ++ +  +       A ++W +   +  +  A   S  F+V A+S  ST
Sbjct  89   GMAQAVVPAMQCRVGVKAA-------AGRVWSAGRTRTGRGGA---SPGFKVMAVSTGST  138

Query  298  --VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  139  GVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGS  198

Query  472  STGQAPG  492
            STGQAPG
Sbjct  199  STGQAPG  205



>gb|AAL87183.1|AF480497_11 putative precursor chloroplastic glutamine synthetase [Oryza 
sativa Japonica Group]
Length=451

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 11/128 (9%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKM--WGSVVMKPNKRVAVKSSAKFRVFALSENS  294
            MAQ + P+ Q Q+   ++   A+  A+    WG        R   + ++ FRV A+S  +
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  295  T--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  468
            T  V RMEQLLN+D TP+TDKIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  469  SSTGQAPG  492
            SSTGQAPG
Sbjct  114  SSTGQAPG  121



>ref|NP_001054133.1| Os04g0659100 [Oryza sativa Japonica Group]
 sp|P14655.1|GLNA2_ORYSJ RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=Glutamate--ammonia 
ligase; AltName: Full=OsGS2; Short=GS2; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAA32462.1| unnamed protein product [Oryza sativa]
 emb|CAE02885.2| OSJNBa0015K02.2 [Oryza sativa Japonica Group]
 emb|CAE54574.1| OSJNBa0011F23.15 [Oryza sativa Japonica Group]
 dbj|BAF16047.1| Os04g0659100 [Oryza sativa Japonica Group]
 emb|CAH67797.1| OSIGBa0132E09-OSIGBa0108L24.11 [Oryza sativa Indica Group]
 gb|EEC78171.1| hypothetical protein OsI_17756 [Oryza sativa Indica Group]
 gb|EEE61834.1| hypothetical protein OsJ_16481 [Oryza sativa Japonica Group]
Length=428

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 11/128 (9%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKM--WGSVVMKPNKRVAVKSSAKFRVFALSENS  294
            MAQ + P+ Q Q+   ++   A+  A+    WG        R   + ++ FRV A+S  +
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  295  T--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  468
            T  V RMEQLLN+D TP+TDKIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  469  SSTGQAPG  492
            SSTGQAPG
Sbjct  114  SSTGQAPG  121



>dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis]
 dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 92/129 (71%), Gaps = 12/129 (9%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI-AKSSTEASPMAS--KMWGSVVMKPNKRVAVKSSAKFRVFALSEN  291
            MAQ + P+ Q Q+    K++  A P  +  ++WG       KR   + ++ F+V A+S  
Sbjct  1    MAQPVVPAMQCQVGARGKAAVRARPAGAGGRVWGV------KRSG-RGTSGFKVMAVSTE  53

Query  292  ST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  465
            ST  V R+EQLLN+D  P+TDKIIAEYIW+GGSGID RSKSRT+SKPV+ PSELPKWNYD
Sbjct  54   STGVVPRLEQLLNMDTKPFTDKIIAEYIWVGGSGIDLRSKSRTLSKPVEDPSELPKWNYD  113

Query  466  GSSTGQAPG  492
            GSSTGQAPG
Sbjct  114  GSSTGQAPG  122



>prf||1804333B Gln synthetase
Length=430

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+N +
Sbjct  1    MAQILAASPTCQMRVPKHSSVIAS-SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNMS  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +N  E LLNL  + Y D+IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LNSDEILLNLSDSTYKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>sp|P13564.2|GLNA2_HORVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA37643.1| unnamed protein product [Hordeum vulgare]
Length=434

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 7/96 (7%)
 Frame = +1

Query  226  KPNKRV-----AVKSSAKFRVFALSENST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGS  384
            +P  RV     A ++++ F+V AL   +T  + RM+QLL++D TP+TDKIIAEYIW+GGS
Sbjct  32   QPAGRVWGVSRAARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGS  91

Query  385  GIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPG  492
            GID RSKSRTISKPV+ PSELPKWNYDGSSTGQAPG
Sbjct  92   GIDLRSKSRTISKPVEDPSELPKWNYDGSSTGQAPG  127



