BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014I14

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002273367.1|  PREDICTED: glycerol kinase                         302   6e-97   Vitis vinifera
ref|XP_007023295.1|  Actin-like ATPase superfamily protein isoform 2    298   3e-96   
ref|XP_007023296.1|  Actin-like ATPase superfamily protein isoform 3    298   3e-96   
ref|XP_010250262.1|  PREDICTED: glycerol kinase-like                    300   6e-96   Nelumbo nucifera [Indian lotus]
emb|CAN76048.1|  hypothetical protein VITISV_037711                     300   6e-96   Vitis vinifera
ref|XP_007023294.1|  Actin-like ATPase superfamily protein isoform 1    298   2e-95   
emb|CDO98178.1|  unnamed protein product                                297   5e-95   Coffea canephora [robusta coffee]
ref|XP_009593517.1|  PREDICTED: glycerol kinase                         295   3e-94   Nicotiana tomentosiformis
ref|XP_009758692.1|  PREDICTED: glycerol kinase                         295   3e-94   Nicotiana sylvestris
ref|XP_006341400.1|  PREDICTED: glycerol kinase-like                    295   4e-94   Solanum tuberosum [potatoes]
ref|XP_002517681.1|  glycerol kinase, putative                          293   1e-93   Ricinus communis
ref|XP_004235901.1|  PREDICTED: glycerol kinase                         293   2e-93   Solanum lycopersicum
ref|XP_011073388.1|  PREDICTED: glycerol kinase-like                    293   2e-93   Sesamum indicum [beniseed]
ref|XP_008228677.1|  PREDICTED: glycerol kinase                         293   3e-93   Prunus mume [ume]
ref|XP_007215813.1|  hypothetical protein PRUPE_ppa004097mg             293   3e-93   
gb|EYU21675.1|  hypothetical protein MIMGU_mgv1a019703mg                292   4e-93   Erythranthe guttata [common monkey flower]
gb|KDP37048.1|  hypothetical protein JCGZ_06104                         291   1e-92   Jatropha curcas
ref|XP_008461141.1|  PREDICTED: glycerol kinase                         290   2e-92   Cucumis melo [Oriental melon]
ref|XP_009334628.1|  PREDICTED: glycerol kinase-like                    290   7e-92   Pyrus x bretschneideri [bai li]
ref|XP_010033977.1|  PREDICTED: glycerol kinase-like                    289   7e-92   
ref|XP_006492058.1|  PREDICTED: glycerol kinase-like                    289   7e-92   Citrus sinensis [apfelsine]
ref|XP_010063499.1|  PREDICTED: glycerol kinase                         289   9e-92   Eucalyptus grandis [rose gum]
gb|KEH28675.1|  glycerol kinase-like protein                            288   1e-91   Medicago truncatula
ref|XP_009336317.1|  PREDICTED: glycerol kinase-like                    289   1e-91   Pyrus x bretschneideri [bai li]
ref|XP_003604353.1|  Glycerol kinase                                    288   1e-91   Medicago truncatula
ref|NP_001031307.1|  glycerol kinase                                    287   1e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081977.1|  PREDICTED: glycerol kinase                         288   2e-91   Sesamum indicum [beniseed]
ref|XP_006427440.1|  hypothetical protein CICLE_v10025360mg             288   2e-91   Citrus clementina [clementine]
ref|XP_010429953.1|  PREDICTED: glycerol kinase                         288   2e-91   Camelina sativa [gold-of-pleasure]
gb|ABK32113.1|  At1g80460                                               288   2e-91   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178161.1|  glycerol kinase                                       288   3e-91   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79385.1|  BnaC06g19180D                                          287   4e-91   
ref|XP_004135863.1|  PREDICTED: glycerol kinase-like                    287   5e-91   Cucumis sativus [cucumbers]
emb|CDY37598.1|  BnaA02g19720D                                          287   5e-91   Brassica napus [oilseed rape]
ref|XP_008372701.1|  PREDICTED: glycerol kinase                         287   7e-91   Malus domestica [apple tree]
ref|XP_010097187.1|  Glycerol kinase                                    286   7e-91   Morus notabilis
emb|CDY39977.1|  BnaC06g40550D                                          286   7e-91   Brassica napus [oilseed rape]
ref|XP_006385291.1|  glycerol kinase family protein                     286   9e-91   
ref|XP_009104463.1|  PREDICTED: glycerol kinase                         286   1e-90   
emb|CDX67948.1|  BnaA07g19880D                                          286   1e-90   
emb|CDX87311.1|  BnaA07g35620D                                          285   2e-90   
ref|XP_006389796.1|  hypothetical protein EUTSA_v10018399mg             283   2e-90   
ref|XP_009106746.1|  PREDICTED: glycerol kinase-like                    285   2e-90   Brassica rapa
ref|XP_006302136.1|  hypothetical protein CARUB_v10020141mg             283   2e-90   
gb|EPS68115.1|  hypothetical protein M569_06657                         284   4e-90   Genlisea aurea
ref|XP_010472924.1|  PREDICTED: glycerol kinase-like isoform X1         284   9e-90   Camelina sativa [gold-of-pleasure]
ref|XP_006389795.1|  hypothetical protein EUTSA_v10018399mg             284   9e-90   Eutrema salsugineum [saltwater cress]
ref|XP_010417705.1|  PREDICTED: glycerol kinase-like                    284   9e-90   Camelina sativa [gold-of-pleasure]
gb|KFK42437.1|  hypothetical protein AALP_AA2G256400                    283   1e-89   Arabis alpina [alpine rockcress]
ref|XP_002887828.1|  At1g80460                                          283   1e-89   
ref|XP_011044862.1|  PREDICTED: glycerol kinase                         283   1e-89   Populus euphratica
ref|XP_006302137.1|  hypothetical protein CARUB_v10020141mg             283   2e-89   Capsella rubella
ref|XP_004506960.1|  PREDICTED: glycerol kinase-like                    283   2e-89   Cicer arietinum [garbanzo]
ref|XP_010537930.1|  PREDICTED: glycerol kinase                         283   2e-89   Tarenaya hassleriana [spider flower]
ref|XP_007135771.1|  hypothetical protein PHAVU_010G157400g             282   4e-89   Phaseolus vulgaris [French bean]
ref|XP_006652916.1|  PREDICTED: glycerol kinase-like                    282   6e-89   Oryza brachyantha
gb|AAR88660.1|  glycerol kinase                                         281   8e-89   Pandanus amaryllifolius [pandan rampeh]
ref|XP_004303284.1|  PREDICTED: glycerol kinase-like                    281   9e-89   Fragaria vesca subsp. vesca
gb|AIT39761.1|  glycerol kinase                                         280   3e-88   Chrysanthemum boreale
gb|EMS68114.1|  Glycerol kinase                                         279   3e-88   Triticum urartu
ref|XP_010691126.1|  PREDICTED: glycerol kinase                         280   3e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN01314.1|  Putative glycerol kinase                                279   7e-88   Glycine soja [wild soybean]
gb|KHG30375.1|  Glycerol kinase                                         279   1e-87   Gossypium arboreum [tree cotton]
ref|XP_003580683.1|  PREDICTED: glycerol kinase                         278   2e-87   Brachypodium distachyon [annual false brome]
ref|XP_010244913.1|  PREDICTED: glycerol kinase-like                    278   3e-87   Nelumbo nucifera [Indian lotus]
ref|XP_010913342.1|  PREDICTED: glycerol kinase-like                    278   3e-87   Elaeis guineensis
ref|NP_001237303.1|  glycerol kinase                                    277   3e-87   
ref|XP_009407371.1|  PREDICTED: glycerol kinase                         276   7e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB66375.1|  hypothetical protein B456_010G138000                    276   1e-86   Gossypium raimondii
gb|AGH08245.1|  glycerol kinase                                         276   1e-86   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010907017.1|  PREDICTED: glycerol kinase                         275   2e-86   Elaeis guineensis
ref|XP_008795833.1|  PREDICTED: glycerol kinase-like                    275   3e-86   Phoenix dactylifera
ref|XP_004977029.1|  PREDICTED: glycerol kinase-like                    269   4e-84   Setaria italica
ref|NP_001132106.2|  uncharacterized protein LOC100193522               264   3e-82   Zea mays [maize]
ref|XP_008779160.1|  PREDICTED: glycerol kinase-like isoform X2         262   3e-81   Phoenix dactylifera
gb|AAR18687.1|  glycerol kinase-like protein                            261   7e-81   Oryza sativa Japonica Group [Japonica rice]
gb|EMT01355.1|  Putative glycerol kinase                                261   9e-81   
ref|XP_002448637.1|  hypothetical protein SORBIDRAFT_06g030600          260   2e-80   Sorghum bicolor [broomcorn]
emb|CAJ86056.1|  H0821G03.7                                             259   3e-80   Oryza sativa [red rice]
ref|NP_001054071.1|  Os04g0647800                                       258   1e-79   
gb|ABK24550.1|  unknown                                                 256   4e-79   Picea sitchensis
gb|ABK25673.1|  unknown                                                 250   9e-77   Picea sitchensis
ref|XP_002984877.1|  hypothetical protein SELMODRAFT_121015             241   2e-73   Selaginella moellendorffii
ref|XP_002985935.1|  hypothetical protein SELMODRAFT_123030             239   8e-73   Selaginella moellendorffii
ref|XP_010911625.1|  PREDICTED: glycerol kinase-like                    209   1e-65   Elaeis guineensis
gb|AEZ00842.1|  putative glycerol kinase protein                        207   7e-65   Elaeis guineensis
ref|XP_001763943.1|  predicted protein                                  217   4e-64   
gb|KDO47427.1|  hypothetical protein CISIN_1g0098681mg                  210   7e-62   Citrus sinensis [apfelsine]
gb|KIX03908.1|  glycerol kinase                                         201   2e-58   Rhinocladiella mackenziei CBS 650.93
gb|KIW59223.1|  glycerol kinase                                         199   3e-57   Exophiala xenobiotica
ref|XP_007734806.1|  glycerol kinase                                    198   5e-57   Capronia epimyces CBS 606.96
dbj|BAH56977.1|  AT1G80460                                              196   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006852853.1|  hypothetical protein AMTR_s00033p00197360          196   1e-56   
ref|XP_003072057.1|  glycerol kinase, putative                          197   2e-56   Coccidioides posadasii C735 delta SOWgp
gb|KIW39098.1|  glycerol kinase                                         197   2e-56   Exophiala oligosperma
ref|XP_002544072.1|  glycerol kinase                                    196   2e-56   Uncinocarpus reesii 1704
gb|KIW74117.1|  glycerol kinase                                         196   4e-56   Fonsecaea pedrosoi CBS 271.37
gb|KIW41707.1|  glycerol kinase                                         196   5e-56   Exophiala oligosperma
gb|KIW53862.1|  glycerol kinase                                         196   5e-56   Exophiala xenobiotica
gb|KIX96461.1|  hypothetical protein Z520_07727                         196   5e-56   Fonsecaea multimorphosa CBS 102226
gb|KIW12125.1|  glycerol kinase                                         196   5e-56   Exophiala spinifera
gb|KIW25190.1|  glycerol kinase                                         195   6e-56   Cladophialophora immunda
gb|KEF63543.1|  glycerol kinase                                         195   7e-56   Exophiala aquamarina CBS 119918
ref|XP_008082000.1|  Actin-like ATPase                                  195   1e-55   Glarea lozoyensis ATCC 20868
gb|EAS27500.3|  glycerol kinase                                         195   1e-55   Coccidioides immitis RS
gb|KIW13824.1|  glycerol kinase                                         194   2e-55   Exophiala spinifera
ref|XP_007746125.1|  glycerol kinase                                    194   2e-55   Cladophialophora psammophila CBS 110553
ref|XP_007721505.1|  glycerol kinase                                    194   2e-55   Capronia coronata CBS 617.96
gb|EHL03740.1|  putative Glycerol kinase                                194   2e-55   Glarea lozoyensis 74030
ref|XP_008083904.1|  Actin-like ATPase                                  194   4e-55   Glarea lozoyensis ATCC 20868
gb|KIW93314.1|  glycerol kinase                                         193   4e-55   Cladophialophora bantiana CBS 173.52
gb|KIV83409.1|  glycerol kinase                                         193   5e-55   Exophiala sideris
ref|XP_009154657.1|  glycerol kinase                                    193   5e-55   Exophiala dermatitidis NIH/UT8656
gb|KEF52126.1|  glycerol kinase                                         192   6e-55   Exophiala aquamarina CBS 119918
gb|KIX09632.1|  glycerol kinase                                         192   7e-55   Rhinocladiella mackenziei CBS 650.93
