BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014K10

Length=414
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769985.1|  PREDICTED: uncharacterized protein LOC104220752  84.7    9e-17   Nicotiana sylvestris
ref|XP_009594216.1|  PREDICTED: uncharacterized protein LOC104090749  77.8    4e-14   Nicotiana tomentosiformis
ref|XP_006360143.1|  PREDICTED: uncharacterized protein LOC102590255  69.3    4e-11   Solanum tuberosum [potatoes]
emb|CDP05871.1|  unnamed protein product                              60.8    3e-08   Coffea canephora [robusta coffee]
ref|XP_010545803.1|  PREDICTED: uncharacterized protein LOC104818056  58.5    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_004244201.1|  PREDICTED: uncharacterized protein LOC101247444  58.2    3e-07   Solanum lycopersicum
ref|XP_010644223.1|  PREDICTED: uncharacterized protein LOC100253...  53.9    6e-06   Vitis vinifera
ref|XP_002284644.1|  PREDICTED: mpv17-like protein isoform X1         53.9    7e-06   Vitis vinifera
ref|XP_008363403.1|  PREDICTED: beta-glucosidase 13-like              52.8    2e-05   
ref|XP_010092169.1|  Peroxisomal membrane protein 2                   51.2    6e-05   
ref|XP_010268765.1|  PREDICTED: uncharacterized protein LOC104605628  50.8    7e-05   Nelumbo nucifera [Indian lotus]
gb|KJB62714.1|  hypothetical protein B456_009G432500                  48.5    4e-04   Gossypium raimondii
gb|KDP38924.1|  hypothetical protein JCGZ_00681                       48.5    5e-04   Jatropha curcas
ref|XP_008366686.1|  PREDICTED: uncharacterized protein LOC103430324  47.4    0.001   Malus domestica [apple tree]



>ref|XP_009769985.1| PREDICTED: uncharacterized protein LOC104220752 [Nicotiana sylvestris]
Length=375

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 11/98 (11%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  271
            MATINGL +PQ   SLSKP PK  S SHFKP K Q+  + + +Q           + A E
Sbjct  1    MATINGLTSPQPFLSLSKPKPKP-SYSHFKPLKPQILSKGLKQQNQQLRDWAVVGSVANE  59

Query  272  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIVNQ  385
             D+IPVQS+D+TDQQ GVV   ERE E GGD+D +VNQ
Sbjct  60   TDLIPVQSNDTTDQQSGVVIGLEREPE-GGDMD-LVNQ  95



>ref|XP_009594216.1| PREDICTED: uncharacterized protein LOC104090749 [Nicotiana tomentosiformis]
Length=375

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 62/98 (63%), Gaps = 11/98 (11%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  271
            M+TINGL +PQ   SL KP P   S SHFKP K ++  + + +Q          ++ A E
Sbjct  1    MSTINGLTSPQPFLSLPKPKPNP-SYSHFKPLKPRILSKGLKQQNQQLRDWAVVSSVANE  59

Query  272  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIVNQ  385
             D+IPVQS+D+TDQQ GVV   ERE E GGD+D +VNQ
Sbjct  60   TDLIPVQSNDTTDQQSGVVIGLEREPE-GGDMD-LVNQ  95



>ref|XP_006360143.1| PREDICTED: uncharacterized protein LOC102590255 [Solanum tuberosum]
Length=371

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 56/99 (57%), Gaps = 11/99 (11%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  271
            MATINGL +PQ   SL K N K    S  KP K Q   + + +Q           +   E
Sbjct  1    MATINGLTSPQPFLSLQKSNSKP-FLSLSKPMKSQFLFKGLKQQNQQLRDWVVVGSVTNE  59

Query  272  LDVIPVQSSDSTDQQGGVVDATEREAE-GGGDIDSIVNQ  385
             DVIPVQS+D TDQQ GVV   ERE E GGG++D IVNQ
Sbjct  60   ADVIPVQSTDVTDQQNGVVIGLEREPELGGGEMD-IVNQ  97



>emb|CDP05871.1| unnamed protein product [Coffea canephora]
Length=384

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 56/104 (54%), Gaps = 17/104 (16%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT-KLQLFPRPV----------SKQFAAAA  262
            MA+IN L TPQT  SL  P PK+      KPT K+Q FP P           S     + 
Sbjct  1    MASINSLTTPQTFLSL--PKPKSSLCFQPKPTSKIQSFPHPFNLLLSKHHKDSSFIVGSV  58

Query  263  AKELDVIPVQSSDSTDQQGGVVDA-TEREAEG--GGDI-DSIVN  382
            + E D+IPVQSSD TDQQ GV+    E E EG  G DI + +VN
Sbjct  59   SNEPDIIPVQSSDYTDQQDGVLGGIVEIETEGLSGEDILNQVVN  102



>ref|XP_010545803.1| PREDICTED: uncharacterized protein LOC104818056 [Tarenaya hassleriana]
Length=377

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 9/89 (10%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKP------NPKTGSPSHFKPTKLQLFPR--PVSKQFAAAAAKE  271
            MA+++   +P++L SLSKP      +P   SP+  KP + Q+FPR   +S+   A    E
Sbjct  1    MASLHTSISPRSLLSLSKPRKPTSISPPVFSPAAQKPPRTQVFPRNKQISRVPYAVVRDE  60

Query  272  LDVIPVQSSDSTDQQGGVVDA-TEREAEG  355
            LDVIPVQS D TDQQ GVV    E E EG
Sbjct  61   LDVIPVQSGDRTDQQEGVVVVGGEAEREG  89



>ref|XP_004244201.1| PREDICTED: uncharacterized protein LOC101247444 [Solanum lycopersicum]
Length=376