>gb|EMS53309.1| Glutamine synthetase leaf isozyme, chloroplastic [Triticum urartu]
Length=535

 Score =   130 bits (327),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 66/116 (57%), Positives = 82/116 (71%), Gaps = 9/116 (8%)
 Frame = +1

Query  151  WQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENST--VNRMEQLLN  324
            W      S+  A   A ++WG        R   ++++ F+V AL   +T  + RM+QLL+
Sbjct  4    WVGVRGSSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETTGVIQRMQQLLD  56

Query  325  LDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPG  492
            +D TP+TDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSSTGQAPG
Sbjct  57   MDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGSSTGQAPG  112



>gb|EPS57543.1| glutamine synthetase, partial [Genlisea aurea]
Length=222

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            VNR+++LLN D+TPYTD IIAEYIWIGGSGID RSKSRTISKPVQHPSELPKWNYDGSST
Sbjct  1    VNRLDKLLNSDLTPYTDNIIAEYIWIGGSGIDIRSKSRTISKPVQHPSELPKWNYDGSST  60

Query  478  GQAPG  492
            GQAPG
Sbjct  61   GQAPG  65



>dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 12/129 (9%)
 Frame = +1

Query  121  MAQILAPSAQWQMRI---AKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL--S  285
            MAQ + P+ Q Q+ +    ++   A+    ++WG        R + + ++ F+V A+  S
Sbjct  1    MAQAVVPAMQCQVGVKAAVRARPAAAGAGGRVWGV-------RRSGRGTSGFKVMAMGMS  53

Query  286  ENSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  465
             +  V R+EQLLN+D  PYTD IIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYD
Sbjct  54   TSGVVPRLEQLLNMDTKPYTDNIIAEYIWVGGSGIDVRSKSRTISKPVEDPSELPKWNYD  113

Query  466  GSSTGQAPG  492
            GSSTGQAPG
Sbjct  114  GSSTGQAPG  122



>prf||1804333C Gln synthetase
Length=430

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+N +
Sbjct  1    MAQILAASPTCQMRVPKHSSVIA-SSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNMS  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +   E LLN+   P  D+IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LLADEVLLNISDNPEKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  118

Query  478  GQAPG  492
            GQAPG
Sbjct  119  GQAPG  123



>emb|CAA29057.1| gluthamine synthetase [Pisum sativum]
Length=373

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +1

Query  295  TVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  474
            T+NR+E LLNLD+TP+TD IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDGSS
Sbjct  1    TINRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDGSS  60

Query  475  TGQAPG  492
            TGQAPG
Sbjct  61   TGQAPG  66



>prf||1804333D Gln synthetase
Length=430

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  121  MAQILAPSAQWQMRIAKSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFAL-SENST  297
            MAQILA S   QMR+ K S+  +  +SK+W SVV+K  K+   K    FRV AL S+NST
Sbjct  1    MAQILAASPTCQMRVPKHSSVIAS-SSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            +   E LLNL      D+IIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LLSDEVLLNLTDATGKDRIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSST  118

Query  478  GQAPG  492
            GQA G
Sbjct  119  GQAAG  123



>gb|ACG35376.1| glutamine synthetase [Zea mays]
Length=427

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +1

Query  259  AKFRVFALSENST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQ  432
            A  +   LS  ST  V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+
Sbjct  41   AGVQGHGLSTGSTGVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVE  100

Query  433  HPSELPKWNYDGSSTGQAPG  492
             PSELPKWNYDGSSTGQAPG
Sbjct  101  DPSELPKWNYDGSSTGQAPG  120



>ref|XP_006653841.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase, chloroplastic-like 
[Oryza brachyantha]
Length=410

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  292  STVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  471
              V R+EQLLN+D  PYTDKIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  37   GVVTRLEQLLNMDTKPYTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  96

Query  472  STGQAPG  492
            STGQAPG
Sbjct  97   STGQAPG  103



>gb|ACG31728.1| hypothetical protein [Zea mays]
Length=382

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = +1

Query  274  FALSENST--VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSEL  447
             A+S  ST  V R+EQLLN+D TPYTDK+IAEYIW+GGSGID RSKSRTISKPV+ PSEL
Sbjct  1    MAVSTGSTGXVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSEL  60