ref|XP_008779159.1|  PREDICTED: glycerol kinase-like isoform X1         191   8e-55   Phoenix dactylifera
gb|ERS98066.1|  glycerol kinase                                         194   1e-54   Sporothrix schenckii ATCC 58251
gb|KIV86319.1|  glycerol kinase                                         192   1e-54   Exophiala sideris
ref|XP_007722970.1|  glycerol kinase                                    191   2e-54   Capronia coronata CBS 617.96
gb|KIH87229.1|  glycerol kinase                                         193   2e-54   Sporothrix brasiliensis 5110
ref|XP_008715149.1|  glycerol kinase                                    191   2e-54   Cyphellophora europaea CBS 101466
gb|ESZ94780.1|  glycerol kinase                                         191   2e-54   Sclerotinia borealis F-4128
ref|XP_002623248.1|  glycerol kinase                                    191   4e-54   Blastomyces gilchristii SLH14081
ref|XP_003053171.1|  hypothetical protein NECHADRAFT_67500              192   4e-54   [Nectria] haematococca mpVI 77-13-4
ref|XP_009161485.1|  glycerol kinase                                    190   4e-54   Exophiala dermatitidis NIH/UT8656
gb|KIV91759.1|  glycerol kinase                                         190   7e-54   Exophiala mesophila
gb|EZF30633.1|  glycerol kinase                                         185   7e-54   Trichophyton interdigitale H6
gb|EEH03542.1|  glycerol kinase                                         189   9e-54   Histoplasma capsulatum G186AR
ref|XP_009257820.1|  hypothetical protein FPSE_06427                    191   9e-54   Fusarium pseudograminearum CS3096
ref|XP_007290490.1|  glycerol kinase                                    190   1e-53   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|EER38708.1|  glycerol kinase                                         189   1e-53   Histoplasma capsulatum H143
gb|EGC47863.1|  glycerol kinase                                         189   2e-53   Histoplasma capsulatum H88
gb|EEQ90810.1|  glycerol kinase                                         188   3e-53   Blastomyces dermatitidis ER-3
gb|KIW30265.1|  glycerol kinase                                         188   3e-53   Cladophialophora immunda
gb|KIW62746.1|  glycerol kinase                                         188   3e-53   Phialophora americana
gb|EXK30956.1|  glycerol kinase                                         189   3e-53   Fusarium oxysporum f. sp. melonis 26406
ref|XP_007762002.1|  glycerol kinase                                    188   4e-53   Cladophialophora yegresii CBS 114405
gb|EWG39393.1|  glycerol kinase                                         189   4e-53   Fusarium verticillioides 7600
ref|XP_008730990.1|  glycerol kinase                                    188   4e-53   Cladophialophora carrionii CBS 160.54
gb|EGU77732.1|  hypothetical protein FOXB_11754                         189   4e-53   Fusarium oxysporum Fo5176
gb|EXM09636.1|  glycerol kinase                                         189   4e-53   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXA40461.1|  glycerol kinase                                         189   4e-53   Fusarium oxysporum f. sp. pisi HDV247
gb|EWY88820.1|  glycerol kinase                                         189   5e-53   Fusarium oxysporum FOSC 3-a
gb|EWZ39665.1|  glycerol kinase                                         189   5e-53   Fusarium oxysporum Fo47
emb|CCT70018.1|  probable GUT1-glycerol kinase                          189   7e-53   Fusarium fujikuroi IMI 58289
dbj|GAM87358.1|  hypothetical protein ANO11243_053820                   187   8e-53   fungal sp. No.11243
gb|KIW80416.1|  glycerol kinase                                         187   1e-52   Fonsecaea pedrosoi CBS 271.37
gb|EGE01178.1|  glycerol kinase                                         187   1e-52   Trichophyton equinum CBS 127.97
gb|EGD95974.1|  glycerol kinase                                         187   1e-52   Trichophyton tonsurans CBS 112818
ref|XP_007761772.1|  glycerol kinase                                    187   1e-52   Cladophialophora yegresii CBS 114405
gb|KIX93773.1|  hypothetical protein Z520_10397                         186   1e-52   Fonsecaea multimorphosa CBS 102226
ref|XP_010761524.1|  glycerol kinase                                    186   2e-52   Paracoccidioides brasiliensis Pb18
ref|XP_003172411.1|  glycerol kinase                                    186   2e-52   Nannizzia gypsea CBS 118893
gb|KIW98601.1|  glycerol kinase                                         186   2e-52   Cladophialophora bantiana CBS 173.52
gb|KFA61070.1|  hypothetical protein S40285_06341                       186   2e-52   Stachybotrys chlorohalonata IBT 40285
gb|KEZ40309.1|  Glycerol kinase 2                                       186   2e-52   Scedosporium apiospermum
dbj|GAD93635.1|  glycerol kinase, putative                              187   2e-52   Byssochlamys spectabilis No. 5
ref|XP_007875438.1|  hypothetical protein PNEG_03356                    186   3e-52   Pneumocystis murina B123
ref|XP_005702903.1|  glycerol kinase                                    185   3e-52   Galdieria sulphuraria
gb|ELQ38941.1|  glycerol kinase                                         187   4e-52   Magnaporthe oryzae Y34
ref|XP_002843966.1|  glycerol kinase 2                                  185   4e-52   Microsporum canis CBS 113480
gb|KFY31403.1|  hypothetical protein V493_01143                         185   4e-52   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_003237179.1|  glycerol kinase                                    185   4e-52   Trichophyton rubrum CBS 118892
gb|EZF71154.1|  glycerol kinase                                         185   4e-52   Trichophyton soudanense CBS 452.61
gb|KDB23476.1|  glycerol kinase                                         185   4e-52   Trichophyton interdigitale MR816
ref|XP_002792127.1|  glycerol kinase                                    185   5e-52   Paracoccidioides lutzii Pb01
ref|XP_007739070.1|  glycerol kinase                                    185   5e-52   Cladophialophora psammophila CBS 110553
ref|XP_003717501.1|  glycerol kinase                                    185   6e-52   Magnaporthe oryzae 70-15
gb|KDB23477.1|  glycerol kinase                                         184   7e-52   Trichophyton interdigitale MR816
gb|EZF12740.1|  glycerol kinase                                         184   7e-52   Trichophyton rubrum MR850
gb|EEH23527.1|  glycerol kinase                                         184   7e-52   Paracoccidioides brasiliensis Pb03
gb|EZF71155.1|  glycerol kinase                                         184   7e-52   Trichophyton soudanense CBS 452.61
ref|XP_661520.1|  hypothetical protein AN3916.2                         186   8e-52   Aspergillus nidulans FGSC A4
gb|KIL91975.1|  hypothetical protein FAVG1_04380                        186   9e-52   Fusarium avenaceum
gb|KEY70743.1|  hypothetical protein S7711_03239                        184   1e-51   Stachybotrys chartarum IBT 7711
gb|KFA76269.1|  hypothetical protein S40288_03598                       184   1e-51   Stachybotrys chartarum IBT 40288
gb|KIN04900.1|  hypothetical protein OIDMADRAFT_157379                  185   1e-51   Oidiodendron maius Zn
gb|EWM26199.1|  glycerol kinase                                         176   2e-51   Nannochloropsis gaditana
ref|XP_009216069.1|  glycerol kinase                                    185   2e-51   Gaeumannomyces tritici R3-111a-1
ref|XP_007583629.1|  putative glycerol kinase protein                   184   2e-51   
ref|XP_001214980.1|  glycerol kinase 2                                  184   3e-51   Aspergillus terreus NIH2624
ref|XP_008020290.1|  hypothetical protein SETTUDRAFT_40870              184   3e-51   Exserohilum turcica Et28A
gb|EKG13278.1|  Carbohydrate kinase FGGY                                184   3e-51   Macrophomina phaseolina MS6
ref|XP_007785100.1|  glycerol kinase                                    184   3e-51   Coniosporium apollinis CBS 100218
gb|KHO01811.1|  Glycerol kinase                                         182   5e-51   Metarhizium album ARSEF 1941
gb|EKG19925.1|  Carbohydrate kinase FGGY                                183   7e-51   Macrophomina phaseolina MS6
gb|EFX03253.1|  glycerol kinase                                         183   7e-51   Grosmannia clavigera kw1407
ref|XP_008724472.1|  glycerol kinase                                    182   7e-51   Cladophialophora carrionii CBS 160.54
gb|EPE08983.1|  glycerol kinase                                         183   8e-51   Ophiostoma piceae UAMH 11346
ref|XP_003845263.1|  similar to glycerol kinase                         182   9e-51   Leptosphaeria maculans JN3
gb|EKV13298.1|  Glycerol kinase, putative                               181   1e-50   Penicillium digitatum PHI26
ref|XP_001796578.1|  hypothetical protein SNOG_06196                    181   1e-50   Parastagonospora nodorum SN15
gb|ESA10637.1|  hypothetical protein GLOINDRAFT_3264                    181   2e-50   
ref|XP_750736.1|  glycerol kinase                                       182   2e-50   Aspergillus fumigatus Af293
gb|KEY82231.1|  glycerol kinase                                         182   2e-50   Aspergillus fumigatus var. RP-2014
emb|CDM35394.1|  Putative glycerol kinase 3                             182   2e-50   Penicillium roqueforti FM164
ref|XP_007289663.1|  putative glycerol kinase                           182   2e-50   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_007674509.1|  hypothetical protein BAUCODRAFT_32546              182   3e-50   Baudoinia panamericana UAMH 10762
gb|KIW77253.1|  glycerol kinase                                         181   3e-50   Fonsecaea pedrosoi CBS 271.37
dbj|BAE57019.1|  unnamed protein product                                180   3e-50   Aspergillus oryzae RIB40
ref|XP_002478964.1|  glycerol kinase, putative                          181   3e-50   Talaromyces stipitatus ATCC 10500
emb|CCF45414.1|  glycerol kinase                                        181   3e-50   Colletotrichum higginsianum
gb|EMF13374.1|  glycerol kinase                                         181   3e-50   Sphaerulina musiva SO2202
gb|EXL75811.1|  glycerol kinase                                         180   3e-50   Fusarium oxysporum f. sp. conglutinans race 2 54008
gb|EXK28283.1|  glycerol kinase                                         179   4e-50   Fusarium oxysporum f. sp. melonis 26406
gb|EMT71501.1|  Glycerol kinase                                         179   4e-50   Fusarium oxysporum f. sp. cubense race 4
gb|ENH75487.1|  Glycerol kinase                                         179   4e-50   Fusarium oxysporum f. sp. cubense race 1
gb|KEQ89714.1|  glycerol kinase                                         180   4e-50   Aureobasidium pullulans EXF-150
emb|CCJ30886.1|  unnamed protein product                                179   4e-50   Pneumocystis jirovecii
gb|EME45283.1|  hypothetical protein DOTSEDRAFT_87671                   180   5e-50   Dothistroma septosporum NZE10
ref|XP_002837355.1|  hypothetical protein                               180   5e-50   Tuber melanosporum Mel28
gb|KIE03648.1|  Carbohydrate kinase, FGGY                               179   5e-50   Metarhizium majus ARSEF 297
ref|XP_001267955.1|  glycerol kinase, putative                          181   6e-50   Aspergillus clavatus NRRL 1
gb|KEF57655.1|  glycerol kinase                                         179   7e-50   Exophiala aquamarina CBS 119918
gb|EWZ32741.1|  glycerol kinase                                         179   7e-50   Fusarium oxysporum Fo47
ref|XP_001819021.2|  glycerol kinase                                    180   7e-50   
ref|XP_007582400.1|  putative glycerol kinase protein                   180   7e-50   
gb|EWG48859.1|  glycerol kinase                                         179   7e-50   Fusarium verticillioides 7600
gb|EGU81741.1|  hypothetical protein FOXB_07748                         179   7e-50   Fusarium oxysporum Fo5176
gb|EXK28275.1|  glycerol kinase                                         179   7e-50   Fusarium oxysporum f. sp. melonis 26406
gb|EWY83399.1|  glycerol kinase                                         179   8e-50   Fusarium oxysporum FOSC 3-a
ref|XP_007915417.1|  putative glycerol kinase protein                   179   8e-50   Phaeoacremonium minimum UCRPA7
gb|KIL87347.1|  glycerol kinase                                         179   9e-50   Fusarium avenaceum
ref|XP_001257963.1|  glycerol kinase, putative                          180   1e-49   Aspergillus fischeri NRRL 181
gb|EPE03807.1|  glycerol kinase                                         179   1e-49   Ophiostoma piceae UAMH 11346