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  271
            MATINGL +P    SL K N K    S  KP K Q   + + +Q           + + E
Sbjct  1    MATINGLTSPHPFLSLQKSNSKP-FLSLSKPMKSQFLFKGLKQQNQQLRDWAVVGSVSNE  59

Query  272  LDVIPVQSSDSTDQQGGVVDATEREAE-GGGDIDSIVNQ  385
             D I VQSSD  DQQ GVV   ERE + GGGD+  IVNQ
Sbjct  60   ADEIRVQSSDVMDQQNGVVIGLEREPKLGGGDM-GIVNQ  97



>ref|XP_010644223.1| PREDICTED: uncharacterized protein LOC100253839 isoform X2 [Vitis 
vinifera]
Length=370

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
 Frame = +2

Query  164  SKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATER  343
            SKP P    P    P    +F     K++  A A+ELDVIPVQSSDSTDQQ GV+   E 
Sbjct  20   SKPRPTIFLPKGL-PQTSGIFSGTNRKRWVVAVAEELDVIPVQSSDSTDQQDGVLARIEV  78

Query  344  EAEGGGDIDSIVNQ  385
            E EG      +VNQ
Sbjct  79   EEEG-----ELVNQ  87



>ref|XP_002284644.1| PREDICTED: mpv17-like protein isoform X1 [Vitis vinifera]
Length=371

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 6/74 (8%)
 Frame = +2

Query  164  SKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATER  343
            SKP P    P    P    +F     K++  A A+ELDVIPVQSSDSTDQQ GV+   E 
Sbjct  20   SKPRPTIFLPKGL-PQTSGIFSGTNRKRWVVAVAEELDVIPVQSSDSTDQQDGVLARIEV  78

Query  344  EAEGGGDIDSIVNQ  385
            E EG      +VNQ
Sbjct  79   EEEG-----ELVNQ  87



>ref|XP_008363403.1| PREDICTED: beta-glucosidase 13-like [Malus domestica]
Length=649

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 54/100 (54%), Gaps = 13/100 (13%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR----PVSKQ------FAAAAA  265
            MA I+ +   Q+  SL  P P+    +H KP      P+    P +KQ       +A   
Sbjct  18   MAAIHSIAA-QSFLSLPNPKPRKRIAAHPKPILTSKLPKNPTFPRNKQKGRRVLNSAVKR  76

Query  266  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIVNQ  385
            +E DVIPVQSSDSTDQQ GVV A+  E+E  GD   +V+Q
Sbjct  77   EECDVIPVQSSDSTDQQEGVV-ASRVESE-AGDQGELVSQ  114



>ref|XP_010092169.1| Peroxisomal membrane protein 2 [Morus notabilis]
 gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis]
Length=393

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 19/94 (20%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKL--------QLFPRPVSK----QFAAA  259
            MA++N +  PQ+  S+SKP PK   P++  P  +         +F R   K       + 
Sbjct  1    MASVNTI-APQSFLSISKPKPK---PTNAYPKSIPCSNFPNHSIFSRNKQKVKGWALNSV  56

Query  260  AAKELDVIPVQSSDSTDQQGGVVDATEREAEGGG  361
              +ELDVIPVQSSD TDQQ GVV +     EGGG
Sbjct  57   VNEELDVIPVQSSDGTDQQEGVVVS---RVEGGG  87



>ref|XP_010268765.1| PREDICTED: uncharacterized protein LOC104605628 [Nelumbo nucifera]
Length=386

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +2

Query  149  TLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVV  328
            T++ LS  + +    +H K        R  +     + A+ELDVIPV+SSDSTDQQ GVV
Sbjct  29   TVKGLSGSSLQNSCKAH-KSGNSGFLRRKRTDWVVLSVAEELDVIPVRSSDSTDQQDGVV  87

Query  329  DATEREAEG  355
               ERE EG
Sbjct  88   ARIEREREG  96



>gb|KJB62714.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=418

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 47/95 (49%), Gaps = 14/95 (15%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  256
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  257  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGG  358
            + A+ELDVIPVQS D TD Q GV V    RE+ GG
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGG  95



>gb|KDP38924.1| hypothetical protein JCGZ_00681 [Jatropha curcas]
Length=375

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSK---PNPKTGSPSHFKPTKLQLFP-------RPVSKQFAAAAA  265
            MA+++ + +P +L  LSK   P  K    SHF  TK+   P       +  S    +   
Sbjct  1    MASLHTI-SPHSLLPLSKSKKPTSKILPNSHFLGTKILHSPIFWTNKQKTESWLLNSVVQ  59

Query  266  KELDVIPVQSSDSTDQQGGVVDATEREAEG  355
            +ELDVIPVQS DSTDQQ GVV  ++ E+EG
Sbjct  60   EELDVIPVQSGDSTDQQDGVV-VSQVESEG  88



>ref|XP_008366686.1| PREDICTED: uncharacterized protein LOC103430324 [Malus domestica]
Length=374

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 13/100 (13%)
 Frame = +2

Query  116  MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR----PVSKQ------FAAAAA  265
            MA I+ +   Q+  SL  P P+    +H KP      P+    P +KQ       +A   
Sbjct  1    MAAIHSIAA-QSFLSLPNPKPRKPIAAHPKPILTSKLPKNPTFPRNKQKSRWVLNSAVER  59

Query  266  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIVNQ  385
            +E DVIPV SSD TDQQ GVV A+  E+E GGD   +V+Q
Sbjct  60   EECDVIPVHSSDRTDQQEGVV-ASRVESE-GGDQGELVSQ  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875