Query  448  PKWNYDGSSTGQAP  489
            PKWNYDGSSTGQAP
Sbjct  61   PKWNYDGSSTGQAP  74



>gb|AHJ10962.1| chloroplast glutamine synthetase 2 isoform 2 [Lemna minor]
Length=424

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = +1

Query  124  AQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            AQI APS + +  IA + S   +P+     GS   +    V  +  +  R    + N+ V
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRGFS-VRAVLGNRNNAV  61

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            +R+E LLNLD+ P+T+KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDGSSTG
Sbjct  62   SRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDGSSTG  121

Query  481  QAPG  492
            QAPG
Sbjct  122  QAPG  125



>gb|AHJ10961.1| chloroplast glutamine synthetase 2 isoform 1 [Lemna minor]
Length=424

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = +1

Query  124  AQILAPSAQWQMRIA-KSSTEASPMASKMWGSVVMKPNKRVAVKSSAKFRVFALSENSTV  300
            AQI APS + +  IA + S   +P+     GS   +    V  +  +  R    + N+ V
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRGFS-VRAVLGNRNNAV  61

Query  301  NRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTG  480
            +R+E LLNLD+ P+T+KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDGSSTG
Sbjct  62   SRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDGSSTG  121

Query  481  QAPG  492
            QAPG
Sbjct  122  QAPG  125



>gb|AFW89160.1| glutamine synthetase3 isoform 1 [Zea mays]
 gb|AFW89161.1| glutamine synthetase3 isoform 2 [Zea mays]
Length=88

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++ YT+KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDYTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAP33476.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=98

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSSTG+A
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGRA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010492570.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X2 [Camelina sativa]
Length=272

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010420355.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X2 [Camelina sativa]
Length=355

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P23712.2|GLNA_LACSA RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Lactuca sativa]
 emb|CAA42689.1| glutamine synthetase [Lactuca sativa]
Length=358

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLVNLDLSSITDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010453820.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Camelina 
sativa]
Length=356

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|EYU24513.1| hypothetical protein MIMGU_mgv1a008973mg [Erythranthe guttata]
Length=356

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+K IAEYIWIGGSG+D RSK+RT S P++HPSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDTTEKTIAEYIWIGGSGMDLRSKARTFSGPIKHPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_004162638.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
Length=356

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD+  +TDKIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|KGN51032.1| Glutamine synthetase [Cucumis sativus]
Length=356

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD+  +TDKIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_004140309.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
Length=368

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD+  +TDKIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010435596.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X2 [Camelina sativa]
Length=276

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  478  GQAPG  492
            GQAPG
Sbjct  61   GQAPG  65



>gb|AHJ10959.1| cytosolic glutamine synthetase 1 isoform 1 [Lemna minor]
Length=356

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L NL++T  T+KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDGSSTGQA
Sbjct  4    LADLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_002465624.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
 emb|CAQ86599.1| glutamine synthetase [Sorghum bicolor]
 gb|EER92622.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
Length=357

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TDKIIAEYIWIGGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AHJ10960.1| cytosolic glutamine synthetase 1 isoform 2 [Lemna minor]
Length=356

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L NL++T  T+KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDGSSTGQA
Sbjct  4    LTDLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|ACN36710.1| unknown [Zea mays]
Length=217

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T++IIAEYIWIGGSGID RSK+RT++ PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTNQIIAEYIWIGGSGIDMRSKARTLAGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_002873784.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50043.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAW21274.1| glutamine synthetase [Saccharum officinarum]
Length=357

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TDKIIAEYIWIGGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010435595.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  478  GQAPG  492
            GQAPG
Sbjct  61   GQAPG  65



>ref|XP_010440874.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Camelina 
sativa]
Length=356

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  478  GQAPG  492
            GQAPG
Sbjct  61   GQAPG  65



>sp|O04867.1|GLNA1_ALNGL RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Alnus glutinosa]
 emb|CAA69937.1| glutamate synthetase [Alnus glutinosa]
Length=356