dbj|BAB25518.1|  unnamed protein product                                169   1e-49   Mus musculus [mouse]
gb|KEY65705.1|  hypothetical protein S7711_07532                        179   1e-49   Stachybotrys chartarum IBT 7711
gb|KFA65845.1|  hypothetical protein S40285_04646                       179   1e-49   Stachybotrys chlorohalonata IBT 40285
gb|KID78011.1|  Glycerol kinase                                         179   1e-49   Metarhizium brunneum ARSEF 3297
gb|KFA72479.1|  hypothetical protein S40288_08601                       178   1e-49   Stachybotrys chartarum IBT 40288
gb|KIV98076.1|  glycerol kinase                                         179   1e-49   Exophiala mesophila
ref|XP_011322504.1|  hypothetical protein FGSG_03247                    178   1e-49   Fusarium graminearum PH-1
gb|KFZ18912.1|  hypothetical protein V502_03900                         178   1e-49   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KEQ90708.1|  hypothetical protein AUEXF2481DRAFT_9264                178   1e-49   Aureobasidium subglaciale EXF-2481
ref|XP_002382003.1|  glycerol kinase, putative                          180   1e-49   Aspergillus flavus NRRL3357
gb|EMD93310.1|  hypothetical protein COCHEDRAFT_1131471                 179   2e-49   Bipolaris maydis C5
ref|XP_007818344.1|  glycerol kinase                                    178   2e-49   Metarhizium robertsii ARSEF 23
gb|KID92964.1|  Carbohydrate kinase, FGGY                               178   2e-49   Metarhizium guizhouense ARSEF 977
ref|XP_003300497.1|  hypothetical protein PTT_11744                     179   2e-49   
ref|XP_002146657.1|  glycerol kinase, putative                          179   2e-49   Talaromyces marneffei ATCC 18224
ref|XP_007687604.1|  hypothetical protein COCMIDRAFT_4982               179   2e-49   Bipolaris oryzae ATCC 44560
emb|CCT74864.1|  probable GUT1-glycerol kinase                          178   2e-49   Fusarium fujikuroi IMI 58289
gb|KIW63436.1|  glycerol kinase                                         179   2e-49   Phialophora americana
ref|XP_007708185.1|  hypothetical protein COCCADRAFT_85322              179   2e-49   Bipolaris zeicola 26-R-13
ref|XP_009259021.1|  hypothetical protein FPSE_07628                    178   2e-49   Fusarium pseudograminearum CS3096
ref|XP_002565259.1|  Pc22g13330                                         179   2e-49   Penicillium rubens Wisconsin 54-1255
gb|KEQ66791.1|  glycerol kinase                                         177   3e-49   Aureobasidium melanogenum CBS 110374
gb|KGO43785.1|  Carbohydrate kinase, FGGY, N-terminal                   179   3e-49   Penicillium expansum
gb|KFG85089.1|  putative glycerol kinase                                177   3e-49   Metarhizium anisopliae
emb|CCF44486.1|  glycerol kinase                                        177   3e-49   Colletotrichum higginsianum
ref|XP_007695722.1|  hypothetical protein COCSADRAFT_156456             178   3e-49   Bipolaris sorokiniana ND90Pr
gb|KFZ02369.1|  hypothetical protein V500_00242                         177   3e-49   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_003650464.1|  hypothetical protein THITE_2109948                 178   4e-49   Thielavia terrestris NRRL 8126
gb|KFH41246.1|  Glycerol kinase-like protein                            178   4e-49   Acremonium chrysogenum ATCC 11550
gb|EHK44930.1|  hypothetical protein TRIATDRAFT_39628                   177   4e-49   Trichoderma atroviride IMI 206040
ref|XP_007785758.1|  hypothetical protein EPUS_02645                    177   5e-49   Endocarpon pusillum Z07020
gb|KGO69620.1|  Carbohydrate kinase, FGGY, N-terminal                   178   5e-49   Penicillium italicum
ref|XP_006694626.1|  glycerol kinase-like protein                       178   5e-49   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_006852079.1|  hypothetical protein AMTR_s00041p00233680          166   6e-49   
gb|EMF10400.1|  glycerol kinase                                         177   6e-49   Sphaerulina musiva SO2202
ref|XP_003714199.1|  glycerol kinase                                    177   7e-49   Magnaporthe oryzae 70-15
emb|CCX34888.1|  Similar to Glycerol kinase; acc. no. A9WJ21            178   7e-49   Pyronema omphalodes CBS 100304
ref|XP_006427437.1|  hypothetical protein CICLE_v10025756mg             174   7e-49   
ref|XP_001932988.1|  glycerol kinase                                    176   8e-49   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_009654938.1|  glycerol kinase                                    176   8e-49   Verticillium dahliae VdLs.17
dbj|GAM35762.1|  glycerol kinase                                        177   8e-49   Talaromyces cellulolyticus
ref|XP_008598371.1|  glycerol kinase                                    176   8e-49   Beauveria bassiana ARSEF 2860
gb|KGQ06803.1|  Glycerol kinase                                         176   9e-49   Beauveria bassiana D1-5
ref|XP_001560626.1|  hypothetical protein BC1G_00654                    177   1e-48   Botrytis cinerea B05.10
gb|ENH83098.1|  glycerol kinase                                         176   1e-48   
ref|XP_003004691.1|  glycerol kinase                                    176   1e-48   Verticillium alfalfae VaMs.102
gb|EMR89696.1|  putative glycerol kinase protein                        177   1e-48   Botrytis cinerea BcDW1
gb|KGO51951.1|  Carbohydrate kinase, FGGY, N-terminal                   177   1e-48   Penicillium expansum
ref|XP_003350613.1|  hypothetical protein SMAC_07929                    177   1e-48   Sordaria macrospora k-hell
emb|CCD51759.1|  similar to glycerol kinase                             177   1e-48   Botrytis cinerea T4
ref|XP_001598363.1|  hypothetical protein SS1G_00451                    177   1e-48   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_007925614.1|  hypothetical protein MYCFIDRAFT_195993             176   1e-48   Pseudocercospora fijiensis CIRAD86
gb|KFY07829.1|  hypothetical protein V492_06783                         178   1e-48   Pseudogymnoascus sp. VKM F-4246
ref|XP_007285916.1|  glycerol kinase                                    176   1e-48   
gb|EQB57757.1|  glycerol kinase                                         176   1e-48   
gb|EPQ67800.1|  Glycerol kinase                                         176   1e-48   
gb|KIX97385.1|  hypothetical protein Z520_06837                         176   2e-48   
gb|AGM32757.1|  putative glycerol kinase 3-like protein                 169   2e-48   
emb|CEJ05177.1|  Putative Glycerol kinase                               168   2e-48   
gb|ENH81505.1|  glycerol kinase                                         176   2e-48   
gb|KIW00193.1|  glycerol kinase                                         176   2e-48   
ref|XP_009230026.1|  glycerol kinase                                    176   2e-48   
gb|KFH46127.1|  Glycerol kinase-like protein                            175   2e-48   
gb|EIE80556.1|  hypothetical protein RO3G_05261                         167   2e-48   
gb|KFH62786.1|  glycerol kinase                                         175   3e-48   
ref|XP_003664128.1|  glycerol kinase-like protein                       175   4e-48   
ref|XP_958813.3|  glycerol kinase                                       175   4e-48   
emb|CCU81709.1|  glycerol kinase/GUT1                                   175   5e-48   
ref|XP_003043029.1|  predicted protein                                  174   5e-48   
ref|XP_005642816.1|  hypothetical protein COCSUDRAFT_20832              174   6e-48   
gb|ESZ99393.1|  glycerol kinase-like protein                            175   6e-48   
emb|CEJ80119.1|  Putative Glycerol kinase                               174   6e-48   
gb|KDN65164.1|  putative glycerol kinase                                174   6e-48   
gb|KEQ70942.1|  glycerol kinase                                         174   7e-48   
gb|EME45231.1|  hypothetical protein DOTSEDRAFT_23288                   174   7e-48   
gb|KFZ03328.1|  hypothetical protein V501_09388                         175   7e-48   
gb|KIV83164.1|  glycerol kinase                                         174   7e-48   
gb|KFG81304.1|  glycerol kinase                                         174   7e-48   
ref|XP_007819303.1|  glycerol kinase                                    174   7e-48   
gb|KID98996.1|  glycerol kinase                                         174   8e-48   
gb|KID76186.1|  glycerol kinase                                         174   8e-48   
gb|KID87902.1|  glycerol kinase                                         174   8e-48   
emb|CDQ94327.1|  unnamed protein product                                167   8e-48   
ref|XP_007813385.1|  glycerol kinase                                    174   8e-48   
ref|XP_001906073.1|  hypothetical protein                               174   9e-48   
gb|KFY50426.1|  hypothetical protein V496_09346                         176   9e-48   
gb|KFY71367.1|  hypothetical protein V499_08431                         175   1e-47   
dbj|GAM40117.1|  glycerol kinase                                        173   1e-47   
emb|CCE32088.1|  probable GUT1-glycerol kinase                          173   1e-47   
ref|XP_002500482.1|  predicted protein                                  173   1e-47   
ref|XP_002108430.1|  hypothetical protein TRIADDRAFT_20207              173   1e-47   
ref|XP_007594560.1|  glycerol kinase                                    173   1e-47   
ref|XP_007808987.1|  glycerol kinase, putative                          173   1e-47   
gb|KIW25924.1|  glycerol kinase                                         173   2e-47   
ref|XP_003853689.1|  hypothetical protein MYCGRDRAFT_85027              173   2e-47   
ref|XP_504821.1|  YALI0F00484p                                          172   2e-47   
gb|EFQ34813.1|  glycerol kinase                                         173   2e-47   
ref|XP_006679867.1|  hypothetical protein BATDEDRAFT_25739              167   2e-47   
ref|XP_007782119.1|  glycerol kinase                                    173   2e-47   
gb|KIW14161.1|  glycerol kinase                                         173   2e-47   
gb|KFY30615.1|  hypothetical protein V494_08093                         176   2e-47   
gb|KFY41374.1|  hypothetical protein V495_04954                         175   2e-47   
gb|KIH92358.1|  glycerol kinase                                         172   2e-47   
ref|XP_007594196.1|  glycerol kinase                                    173   2e-47   
gb|ERT00918.1|  glycerol kinase                                         172   2e-47   
gb|KFX95063.1|  hypothetical protein O988_06007                         175   2e-47   
ref|XP_006963775.1|  glycerol kinase-like protein                       172   2e-47   
gb|KHN96571.1|  glycerol kinase                                         172   2e-47   
gb|KIW59080.1|  glycerol kinase                                         172   2e-47   
ref|XP_007744581.1|  glycerol kinase                                    172   3e-47   
ref|XP_005091681.1|  PREDICTED: putative glycerol kinase 3-like         172   3e-47   
ref|XP_006666955.1|  glycerol kinase                                    175   3e-47   
gb|KIW39527.1|  glycerol kinase                                         172   3e-47   
gb|KFY82739.1|  hypothetical protein V500_10354                         173   3e-47   
emb|CDH60090.1|  glycerol kinase                                        171   5e-47   
dbj|GAN02093.1|  conserved hypothetical protein                         171   5e-47   
ref|XP_009055569.1|  hypothetical protein LOTGIDRAFT_209470             171   8e-47   
ref|XP_008299996.1|  PREDICTED: glycerol kinase-like                    164   8e-47   
ref|XP_005817108.1|  PREDICTED: glycerol kinase-like                    166   9e-47   
ref|WP_022884044.1|  glycerol kinase                                    171   9e-47   
emb|CEJ00803.1|  Putative Glycerol kinase                               163   1e-46   
gb|KFZ04234.1|  hypothetical protein V502_10303                         173   1e-46   
gb|KFX95478.1|  hypothetical protein V490_03828                         175   1e-46   
gb|EEH64510.1|  glycerol kinase                                         171   1e-46   
gb|EQL04035.1|  Glycerol kinase                                         171   1e-46   
ref|XP_011436346.1|  PREDICTED: glycerol kinase-like isoform X2         171   1e-46   
gb|EPB83489.1|  glycerol kinase                                         170   1e-46   
gb|ETE58690.1|  Glycerol kinase                                         165   2e-46   
gb|EPS34031.1|  hypothetical protein PDE_08993                          171   2e-46   
ref|XP_003854468.1|  hypothetical protein MYCGRDRAFT_108567             171   2e-46   
ref|XP_005484433.1|  PREDICTED: glycerol kinase isoform X2              170   2e-46   
ref|XP_011436344.1|  PREDICTED: glycerol kinase-like isoform X1         170   2e-46   
ref|XP_005484432.1|  PREDICTED: glycerol kinase isoform X1              170   2e-46   
ref|XP_007673590.1|  hypothetical protein BAUCODRAFT_31496              171   3e-46   
emb|CEJ02635.1|  Putative Glycerol kinase                               169   3e-46   
gb|EHK27069.1|  hypothetical protein TRIVIDRAFT_91895                   169   3e-46   
gb|ELR05467.1|  hypothetical protein GMDG_07389                         171   3e-46   
gb|EFQ35846.1|  glycerol kinase                                         170   3e-46   
ref|XP_008327167.1|  PREDICTED: glycerol kinase-like                    169   3e-46   
emb|CEG63395.1|  Putative Glycerol kinase                               169   4e-46   
ref|WP_040313060.1|  glycerol kinase                                    169   4e-46   
ref|XP_005807877.1|  PREDICTED: glycerol kinase-like                    169   4e-46   
ref|NP_001004077.1|  glycerol kinase 2                                  169   4e-46   
ref|XP_005144607.1|  PREDICTED: glycerol kinase isoform X3              169   5e-46   
ref|XP_005144605.1|  PREDICTED: glycerol kinase isoform X1              169   5e-46   
ref|XP_005144606.1|  PREDICTED: glycerol kinase isoform X2              169   5e-46   
ref|XP_007541421.1|  PREDICTED: glycerol kinase isoform X2              169   5e-46   
ref|WP_038679022.1|  glycerol kinase                                    169   5e-46   
ref|XP_007840960.1|  hypothetical protein PFICI_14188                   169   5e-46   
gb|KDB14926.1|  glycerol kinase                                         169   5e-46   
ref|XP_005037351.1|  PREDICTED: glycerol kinase isoform X4              169   5e-46   
ref|XP_004336510.1|  glycerol kinase                                    169   5e-46   
emb|CEI99624.1|  Putative Glycerol kinase                               169   6e-46   
gb|KDN60214.1|  putative glycerol kinase                                169   6e-46   
emb|CEG66889.1|  Putative Glycerol kinase                               169   6e-46   
ref|XP_007541420.1|  PREDICTED: glycerol kinase isoform X1              169   6e-46   
gb|EQB52429.1|  glycerol kinase                                         169   6e-46   
gb|KEQ73829.1|  glycerol kinase                                         169   6e-46   
ref|XP_005303408.1|  PREDICTED: glycerol kinase isoform X3              169   7e-46   
ref|XP_005037348.1|  PREDICTED: glycerol kinase isoform X1              169   7e-46   
ref|XP_005037349.1|  PREDICTED: glycerol kinase isoform X2              169   8e-46   
ref|XP_007084972.1|  PREDICTED: glycerol kinase-like isoform X2         168   8e-46   
gb|KHJ31382.1|  putative glycerol kinase                                169   8e-46   
gb|KEQ64801.1|  glycerol kinase                                         169   8e-46   
ref|NP_001090867.1|  glycerol kinase                                    169   8e-46   
ref|XP_005303407.1|  PREDICTED: glycerol kinase isoform X2              169   8e-46   
sp|Q63060.1|GLPK_RAT  RecName: Full=Glycerol kinase; Short=GK; Sh...    168   8e-46   
ref|XP_005037350.1|  PREDICTED: glycerol kinase isoform X3              169   8e-46   
ref|NP_077357.2|  glycerol kinase                                       168   9e-46   
ref|XP_005303406.1|  PREDICTED: glycerol kinase isoform X1              169   9e-46   
ref|WP_014453961.1|  glycerol kinase                                    168   9e-46   
ref|NP_001080640.1|  glycerol kinase                                    169   1e-45   
ref|XP_006679513.1|  hypothetical protein BATDEDRAFT_30202              167   1e-45   
ref|XP_005516767.1|  PREDICTED: glycerol kinase                         168   1e-45   
ref|XP_008719910.1|  glycerol kinase                                    168   1e-45   
ref|XP_007084971.1|  PREDICTED: glycerol kinase-like isoform X1         168   1e-45   
ref|XP_008546991.1|  PREDICTED: glycerol kinase                         167   1e-45   
ref|XP_006257050.1|  PREDICTED: glycerol kinase isoform X6              168   1e-45   
ref|XP_003394582.1|  PREDICTED: putative glycerol kinase 3-like         167   2e-45   
ref|XP_011297300.1|  PREDICTED: glycerol kinase                         167   2e-45   
emb|CEI95054.1|  Putative Glycerol kinase                               167   2e-45   
ref|XP_006257049.1|  PREDICTED: glycerol kinase isoform X4              168   2e-45   
ref|WP_010202377.1|  glycerol kinase                                    167   2e-45   
ref|XP_008429219.1|  PREDICTED: glycerol kinase isoform X3              166   2e-45   
ref|XP_004989699.1|  hypothetical protein PTSG_09443                    161   3e-45   
ref|XP_010569615.1|  PREDICTED: glycerol kinase isoform X4              167   3e-45   
ref|NP_034424.1|  glycerol kinase 2                                     167   3e-45   
dbj|BAG06227.1|  glycerol kinase                                        167   3e-45   
ref|XP_010569613.1|  PREDICTED: glycerol kinase isoform X2              167   3e-45   
ref|XP_005159998.1|  PREDICTED: glycerol kinase isoform X6              167   3e-45   
ref|XP_009289973.1|  PREDICTED: glycerol kinase isoform X5              167   3e-45   
ref|XP_008401387.1|  PREDICTED: glycerol kinase-like                    165   3e-45   
ref|NP_001108056.1|  glycerol kinase                                    167   4e-45   
ref|XP_007430530.1|  PREDICTED: glycerol kinase isoform X2              167   4e-45   
ref|XP_010569612.1|  PREDICTED: glycerol kinase isoform X1              167   4e-45   
dbj|BAE41209.1|  unnamed protein product                                166   4e-45   
ref|NP_032220.1|  glycerol kinase isoform 1                             166   4e-45   
ref|XP_008429212.1|  PREDICTED: glycerol kinase isoform X2              166   4e-45   
ref|XP_006617526.1|  PREDICTED: glycerol kinase-like isoform X2         166   4e-45   
ref|XP_007734330.1|  glycerol kinase                                    167   4e-45   
ref|XP_416788.3|  PREDICTED: glycerol kinase isoformX3                  166   4e-45   
ref|XP_010569614.1|  PREDICTED: glycerol kinase isoform X3              167   4e-45   
gb|AIK22411.1|  glycerol kinase                                         166   4e-45   
ref|XP_006617525.1|  PREDICTED: glycerol kinase-like isoform X1         166   5e-45   
ref|XP_007493667.1|  PREDICTED: glycerol kinase-like isoform X5         166   5e-45   
ref|XP_008284277.1|  PREDICTED: glycerol kinase-like isoform X2         166   5e-45   
ref|XP_008429203.1|  PREDICTED: glycerol kinase isoform X1              166   5e-45   
gb|EFA75245.1|  Glycerol kinase 2                                       166   5e-45   
ref|XP_006258827.1|  PREDICTED: glycerol kinase                         166   5e-45   
ref|XP_005159997.1|  PREDICTED: glycerol kinase isoform X4              166   5e-45   
ref|XP_004934697.1|  PREDICTED: glycerol kinase isoform X4              166   5e-45   
ref|XP_007430529.1|  PREDICTED: glycerol kinase isoform X1              166   5e-45   
ref|XP_009289955.1|  PREDICTED: glycerol kinase isoform X1              166   6e-45   
ref|XP_011487479.1|  PREDICTED: glycerol kinase-like isoform X1         166   6e-45   
ref|XP_008964375.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    166   6e-45   
ref|XP_009289961.1|  PREDICTED: glycerol kinase isoform X3              166   6e-45   
ref|XP_005159996.1|  PREDICTED: glycerol kinase isoform X2              166   6e-45   
ref|XP_004081419.1|  PREDICTED: glycerol kinase-like isoform X2         166   6e-45   
ref|XP_003485295.1|  PREDICTED: putative glycerol kinase 3-like         166   6e-45   
ref|NP_997609.1|  glycerol kinase isoform 2                             166   6e-45   
ref|XP_004612512.1|  PREDICTED: glycerol kinase                         167   6e-45   
ref|XP_007924692.1|  hypothetical protein MYCFIDRAFT_133838             166   6e-45   
ref|NP_001281069.1|  glycerol kinase isoform 4                          166   6e-45   
gb|EDL29154.1|  glycerol kinase, isoform CRA_a                          166   7e-45   
ref|XP_007493664.1|  PREDICTED: glycerol kinase-like isoform X2         166   7e-45   
ref|XP_007493663.1|  PREDICTED: glycerol kinase-like isoform X1         166   7e-45   
ref|XP_003640559.2|  PREDICTED: glycerol kinase isoformX2               166   8e-45   
dbj|BAC31861.1|  unnamed protein product                                166   8e-45   
ref|XP_007493666.1|  PREDICTED: glycerol kinase-like isoform X4         166   8e-45   
ref|WP_044172405.1|  glycerol kinase                                    165   8e-45   
ref|XP_003640558.2|  PREDICTED: glycerol kinase isoformX1               166   9e-45   
ref|XP_007493665.1|  PREDICTED: glycerol kinase-like isoform X3         166   9e-45   
gb|KEQ94319.1|  hypothetical protein AUEXF2481DRAFT_30297               166   9e-45   
ref|XP_008284276.1|  PREDICTED: glycerol kinase-like isoform X1         166   9e-45   
ref|XP_006918341.1|  PREDICTED: glycerol kinase isoform X2              166   9e-45   
ref|XP_005995031.1|  PREDICTED: glycerol kinase isoform X5              166   9e-45   
ref|XP_005641284.1|  PREDICTED: glycerol kinase isoform X4              166   9e-45   
ref|XP_003640303.1|  PREDICTED: glycerol kinase isoform X1              166   9e-45   
emb|CDS12796.1|  hypothetical protein LRAMOSA04980                      165   1e-44   
gb|EFX79590.1|  hypothetical protein DAPPUDRAFT_319506                  166   1e-44   
ref|XP_005995027.1|  PREDICTED: glycerol kinase isoform X1              166   1e-44   
ref|XP_005995030.1|  PREDICTED: glycerol kinase isoform X4              166   1e-44   
ref|XP_005995029.1|  PREDICTED: glycerol kinase isoform X3              166   1e-44   
ref|XP_005995028.1|  PREDICTED: glycerol kinase isoform X2              166   1e-44   
gb|AIY17559.2|  Glycerol kinase                                         165   1e-44   
ref|XP_006639381.1|  PREDICTED: glycerol kinase-like                    164   1e-44   
ref|XP_004416415.1|  PREDICTED: glycerol kinase isoform 8               164   1e-44   
ref|XP_003966700.1|  PREDICTED: glycerol kinase-like                    166   1e-44   
ref|XP_003774796.1|  PREDICTED: glycerol kinase-like                    165   1e-44   
ref|XP_004587889.1|  PREDICTED: glycerol kinase isoform X2              165   1e-44   
ref|XP_007646701.1|  PREDICTED: glycerol kinase isoform X3              165   1e-44   
ref|WP_021797488.1|  glycerol kinase                                    165   1e-44   
ref|XP_005080115.1|  PREDICTED: glycerol kinase isoform X4              165   2e-44   
ref|XP_011383720.1|  PREDICTED: glycerol kinase isoform X4              165   2e-44   
ref|XP_006987588.1|  PREDICTED: glycerol kinase isoform X3              165   2e-44   
ref|XP_006835621.1|  PREDICTED: glycerol kinase-like isoform X3         165   2e-44   
ref|XP_006918340.1|  PREDICTED: glycerol kinase isoform X1              165   2e-44   
ref|XP_010884405.1|  PREDICTED: glycerol kinase-like isoform X2         165   2e-44   
ref|XP_004022034.1|  PREDICTED: glycerol kinase isoform 3               165   2e-44   
ref|XP_005899810.1|  PREDICTED: glycerol kinase isoform X3              164   2e-44   
ref|XP_011383719.1|  PREDICTED: glycerol kinase isoform X3              165   2e-44   
ref|XP_004850116.1|  PREDICTED: glycerol kinase isoform X3              165   2e-44   
gb|KIW01983.1|  glycerol kinase                                         164   2e-44   
ref|XP_004281070.1|  PREDICTED: glycerol kinase isoform 5               164   2e-44   
ref|XP_001488442.3|  PREDICTED: glycerol kinase isoformX1               164   2e-44   
ref|XP_010734432.1|  PREDICTED: glycerol kinase-like                    165   2e-44   
ref|XP_006056353.1|  PREDICTED: glycerol kinase isoform X3              164   2e-44   
ref|XP_005701025.1|  PREDICTED: glycerol kinase isoform X3              164   2e-44   
ref|XP_004416414.1|  PREDICTED: glycerol kinase isoform 7               164   2e-44   
ref|XP_004587888.1|  PREDICTED: glycerol kinase isoform X1              165   2e-44   
ref|XP_006768248.1|  PREDICTED: glycerol kinase-like                    165   2e-44   
ref|XP_005369796.1|  PREDICTED: glycerol kinase isoform X3              164   2e-44   
ref|XP_003962188.1|  PREDICTED: glycerol kinase-like                    164   2e-44   
ref|XP_004626876.1|  PREDICTED: glycerol kinase-like                    165   2e-44   
ref|XP_004663744.1|  PREDICTED: glycerol kinase isoform X2              164   2e-44   