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDK+IAEYIWIGGSG D RSK+RT++ PV HPS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDATDKVIAEYIWIGGSGTDLRSKARTLTGPVNHPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P38563.2|GLNA5_MAIZE RecName: Full=Glutamine synthetase root isozyme 5; AltName: Full=GS117; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
Length=357

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TDKIIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010419001.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like, partial 
[Camelina sativa]
Length=163

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_009121474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 [Brassica 
rapa]
Length=356

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_009800983.1| PREDICTED: glutamine synthetase-like [Nicotiana sylvestris]
Length=356

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL++T  TDKIIAEYIWIGGSG+D RSK+R++S PV+ PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLTESTDKIIAEYIWIGGSGMDLRSKARSLSGPVEDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_009629012.1| PREDICTED: glutamine synthetase-like [Nicotiana tomentosiformis]
Length=356

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL++T  T+KIIAEYIWIGGSG+D RSK+RT+S PV+ PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLTESTEKIIAEYIWIGGSGMDLRSKARTLSGPVKDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>tpg|DAA44141.1| TPA: glutamine synthetase6 [Zea mays]
Length=363

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  289  NSTVNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  468
             S +  +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    GSVMASLTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDG  63

Query  469  SSTGQAPG  492
            SSTGQAPG
Sbjct  64   SSTGQAPG  71



>ref|XP_009385541.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AGC24244.1| glutamine synthetase 1, partial [Brassica napus]
Length=137

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  328  DVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPG  492
            D++ YT+KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQAPG
Sbjct  4    DLSDYTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPG  58



>ref|XP_008460506.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
melo]
Length=356

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL++  +TDKIIAEYIW+GGSG D RSK+RTIS P   PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLCDFTDKIIAEYIWVGGSGTDVRSKARTISGPTSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|NP_001105297.1| glutamine synthetase root isozyme 5 [Zea mays]
 dbj|BAA03432.1| glutamine synthetase [Zea mays]
Length=357

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|ACG47508.1| glutamine synthetase root isozyme 5 [Zea mays]
Length=357

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAG27625.1| putative glutamine synthetase [Populus x canadensis]
Length=72

 Score = 94.4 bits (233),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+N++++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  P++LPKWNYDGSSTGQA
Sbjct  4    LNDLININLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>tpg|DAA44139.1| TPA: glutamine synthetase6 [Zea mays]
Length=362

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|KJB10478.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
 gb|KJB10480.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=259

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|NP_001105538.1| glutamine synthetase root isozyme 1 [Zea mays]
 dbj|BAA03433.1| glutamine synthetase [Zea mays]
 gb|ACF84604.1| unknown [Zea mays]
 tpg|DAA44140.1| TPA: glutamine synthetase6 [Zea mays]
Length=357

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AFK46766.1| unknown [Medicago truncatula]
Length=211

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|KDP25795.1| hypothetical protein JCGZ_22517 [Jatropha curcas]
Length=356

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|KJB10479.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=309

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTDKIIAEYIWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_003544980.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Glycine 
max]
 sp|O82560.1|GLNA2_SOYBN RecName: Full=Glutamine synthetase cytosolic isozyme 2; AltName: 
Full=GS1-2; AltName: Full=Glutamate--ammonia ligase [Glycine 
max]
 gb|AAC97935.1| nodule-specific glutamine synthetase [Glycine max]
 gb|KHN39471.1| Glutamine synthetase cytosolic isozyme 2 [Glycine soja]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDK+IAEYIW+GGSG+D RSK+RT+S PV+ PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDITDKVIAEYIWVGGSGMDMRSKARTLSGPVKDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AFW90613.1| glutamine synthetase GS1 [Solanum tuberosum]
Length=256

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  304  RMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  483
             +  L+NL+++  +DKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSSDKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  484  APG  492
            APG
Sbjct  63   APG  65



>gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum]
 gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDSTDKIIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CCO25538.1| glutamine synthetase [Pinus pinaster]
Length=355

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDVTEKIIAEYIWIGGSGMDIRSKARTLSHPVTDPKDLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypium arboreum]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum]
 gb|ABW89465.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|ABW89463.1| glutamine synthetase [Gossypium raimondii]
 gb|KJB10477.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=356