>ref|XP_002273367.1| PREDICTED: glycerol kinase [Vitis vinifera]
 emb|CBI36391.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE+ VFVGSIDQGTTSTRFIIYDRSA+PV SHQ+EFTQFYP+AGWVEHDP+EILESV+
Sbjct  1    MAKED-VFVGSIDQGTTSTRFIIYDRSAQPVGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC+ KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+GLPLY+AIVWMDART+SICR
Sbjct  60   VCIEKAIDKATADGHNVDSGLKAIGLTNQRETTLIWSKSTGLPLYHAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHFVETCGLPISTYFSA+KLLWLLENV+AVK+AV
Sbjct  120  KLEKELPGGRTHFVETCGLPISTYFSALKLLWLLENVDAVKKAV  163



>ref|XP_007023295.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY25917.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
Length=450

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKEE VF+GS+DQGTTSTRFIIYD+SARP+ SHQ+EFTQFYP+AGWVEHDP+EILESV+
Sbjct  1    MSKEE-VFIGSVDQGTTSTRFIIYDKSARPIGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+S+CR
Sbjct  60   VCIAKALDKATADGHNVDSGLKAIGLTNQRETTLLWSKSTGCPLYNAIVWMDARTSSVCR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHFVE+CGLPISTYFSA+KLLWL+ENV+AVK A+
Sbjct  120  KLEKELPGGRTHFVESCGLPISTYFSAVKLLWLMENVDAVKAAI  163



>ref|XP_007023296.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY25918.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
Length=448

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKEE VF+GS+DQGTTSTRFIIYD+SARP+ SHQ+EFTQFYP+AGWVEHDP+EILESV+
Sbjct  1    MSKEE-VFIGSVDQGTTSTRFIIYDKSARPIGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+S+CR
Sbjct  60   VCIAKALDKATADGHNVDSGLKAIGLTNQRETTLLWSKSTGCPLYNAIVWMDARTSSVCR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHFVE+CGLPISTYFSA+KLLWL+ENV+AVK A+
Sbjct  120  KLEKELPGGRTHFVESCGLPISTYFSAVKLLWLMENVDAVKAAI  163



>ref|XP_010250262.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=529

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M K E+ F+GSIDQGTTSTRFIIYD+SARPV SHQIEFTQFYPQAGWVEH+P+EILESV+
Sbjct  1    MEKVER-FIGSIDQGTTSTRFIIYDQSARPVGSHQIEFTQFYPQAGWVEHNPMEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            +C+ KA+DKAT DGHNV + LKAIG+TNQRETT+VWSKS+GLPLYNAIVWMDARTTSICR
Sbjct  60   ICMEKAIDKATVDGHNVEKGLKAIGLTNQRETTLVWSKSTGLPLYNAIVWMDARTTSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHFVETCGLPISTYFSA+KLLWLLENV AVKEAV
Sbjct  120  KLEKELPGGRTHFVETCGLPISTYFSAVKLLWLLENVSAVKEAV  163



>emb|CAN76048.1| hypothetical protein VITISV_037711 [Vitis vinifera]
Length=522

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE+ VFVGSIDQGTTSTRFIIYDRSA+PV SHQ+EFTQFYP+AGWVEHDP+EILESV 
Sbjct  1    MAKED-VFVGSIDQGTTSTRFIIYDRSAQPVGSHQVEFTQFYPEAGWVEHDPMEILESVX  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC+ KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+GLPLY+AIVWMDART+SICR
Sbjct  60   VCIXKAIDKATADGHNVDSGLKAIGLTNQRETTLIWSKSTGLPLYHAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEK+LPGGRTHFVETCGLPISTYFSA+KLLWLLENV+AVK+AV
Sbjct  120  KLEKKLPGGRTHFVETCGLPISTYFSALKLLWLLENVDAVKKAV  163



>ref|XP_007023294.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY25916.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
Length=522

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKEE VF+GS+DQGTTSTRFIIYD+SARP+ SHQ+EFTQFYP+AGWVEHDP+EILESV+
Sbjct  1    MSKEE-VFIGSVDQGTTSTRFIIYDKSARPIGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+S+CR
Sbjct  60   VCIAKALDKATADGHNVDSGLKAIGLTNQRETTLLWSKSTGCPLYNAIVWMDARTSSVCR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHFVE+CGLPISTYFSA+KLLWL+ENV+AVK A+
Sbjct  120  KLEKELPGGRTHFVESCGLPISTYFSAVKLLWLMENVDAVKAAI  163



>emb|CDO98178.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+VF+GSIDQGTTSTRFIIYDRSA+P+ SHQ+EFTQFYPQAGWVEHDP EILESV+VC+S
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDRSAKPIASHQLEFTQFYPQAGWVEHDPNEILESVRVCIS  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATA+GHNV   LKAIG+TNQRETTVVWSKS+G PLYNA+VWMD RT+ ICRKLE+
Sbjct  64   KAIDKATAEGHNVDGGLKAIGLTNQRETTVVWSKSTGRPLYNAVVWMDIRTSPICRKLEQ  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            ELPGGRTHFV+TCGLPISTYFSA+KLLWLLENV+AVKEAV
Sbjct  124  ELPGGRTHFVDTCGLPISTYFSALKLLWLLENVDAVKEAV  163



>ref|XP_009593517.1| PREDICTED: glycerol kinase [Nicotiana tomentosiformis]
Length=522

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +E+VF+GSIDQGTTSTRFIIYDR AR V SHQ+EFTQFYPQAGWVEHDP+EI+ESV++C+
Sbjct  3    DEEVFIGSIDQGTTSTRFIIYDRLARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            +KA+DKATADGHNV   LKAIG+TNQRETTVVWSKS+GLPLYNAIVWMD RT+SICRKLE
Sbjct  63   AKALDKATADGHNVDSGLKAIGLTNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRKLE  122

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NV+ + EAV
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVDGLSEAV  163



>ref|XP_009758692.1| PREDICTED: glycerol kinase [Nicotiana sylvestris]
Length=522

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +E+VF+GSIDQGTTSTRFIIYDR AR V SHQ+EFTQFYPQAGWVEHDP+EI+ESV++C+
Sbjct  3    DEEVFIGSIDQGTTSTRFIIYDRLARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            +KA+DKATADGHNV   LKAIG+TNQRETTVVWSKS+GLPLYNAIVWMD RT+SICRKLE
Sbjct  63   AKALDKATADGHNVDSGLKAIGLTNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRKLE  122

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NV+ + EAV
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVDGLSEAV  163



>ref|XP_006341400.1| PREDICTED: glycerol kinase-like [Solanum tuberosum]
Length=518

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            + +VF+GSIDQGTTSTRFIIYDR AR V SHQ+EFTQFYPQAGWVEHDP+EI+ESV++C+
Sbjct  3    DSEVFIGSIDQGTTSTRFIIYDRLARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            ++A+DKATA+GHNV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMDART+SICRKLE
Sbjct  63   ARALDKATANGHNVDSGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDARTSSICRKLE  122

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NVE + EAV
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVEGLNEAV  163



>ref|XP_002517681.1| glycerol kinase, putative [Ricinus communis]
 gb|EEF44845.1| glycerol kinase, putative [Ricinus communis]
Length=521

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K+E  F+G+IDQGTTSTRFIIY+R A  + SHQ+EFTQFYPQAGWVEHD +EILESVK
Sbjct  1    MAKQEPAFIGAIDQGTTSTRFIIYNRHANSIGSHQVEFTQFYPQAGWVEHDAMEILESVK  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KAVDKATADGHNV  LLKAIG+TNQRETTV+WSKS+G+PLYNAIVWMD RT+SICR
Sbjct  61   VCMAKAVDKATADGHNVDGLLKAIGLTNQRETTVIWSKSTGVPLYNAIVWMDVRTSSICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHF+ETCGLP+STYFSA+K+LWL+ENV+AVKEA+
Sbjct  121  KLEKELPGGRTHFIETCGLPLSTYFSAVKILWLMENVDAVKEAI  164



>ref|XP_004235901.1| PREDICTED: glycerol kinase [Solanum lycopersicum]
Length=522

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            + +VF+GSIDQGTTSTRFI YDR AR V SHQ+EFTQFYPQAGWVEHDP+EI+ESV++C+
Sbjct  3    DSEVFIGSIDQGTTSTRFIFYDRFARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            ++A+DKATA+GHNV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMDART+SICRKLE
Sbjct  63   ARALDKATANGHNVDSGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDARTSSICRKLE  122

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NVE + EAV
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVEGLNEAV  163



>ref|XP_011073388.1| PREDICTED: glycerol kinase-like [Sesamum indicum]
Length=522

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            ++VF+GSIDQGTTSTRF IYD +ARPV SHQIEFTQFYPQ+GWVEHDP+EILESV++C++
Sbjct  4    DEVFIGSIDQGTTSTRFFIYDSAARPVGSHQIEFTQFYPQSGWVEHDPMEILESVRLCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KAVDKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMD RT+S+CRKLEK
Sbjct  64   KAVDKATADGHNVDSGLKAIGLTNQRETTVIWSKSTGCPLYNAIVWMDVRTSSLCRKLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            ELPGG+THF+ETCGLPISTYFSA+K+LWLL+NV+AVKEAV
Sbjct  124  ELPGGKTHFLETCGLPISTYFSALKVLWLLDNVDAVKEAV  163



>ref|XP_008228677.1| PREDICTED: glycerol kinase [Prunus mume]
Length=530

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K + VFVGSIDQGTTSTRFIIYDRSARP+ SHQ+EFTQFYP+AGWVEHD +EILESV+VC
Sbjct  10   KTDDVFVGSIDQGTTSTRFIIYDRSARPIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EKEL GGRTHF+ETCGLPISTYFSA+KLLWLLENV+ VKEAV
Sbjct  130  EKELSGGRTHFLETCGLPISTYFSALKLLWLLENVDKVKEAV  171



>ref|XP_007215813.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
 gb|EMJ17012.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
Length=530

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K + VFVGSIDQGTTSTRFIIYDRSARPV SHQ+EFTQFYP+AGWVEHD +EILESV+VC
Sbjct  10   KTDDVFVGSIDQGTTSTRFIIYDRSARPVGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            ++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLIWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EKEL GGRTHF+ETCGLPISTYFSA+KLLWLLENV+ VKEAV
Sbjct  130  EKELSGGRTHFLETCGLPISTYFSALKLLWLLENVDKVKEAV  171



>gb|EYU21675.1| hypothetical protein MIMGU_mgv1a019703mg [Erythranthe guttata]
Length=510

 Score =   292 bits (747),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MS EE VFVGSIDQGTTSTRFIIYDRSA+PV SHQ+EFTQFYPQ+GWVEHDP EILESV+
Sbjct  1    MSGEE-VFVGSIDQGTTSTRFIIYDRSAKPVGSHQVEFTQFYPQSGWVEHDPTEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            +C++KAVDKATA GHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMD RT+ ICR
Sbjct  60   LCIAKAVDKATAAGHNVDSGLKAIGLTNQRETTVIWSKSTGSPLYNAIVWMDVRTSPICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHF E CGLPISTYFSA+K+LWLLENVEAVK+AV
Sbjct  120  KLEKELPGGRTHFTEACGLPISTYFSALKVLWLLENVEAVKKAV  163



>gb|KDP37048.1| hypothetical protein JCGZ_06104 [Jatropha curcas]
Length=523

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K E  F+G+IDQGTTSTRFIIYD+ AR V SHQ+EFTQFYPQAGWVEHDP+EILESV+
Sbjct  1    MAKNEPAFIGAIDQGTTSTRFIIYDQHARSVGSHQVEFTQFYPQAGWVEHDPMEILESVR  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            +C++KAVDKATADGHNV   LKAIGITNQRETT+VWSKSSG PL+NAIVWMDART++ICR
Sbjct  61   LCMAKAVDKATADGHNVDGALKAIGITNQRETTLVWSKSSGAPLHNAIVWMDARTSAICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KLEKELPGGRTHFVET GLPISTYFSAMK+LWL+ENV+AVK A
Sbjct  121  KLEKELPGGRTHFVETSGLPISTYFSAMKILWLMENVDAVKLA  163



>ref|XP_008461141.1| PREDICTED: glycerol kinase [Cucumis melo]
Length=523

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K E VFVGSIDQGTTSTRFIIYDR +RP+ SHQ EFTQFYP+AGWVEHDPVEILESVK
Sbjct  1    MAKAEDVFVGSIDQGTTSTRFIIYDRHSRPIGSHQAEFTQFYPEAGWVEHDPVEILESVK  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATA G+NV   LKAIG+TNQRETT+VWSKSSG PL+NAIVWMDART+SICR
Sbjct  61   VCMAKALDKATAAGYNVDNGLKAIGLTNQRETTLVWSKSSGSPLHNAIVWMDARTSSICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKEL GGRTHFV+TCGLPISTYFSA+KL+WL+ENVEAV+E++
Sbjct  121  KLEKELSGGRTHFVDTCGLPISTYFSAVKLIWLMENVEAVRESI  164



>ref|XP_009334628.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=530

 Score =   290 bits (741),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K ++VF+GSIDQGTTSTRFIIYDRSAR + SHQ+EFTQFYP+AGWVEHD +EILESV+VC
Sbjct  10   KPDEVFIGSIDQGTTSTRFIIYDRSARAIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EKEL GGRTHF ETCGLPISTYFSA+KLLWLLENV+ VKEAV
Sbjct  130  EKELSGGRTHFAETCGLPISTYFSALKLLWLLENVDNVKEAV  171



>ref|XP_010033977.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 ref|XP_010033978.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 gb|KCW53847.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
 gb|KCW53848.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
Length=522

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +EQV+VGS+DQGTTSTRFIIYDR+AR + SHQ+EFTQF P AGWVEHDP+EILE+V+VC+
Sbjct  3    DEQVYVGSLDQGTTSTRFIIYDRNARSIGSHQVEFTQFCPHAGWVEHDPMEILETVRVCM  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            +KAVDKATADGHNV   LKAIG+TNQRET +VW KS+G PLYNAIVWMDART+SICRKLE
Sbjct  63   AKAVDKATADGHNVDGGLKAIGLTNQRETALVWRKSTGHPLYNAIVWMDARTSSICRKLE  122

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KELPGGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVKEA+
Sbjct  123  KELPGGRTHFVETCGLPISTYFSAVKLLWLMENVDAVKEAI  163



>ref|XP_006492058.1| PREDICTED: glycerol kinase-like [Citrus sinensis]
Length=523

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K ++VF+G+IDQGTTSTRFIIYD  ARP+ SHQ+EFTQFYP+AGWVEH+P+EILESV+
Sbjct  1    MAKAKEVFIGAIDQGTTSTRFIIYDHQARPIGSHQVEFTQFYPEAGWVEHEPMEILESVR  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMDART+S+CR
Sbjct  61   VCMAKALDKATADGHNVDSGLKAIGLTNQRETTVLWSKSTGCPLYNAIVWMDARTSSVCR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGG+THF+E  GLPISTYFSA+KLLW++ENV+AVKEA+
Sbjct  121  KLEKELPGGKTHFLEAVGLPISTYFSAVKLLWMMENVDAVKEAI  164



>ref|XP_010063499.1| PREDICTED: glycerol kinase [Eucalyptus grandis]
 gb|KCW70740.1| hypothetical protein EUGRSUZ_F03908 [Eucalyptus grandis]
Length=524

 Score =   289 bits (739),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +E+V+VGSIDQGTTSTRFI+YDRSAR + SHQ+EFTQFYP+AGWVEHDP+EILESVKVC+
Sbjct  3    DEEVYVGSIDQGTTSTRFILYDRSARAIASHQVEFTQFYPEAGWVEHDPMEILESVKVCL  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            +KA+DKATA+G+NV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMDART+SICRKLE
Sbjct  63   AKAIDKATANGYNVDGGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDARTSSICRKLE  122

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +ELPGGRTHFVETCGLPISTYFSA+KLLWL ENV+AVK A+
Sbjct  123  QELPGGRTHFVETCGLPISTYFSAVKLLWLKENVDAVKVAM  163



>gb|KEH28675.1| glycerol kinase-like protein [Medicago truncatula]
Length=508

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 156/164 (95%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKE+ VF+G+IDQGT+S+RFIIYD+SA+P+ SHQ+EFTQFYPQAGWVEH+P+EILESVK
Sbjct  1    MSKED-VFIGAIDQGTSSSRFIIYDKSAQPIGSHQVEFTQFYPQAGWVEHNPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KAVDKATA+G NV + LKAIG+TNQRETT+VWSKS+G PL+NA+VWMD RTTS+CR
Sbjct  60   VCITKAVDKATANGFNVDKGLKAIGLTNQRETTLVWSKSTGAPLHNALVWMDVRTTSVCR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGRTHFVE+CGLPISTYFSAMKLLWL+ENV+AVKEA+
Sbjct  120  RLEKELSGGRTHFVESCGLPISTYFSAMKLLWLMENVDAVKEAI  163



>ref|XP_009336317.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338517.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338518.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=524

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K ++V +GSIDQGTTSTRFIIYDRSAR + SHQ+EFTQFYP+AGWVEHD +EILESV+VC
Sbjct  4    KPDEVLIGSIDQGTTSTRFIIYDRSARAIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  63

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  64   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  123

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EKEL GGRTHFVETCGLPISTYFSA+KLLWLLENV+ VKEAV
Sbjct  124  EKELSGGRTHFVETCGLPISTYFSALKLLWLLENVDKVKEAV  165



>ref|XP_003604353.1| Glycerol kinase [Medicago truncatula]
 gb|AES86550.1| glycerol kinase-like protein [Medicago truncatula]
Length=519

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 156/164 (95%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKE+ VF+G+IDQGT+S+RFIIYD+SA+P+ SHQ+EFTQFYPQAGWVEH+P+EILESVK
Sbjct  1    MSKED-VFIGAIDQGTSSSRFIIYDKSAQPIGSHQVEFTQFYPQAGWVEHNPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KAVDKATA+G NV + LKAIG+TNQRETT+VWSKS+G PL+NA+VWMD RTTS+CR
Sbjct  60   VCITKAVDKATANGFNVDKGLKAIGLTNQRETTLVWSKSTGAPLHNALVWMDVRTTSVCR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGRTHFVE+CGLPISTYFSAMKLLWL+ENV+AVKEA+
Sbjct  120  RLEKELSGGRTHFVESCGLPISTYFSAMKLLWLMENVDAVKEAI  163



>ref|NP_001031307.1| glycerol kinase [Arabidopsis thaliana]
 gb|AEE36408.1| glycerol kinase-like protein [Arabidopsis thaliana]
Length=482

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKENG-FIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAI  163