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CDY38104.1| BnaC02g06690D [Brassica napus]
Length=356

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  ++KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_009126124.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Brassica 
rapa]
Length=356

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  ++KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AGC24239.1| glutamine synthetase 1 [Brassica napus]
 emb|CDX85499.1| BnaA02g03140D [Brassica napus]
Length=356

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  ++KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|NP_568335.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
 sp|Q9FMD9.1|GLN14_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-4; AltName: 
Full=Glutamate--ammonia ligase GLN1;4; Short=GLN1;4 [Arabidopsis 
thaliana]
 dbj|BAB10184.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL24414.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAM91149.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED92312.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
Length=356

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>dbj|BAA04996.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_006284008.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
 gb|EOA16906.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
Length=356

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  298  VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  477
            ++ +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSST
Sbjct  1    MSNLSDLINLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSELPKWNYDGSST  60

Query  478  GQAPG  492
            GQAPG
Sbjct  61   GQAPG  65



>gb|AGT16433.1| glutamine synthetase [Saccharum hybrid cultivar R570]
Length=367

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DGSSTGQA
Sbjct  4    LSDLINLDLSDCTEKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAW21275.1| glutamine synthetase [Saccharum officinarum]
Length=367

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DGSSTGQA
Sbjct  4    LSDLINLDLSDCTEKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAJ87510.1| putative glutamine synthetase [Pisum sativum]
Length=356

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D R K+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSGTTEKIIAEYIWIGGSGLDLRCKARTLPGPVTDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P08282.2|GLNA1_PEA RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Cytosolic 
GS1; AltName: Full=Glutamate--ammonia ligase [Pisum 
sativum]
 gb|AAA33669.1| glutamine synthetase (cytosolic GS1) (EC 6.3.1.2) [Pisum sativum]
Length=355

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D R K+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  3    LSDLINLDLSGTTEKIIAEYIWIGGSGLDLRCKARTLPGPVTDPSELPKWNYDGSSTGQA  62

Query  487  PG  492
            PG
Sbjct  63   PG  64



>ref|XP_009785976.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana sylvestris]
Length=356

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDSTEKIIAEYIWVGGSGMDIRSKGRTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P04770.1|GLNA1_PHAVU RecName: Full=Glutamine synthetase PR-1; AltName: Full=Gln isozyme 
beta; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA27631.1| unnamed protein product [Phaseolus vulgaris]
 prf||1208270A synthetase R1,Gln
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  T+K+IAEYIWIGGSG+D RSK+RT+  PV++PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKVIAEYIWIGGSGLDLRSKARTLPGPVKNPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_009785977.1| PREDICTED: glutamine synthetase isoform X2 [Nicotiana sylvestris]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAA71317.1| glutamine synthetase [Medicago truncatula]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P04078.1|GLNA1_MEDSA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=Glutamate--ammonia ligase [Medicago sativa]
 emb|CAA27570.1| glutamine synthetase [Medicago sativa]
 prf||1211328A synthetase,Gln
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAA63963.1| glutamate synthetase [Lotus japonicus]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_003600702.1| Glutamine synthetase [Medicago truncatula]
 gb|AES70953.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010415162.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
 ref|XP_010415163.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAG40238.2|AF302115_1 glutamine synthetase GS1 [Solanum tuberosum]
Length=357

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  304  RMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  483
             +  L+NL+++  +DKIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSSDKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  484  APG  492
            APG
Sbjct  63   APG  65



>ref|XP_010470493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010415164.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X3 [Camelina sativa]
Length=276

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAA58118.1| glutamate--ammonia ligase [Brassica napus]
 emb|CDX74573.1| BnaA04g08160D [Brassica napus]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P14636.1|GLNA3_LUPAN RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Glutamate--ammonia 
ligase, partial [Lupinus angustifolius]
 emb|CAA33605.1| unnamed protein product [Lupinus angustifolius]
Length=315

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWVGGSGVDLRSKARTLSGPVNDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_006300523.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
 gb|EOA33421.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010511548.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 [Camelina 
sativa]
Length=356

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CDY01727.1| BnaC04g30250D [Brassica napus]
Length=349

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010470494.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=275