>ref|XP_011081977.1| PREDICTED: glycerol kinase [Sesamum indicum]
Length=522

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+VF+GSIDQGTTSTRFIIYDRSARP+ SHQ+EFTQFYPQ+GWVEHDP+EILESV+ C++
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDRSARPLASHQVEFTQFYPQSGWVEHDPMEILESVRECIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATA GHNV   LKAIG+TNQRETTVVWS+S+G PL+ AIVWMD RT+SICRKLEK
Sbjct  64   KAIDKATAAGHNVVSGLKAIGLTNQRETTVVWSRSTGCPLHKAIVWMDVRTSSICRKLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGRTHFVE CGLPISTYFSA+KLLWLLENV+AVKEAV
Sbjct  124  ELSGGRTHFVEACGLPISTYFSALKLLWLLENVDAVKEAV  163



>ref|XP_006427440.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
 gb|ESR40680.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
Length=523

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K ++VF+G+IDQGTTSTRFIIYD  ARP+ SHQ+EFTQFYP+AGWVEH+P+EILESV+
Sbjct  1    MAKAKEVFIGAIDQGTTSTRFIIYDHQARPIGSHQVEFTQFYPEAGWVEHEPMEILESVR  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMDART+S+CR
Sbjct  61   VCMAKALDKATADGHNVDSGLKAIGLTNQRETTVLWSKSTGCPLYNAIVWMDARTSSVCR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGG+THF++  GLPISTYFSA+KLLW++ENV+AVKEA+
Sbjct  121  KLEKELPGGKTHFLDAVGLPISTYFSAVKLLWMMENVDAVKEAI  164



>ref|XP_010429953.1| PREDICTED: glycerol kinase [Camelina sativa]
Length=522

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKESG-FIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VKEA+
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKEAI  163



>gb|ABK32113.1| At1g80460 [Arabidopsis thaliana]
Length=522

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKENG-FIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAI  163



>ref|NP_178161.1| glycerol kinase [Arabidopsis thaliana]
 sp|Q9M8L4.1|GLPK_ARATH RecName: Full=Glycerol kinase; Short=Glycerokinase; AltName: 
Full=ATP:glycerol 3-phosphotransferase; AltName: Full=Protein 
GLYCEROL INSENSITIVE 1; AltName: Full=Protein NONHOST RESISTANCE 
TO P. S. PHASEOLICOLA 1 [Arabidopsis thaliana]
 gb|AAF27123.1|AC018849_11 putative glycerol kinase; 69575-71670 [Arabidopsis thaliana]
 gb|AAO61418.1| glycerol kinase [Arabidopsis thaliana]
 dbj|BAH19502.1| AT1G80460 [Arabidopsis thaliana]
 gb|AEE36407.1| glycerol kinase-like protein [Arabidopsis thaliana]
Length=522

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKENG-FIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAI  163



>emb|CDX79385.1| BnaC06g19180D [Brassica napus]
Length=522

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVETCGLPISTYFSAMKLLWL+ENV+AVK+A+
Sbjct  124  ELSGGRSHFVETCGLPISTYFSAMKLLWLMENVDAVKDAI  163



>ref|XP_004135863.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 ref|XP_004163547.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 gb|KGN45247.1| hypothetical protein Csa_7G432280 [Cucumis sativus]
Length=523

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K E VFVGSIDQGTTS+RFIIYDR +RP+ SHQ EFTQFYP+AGWVEHDPVEILESVK
Sbjct  1    MAKAEDVFVGSIDQGTTSSRFIIYDRHSRPIGSHQAEFTQFYPEAGWVEHDPVEILESVK  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATA G+NV   LKAIG+TNQRETT+VWSKS+G PL++AIVWMDART+SICR
Sbjct  61   VCMAKALDKATAAGYNVDNGLKAIGLTNQRETTLVWSKSTGFPLHHAIVWMDARTSSICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKEL GGRTHFV+TCGLPISTYFSA+KL+WL+ENVEAV+E++
Sbjct  121  KLEKELSGGRTHFVDTCGLPISTYFSAVKLIWLMENVEAVRESI  164



>emb|CDY37598.1| BnaA02g19720D [Brassica napus]
Length=522

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E  F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYPQAGWVEHDP+EILESVKVC++
Sbjct  4    ENGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPQAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KAIDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+ +
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDGI  163



>ref|XP_008372701.1| PREDICTED: glycerol kinase [Malus domestica]
 ref|XP_008372702.1| PREDICTED: glycerol kinase [Malus domestica]
Length=530

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K ++V +GSIDQGTTSTRFIIYDRSAR + SHQ+EFTQFYP+AGWVEHD +EILESV+VC
Sbjct  10   KPDEVLIGSIDQGTTSTRFIIYDRSARAIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EKEL GGRTHFVETCGLPISTYFSA+KLLWLLENV+ VK+AV
Sbjct  130  EKELSGGRTHFVETCGLPISTYFSALKLLWLLENVDKVKKAV  171



>ref|XP_010097187.1| Glycerol kinase [Morus notabilis]
 gb|EXB67254.1| Glycerol kinase [Morus notabilis]
Length=523

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSK+E+VFVGSIDQGTTSTRFIIYDR A+PV S+Q+EFTQFYP+AGWVEHDP EILE+VK
Sbjct  1    MSKQEEVFVGSIDQGTTSTRFIIYDRFAKPVGSYQVEFTQFYPEAGWVEHDPREILETVK  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++ AV+KATADGH+V   LKAIG+TNQRETT+VWSKS+G PL+NA+VWMD RT+SICR
Sbjct  61   VCIATAVEKATADGHDVKNGLKAIGLTNQRETTLVWSKSTGAPLHNALVWMDVRTSSICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKEL GGR HFVETCGLPISTYFSA+KLLWL+ENV+AVK AV
Sbjct  121  KLEKELSGGRAHFVETCGLPISTYFSAVKLLWLIENVDAVKNAV  164



>emb|CDY39977.1| BnaC06g40550D [Brassica napus]
Length=522

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAI  163



>ref|XP_006385291.1| glycerol kinase family protein [Populus trichocarpa]
 gb|ERP63088.1| glycerol kinase family protein [Populus trichocarpa]
Length=519

 Score =   286 bits (732),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +E  F+GSIDQGT+STRFIIYDR++R V SHQ+EFTQ YPQAGWVEHDP+EILESVKVC+
Sbjct  5    KEAAFIGSIDQGTSSTRFIIYDRNSRCVGSHQVEFTQLYPQAGWVEHDPMEILESVKVCM  64

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            +KAVD A+A+GHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RTTS+CR+LE
Sbjct  65   AKAVDNASAEGHNVDAALKAIGLTNQRETTLVWSKSTGRPLYNAIVWMDVRTTSVCRRLE  124

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KE+PGGRTHFVETCGLPISTYFSAMKL+WL+ENV+AVKE +
Sbjct  125  KEMPGGRTHFVETCGLPISTYFSAMKLIWLMENVDAVKEGI  165



>ref|XP_009104463.1| PREDICTED: glycerol kinase [Brassica rapa]
 ref|XP_009104464.1| PREDICTED: glycerol kinase [Brassica rapa]
Length=522

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAI  163



>emb|CDX67948.1| BnaA07g19880D [Brassica napus]
Length=522

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAI  163



>emb|CDX87311.1| BnaA07g35620D [Brassica napus]
Length=522

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAM  163



>ref|XP_006389796.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27082.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=455

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AV++ +
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVQDGI  163



>ref|XP_009106746.1| PREDICTED: glycerol kinase-like [Brassica rapa]
Length=522

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAM  163



>ref|XP_006302136.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35034.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=444

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   ++GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKESG-YIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRET VVWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETIVVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+++
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDSI  163



>gb|EPS68115.1| hypothetical protein M569_06657, partial [Genlisea aurea]
Length=509

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+VFVGSIDQGTTSTRFIIYDR A+P+ SHQ+EFTQFYPQ GWVEHDP+EILESV++C++
Sbjct  1    EEVFVGSIDQGTTSTRFIIYDRFAKPIGSHQVEFTQFYPQYGWVEHDPMEILESVRLCIA  60

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATA+GHNV   LKAIG+TNQRET V+WSKS+GLPLYNA+VWMD RT+SICRKLE+
Sbjct  61   KAIDKATAEGHNVDSGLKAIGLTNQRETAVIWSKSTGLPLYNAVVWMDIRTSSICRKLEQ  120

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR HFVE CGLPISTYFSA+K++WLLENV++VKEAV
Sbjct  121  ELSGGRNHFVEACGLPISTYFSALKVMWLLENVDSVKEAV  160



>ref|XP_010472924.1| PREDICTED: glycerol kinase-like isoform X1 [Camelina sativa]
 ref|XP_010472925.1| PREDICTED: glycerol kinase-like isoform X2 [Camelina sativa]
Length=522

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   ++GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKESG-YIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VKEA+
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKEAI  163



>ref|XP_006389795.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27081.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=522

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AV++ +
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVQDGI  163



>ref|XP_010417705.1| PREDICTED: glycerol kinase-like [Camelina sativa]
Length=522

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   ++GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKESG-YIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VKEA+
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKEAI  163



>gb|KFK42437.1| hypothetical protein AALP_AA2G256400 [Arabis alpina]
Length=522

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   F+GS+DQGTTSTRFIIYDR AR V SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKENG-FIGSVDQGTTSTRFIIYDRDARSVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATA GHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART++ICR
Sbjct  60   VCIAKAIDKATAAGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSAICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+ +
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDGI  163



>ref|XP_002887828.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64087.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
Length=522

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKENG-FIGSIDQGTTSTRFIIYDHHARAVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAI  163



>ref|XP_011044862.1| PREDICTED: glycerol kinase [Populus euphratica]
Length=519

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +E  F+GSIDQGT+STRFIIYDR  R V SHQ+EFTQ YPQAGWVEHDP+EILESVKVC+
Sbjct  5    KEAAFIGSIDQGTSSTRFIIYDRDCRCVGSHQVEFTQLYPQAGWVEHDPMEILESVKVCM  64

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            +KAVDKA+A+GHNV   LKAIG+TNQRETT+VWSKS+G P YNAIVWMD RTTS+CR+LE
Sbjct  65   AKAVDKASAEGHNVDAALKAIGLTNQRETTLVWSKSTGRPFYNAIVWMDVRTTSVCRRLE  124

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KE+PGGRTHFVETCGLPISTYFSAMKL+WL+ENV+ VKE +
Sbjct  125  KEMPGGRTHFVETCGLPISTYFSAMKLIWLMENVDLVKEGI  165



>ref|XP_006302137.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35035.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=522

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+KE   ++GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EILESVK
Sbjct  1    MAKESG-YIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHNV   LKAIG+T+QRET VVWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETIVVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+++
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDSI  163



>ref|XP_004506960.1| PREDICTED: glycerol kinase-like [Cicer arietinum]
Length=519

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKE   F+GSIDQGT+STRF+IYD+SA+ +  HQ+EFTQFYP+AGWVEHDPVEILESVK
Sbjct  1    MSKE-NFFIGSIDQGTSSTRFVIYDKSAKQIGFHQVEFTQFYPEAGWVEHDPVEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KAVDKATADG NV + LKAIG+TNQRETT++WSKS+G+PL+NAIVWMDART SICR
Sbjct  60   VCIAKAVDKATADGFNVDKGLKAIGLTNQRETTLLWSKSTGVPLHNAIVWMDARTASICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGRTHFVE+CGLPISTYFSA+KLLWL+ENV+ VKEA+
Sbjct  120  RLEKELSGGRTHFVESCGLPISTYFSALKLLWLMENVDPVKEAI  163



>ref|XP_010537930.1| PREDICTED: glycerol kinase [Tarenaya hassleriana]
Length=522

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            ++ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQ+YP+AGWVEH+P+EILESVK+CV+
Sbjct  4    DKGFIGSIDQGTTSTRFIIYDHHARSVGSHQVEFTQYYPEAGWVEHNPMEILESVKLCVA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KAVDKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPLYNAIVWMDART+SIC +LEK
Sbjct  64   KAVDKATADGHNVDAGLKAIGLTDQRETTVVWSKSTGLPLYNAIVWMDARTSSICMRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGRTHFV TCGLPISTYFSA+KL+WL+ENV+AVKEA+
Sbjct  124  ELSGGRTHFVRTCGLPISTYFSALKLIWLMENVDAVKEAI  163