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAR86718.1| glutamine synthetase GS56 [Nicotiana attenuata]
Length=356

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  304  RMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  483
             +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RTIS PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSTQKIIAEYIWIGGSGMDVRSKARTISGPVDDPSKLPKWNYDGSSTGQ  62

Query  484  APG  492
            APG
Sbjct  63   APG  65



>gb|AAK49029.1| cytosolic glutamine synthetase [Populus tremula x Populus alba]
Length=356

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL ++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSSTGQA
Sbjct  4    LTDLINLKLSDITDKIIAEYIWIGGSGMDMRSKARTLSGPVTDPAQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_011085871.1| PREDICTED: glutamine synthetase cytosolic isozyme [Sesamum indicum]
Length=356

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEY+WIGGSG+D RSK+RT++ PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSESTDKIIAEYVWIGGSGMDLRSKARTLAGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSSTG+A
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGRA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAN68162.1| hypothetical protein VITISV_015673 [Vitis vinifera]
Length=356

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDATDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPHKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P52782.1|GLNA_LUPLU RecName: Full=Glutamine synthetase nodule isozyme; Short=GS; 
AltName: Full=Glutamate--ammonia ligase [Lupinus luteus]
 emb|CAA50522.1| glutamate-ammonia ligase [Lupinus luteus]
 prf||2004276A Gln synthetase
Length=353

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWVGGSGVDLRSKARTLSGPVNDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_006647853.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Oryza 
brachyantha]
Length=356

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RTIS PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AJD14835.1| glutamine synthetase [Boehmeria nivea]
Length=356

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTDKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010940335.1| PREDICTED: glutamine synthetase nodule isozyme-like [Elaeis guineensis]
Length=356

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +E L+N++++  T+KIIAEY+WIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LEDLVNINLSDTTEKIIAEYVWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_009139734.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Brassica 
rapa]
Length=356

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDK+IAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKVIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_010909363.1| PREDICTED: glutamine synthetase nodule isozyme [Elaeis guineensis]
Length=356

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_007032111.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
 gb|EOY03037.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
Length=356

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLSDCTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAD28469.1|AF130882_1 glutamine synthetase [Sandersonia aurantiaca]
Length=185

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL++T  T+KIIAEYIWIGG+G+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLTDTTEKIIAEYIWIGGTGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AAT46062.1| glutamine synthetase GS2 [Apium graveolens Dulce Group]
Length=150

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  352  IIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPG  492
             IAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDGSSTGQAPG
Sbjct  5    FIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPG  51



>ref|XP_009414782.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like [Musa 
acuminata subsp. malaccensis]
Length=357

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++ YT+KIIAEYIW+GGSG D RSK+RT+S PV  PS+LP WNYDGSSTGQA
Sbjct  4    LTDLINLNLSDYTEKIIAEYIWVGGSGEDIRSKARTLSGPVTDPSQLPNWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAA73366.1| glutamine synthetase [Lotus japonicus]
Length=356

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D R+K+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDMRTKARTLPGPVSDPSQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>gb|AFN42876.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  T+K+IAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDTTEKVIAEYIWIGGSGMDLRSKARTLSGPVSDPKKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_004299511.1| PREDICTED: glutamine synthetase cytosolic isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDITDKIIAEYIWVGGSGMDVRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>sp|P38559.1|GLNA1_MAIZE RecName: Full=Glutamine synthetase root isozyme 1; AltName: Full=GS122; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
 emb|CAA46719.1| glutamine synthetase [Zea mays]
Length=357

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NLD++  TD+IIAEYIWIGG+GID RSK+RT+  P+  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPIQLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_004503122.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cicer arietinum]
Length=355

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  ++KIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNISESSEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>ref|XP_008812466.1| PREDICTED: glutamine synthetase nodule isozyme [Phoenix dactylifera]
Length=356

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  307  MEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  486
            +  L+NL+++  TDKIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLSETTDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  487  PG  492
            PG
Sbjct  64   PG  65



>emb|CAA65173.1| glutamine synthetase [Nicotiana tabacum]
Length=356

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  304  RMEQLLNLDVTPYTDKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  483
             +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  484  APG  492
            APG
Sbjct  63   APG  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780