>ref|XP_007135771.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
 gb|ESW07765.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
Length=521

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MS E  VFVG+IDQGT+S+RFIIYD + + +  H +EFTQFYPQAGWVEHD  EILESVK
Sbjct  1    MSSEGDVFVGAIDQGTSSSRFIIYDTAGKVIGCHHVEFTQFYPQAGWVEHDATEILESVK  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VCV+KAVDKATADG NV + L+AIG+TNQRETTVVWSKSSGLPLYNAIVWMDART+SICR
Sbjct  61   VCVAKAVDKATADGFNVDKGLRAIGLTNQRETTVVWSKSSGLPLYNAIVWMDARTSSICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR HFVE+CGLPISTYFSA+KLLWL+ENV AVKEA+
Sbjct  121  RLEKELSGGRNHFVESCGLPISTYFSALKLLWLMENVLAVKEAI  164



>ref|XP_006652916.1| PREDICTED: glycerol kinase-like [Oryza brachyantha]
Length=538

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            ++ EE+V+V SIDQGTTSTRFIIYDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+ESVK
Sbjct  8    VAAEEEVYVASIDQGTTSTRFIIYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVK  67

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C++ A+DKAT DGHNV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR
Sbjct  68   TCMANALDKATTDGHNVDAGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICR  127

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LE EL GGRTHFVETCGLPISTYFSA+K+LWL+ENV+AVK AV
Sbjct  128  RLESELSGGRTHFVETCGLPISTYFSALKVLWLIENVDAVKNAV  171



>gb|AAR88660.1| glycerol kinase [Pandanus amaryllifolius]
Length=531

 Score =   281 bits (720),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+  ++VFV +IDQGTTSTRFIIYD+ A+ V SHQ+EFTQFYP+AGWVEH+P+EILESV+
Sbjct  1    MAGRKEVFVAAIDQGTTSTRFIIYDQDAKAVASHQVEFTQFYPEAGWVEHNPMEILESVR  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADG+NV   L+AIG+TNQRETTV WSKS+GLPLYNAIVWMD RT+SICR
Sbjct  61   VCMAKALDKATADGYNVDGGLRAIGLTNQRETTVAWSKSTGLPLYNAIVWMDVRTSSICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGRTHFVETCGLPISTYFSA+K+LWL+EN+ AVKEA+
Sbjct  121  RLEKELSGGRTHFVETCGLPISTYFSALKILWLMENISAVKEAI  164



>ref|XP_004303284.1| PREDICTED: glycerol kinase-like [Fragaria vesca subsp. vesca]
Length=522

 Score =   281 bits (719),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKE  V+VGSIDQGTTSTRFIIYDR +R V SHQ+EF Q YP+AGWVEHDP+EILESV+
Sbjct  1    MSKE-AVYVGSIDQGTTSTRFIIYDRDSRTVGSHQVEFNQIYPEAGWVEHDPMEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATADGHN+   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+ +CR
Sbjct  60   VCMAKALDKATADGHNIDSGLKAIGLTNQRETTLIWSKSTGSPLYNAIVWMDARTSGVCR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKEL GGRTHF E CGLPISTYFSA+KLLWL+ENV+AVKEA+
Sbjct  120  KLEKELSGGRTHFSEVCGLPISTYFSAVKLLWLMENVDAVKEAI  163



>gb|AIT39761.1| glycerol kinase, partial [Chrysanthemum boreale]
Length=514

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  85   GSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAVDK  264
            GSIDQGTTSTRFIIYD++A+ + SHQ+EFTQF PQAGWVEHDPVEILESVK+C+SKA+DK
Sbjct  1    GSIDQGTTSTRFIIYDKNAQSIGSHQVEFTQFCPQAGWVEHDPVEILESVKMCISKAIDK  60

Query  265  ATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELPGG  444
            ATADG+NV   L AIGITNQRETTVVWSKS+GLPLYNAIVWMD RTTSICR+LE EL GG
Sbjct  61   ATADGYNVDNGLTAIGITNQRETTVVWSKSTGLPLYNAIVWMDVRTTSICRRLETELSGG  120

Query  445  RTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +THF+E+CGLPISTYFSA+KLLWLLENV AVKEAV
Sbjct  121  KTHFLESCGLPISTYFSALKLLWLLENVNAVKEAV  155



>gb|EMS68114.1| Glycerol kinase [Triticum urartu]
Length=479

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
             KEE+V+V SIDQGTTSTRFIIYDR A PV SHQ+EF Q YP+AGWVEHDP+EI+ESVKV
Sbjct  5    GKEEEVYVASIDQGTTSTRFIIYDRHASPVASHQLEFKQHYPEAGWVEHDPMEIMESVKV  64

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C++K ++KA A G NV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMD RT+SICR+
Sbjct  65   CMAKTLEKAAASGLNVDAGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRR  124

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            LE EL GGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVK+AV
Sbjct  125  LESELSGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAV  167



>ref|XP_010691126.1| PREDICTED: glycerol kinase [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K E  F+GSIDQGTTSTRFIIYD SA+ + SHQIEFTQFYP AGWVEHDP+EILESV+
Sbjct  1    MAKSEDTFIGSIDQGTTSTRFIIYDGSAKTIGSHQIEFTQFYPVAGWVEHDPMEILESVR  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            +C++KA+DKATA+GHNV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMD RT+SICR
Sbjct  61   ICITKALDKATAEGHNVDSGLKAIGITNQRETTVIWSKSTGLPLYNAIVWMDVRTSSICR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEK+L GGR HF  +CGLPISTYFSA KLLWLLENVE V++AV
Sbjct  121  RLEKDLSGGRNHFEPSCGLPISTYFSATKLLWLLENVEPVRDAV  164



>gb|KHN01314.1| Putative glycerol kinase [Glycine soja]
Length=519

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKE+ VFVG+IDQGT+S+RFIIYD     V  H +EFTQFYPQAGWVEHDP+EILESVK
Sbjct  1    MSKED-VFVGAIDQGTSSSRFIIYDAKTGVVGCHHVEFTQFYPQAGWVEHDPMEILESVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VCV+KAVDKATADG NV + LKAIG+TNQRETT++WSKS+GLPL+NAIVWMDART+SICR
Sbjct  60   VCVAKAVDKATADGFNVDKGLKAIGLTNQRETTLLWSKSTGLPLHNAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL GGR HFVE+CGLPISTYFSA+KLLWL+ENV+AVKEA+
Sbjct  120  RLEKELSGGRNHFVESCGLPISTYFSALKLLWLMENVDAVKEAI  163



>gb|KHG30375.1| Glycerol kinase [Gossypium arboreum]
Length=550

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = +1

Query  34   TREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDP  213
            T    ++KMSKE Q F+ SIDQGTTSTRF IYD+SAR + SH +EFTQFYP+AGWVEHDP
Sbjct  21   TNNPQKKKMSKE-QTFIASIDQGTTSTRFFIYDKSARIIGSHHVEFTQFYPEAGWVEHDP  79

Query  214  VEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  393
            +EILESV+ C++KA+DKATADG+NV   LKAIG+TNQRET VVWSKS+G PLYNAIVWMD
Sbjct  80   MEILESVRSCMTKALDKATADGYNVDSGLKAIGLTNQRETVVVWSKSTGSPLYNAIVWMD  139

Query  394  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
             RT+SICRKLEKELPGGRTHFVE+CGLP+STYFSA+KLLWL+EN E V+ A+
Sbjct  140  VRTSSICRKLEKELPGGRTHFVESCGLPLSTYFSAVKLLWLMENKEEVRAAI  191



>ref|XP_003580683.1| PREDICTED: glycerol kinase [Brachypodium distachyon]
Length=531

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            EE+V+V SIDQGTTSTRFI+YDR ARPV SHQ+EF Q YP+AGWVEHDP+EI+ESV+ C+
Sbjct  7    EEEVYVASIDQGTTSTRFIVYDRHARPVASHQLEFKQHYPEAGWVEHDPMEIMESVRACM  66

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
            + A++KA ADG NV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMD RT+SICR+LE
Sbjct  67   ANALEKAAADGLNVSAGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDVRTSSICRRLE  126

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
             EL GGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVK+AV
Sbjct  127  GELAGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAV  167



>ref|XP_010244913.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=541

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = +1

Query  52   RKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILES  231
            ++M KEE VF+GS+DQGT+STRFIIYD+S RPV SHQIEFTQF  + GWVEH+P+EIL+S
Sbjct  11   KEMEKEE-VFIGSVDQGTSSTRFIIYDQSCRPVASHQIEFTQFCCEDGWVEHNPMEILQS  69

Query  232  VKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSI  411
            V++C+ KA+DKAT DGHNV + LKAIG+TNQRETTVVWSKSSG PLYNAIVW+D RT+SI
Sbjct  70   VRLCMEKAIDKATVDGHNVEKGLKAIGLTNQRETTVVWSKSSGCPLYNAIVWLDVRTSSI  129

Query  412  CRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            CR+LE++LPGGRTHFVETCGLPISTYFSA+KLLWLLENV AVK AV
Sbjct  130  CRRLEEDLPGGRTHFVETCGLPISTYFSAVKLLWLLENVTAVKHAV  175



>ref|XP_010913342.1| PREDICTED: glycerol kinase-like [Elaeis guineensis]
Length=537

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            + E+V+VGSIDQGT+STRF+IYDR A P+ SHQ+EFTQFYP+AGWVE DP+EILESVK+C
Sbjct  6    ENEEVYVGSIDQGTSSTRFVIYDREANPIASHQVEFTQFYPEAGWVEQDPMEILESVKMC  65

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
             +KA+DKATADG+NV R LKAIGI NQRETTVVWSKSSGLPL+NAIVWMDART+S+CR+L
Sbjct  66   TAKALDKATADGYNVDRGLKAIGIANQRETTVVWSKSSGLPLHNAIVWMDARTSSVCRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            E ELPGG+ HF++TCGLPIST FSA KLLWL+E VEAVK AV
Sbjct  126  ESELPGGKNHFLDTCGLPISTCFSATKLLWLMETVEAVKLAV  167



>ref|NP_001237303.1| glycerol kinase [Glycine max]
 gb|AAR86687.1| glycerol kinase [Glycine max]
Length=519

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E VFVG+IDQGT+S+RFIIYD     V  H +EFTQFYPQAGWVEHDP+EILESVKVCV+
Sbjct  4    EDVFVGAIDQGTSSSRFIIYDAKTGVVGCHHVEFTQFYPQAGWVEHDPMEILESVKVCVA  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KAVDKATADG NV + LKAIG+TNQRETT++WSKS+GLPL+NAIVWMDART+SICR+LEK
Sbjct  64   KAVDKATADGFNVDKGLKAIGLTNQRETTLLWSKSTGLPLHNAIVWMDARTSSICRRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR HFVE+CGLPISTYFSA+KLLWL+ENV+AVKEA+
Sbjct  124  ELSGGRNHFVESCGLPISTYFSALKLLWLMENVDAVKEAI  163



>ref|XP_009407371.1| PREDICTED: glycerol kinase [Musa acuminata subsp. malaccensis]
Length=531

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MS  E+ F+GSIDQGTTSTRFIIYDR A+P+ SHQ+EFTQFYP+AGWVEHDP EI++SV+
Sbjct  1    MSGGEEFFIGSIDQGTTSTRFIIYDRHAQPIASHQVEFTQFYPEAGWVEHDPTEIVQSVR  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            VC++KA+DKATA GHNV   L+AIG+TNQRETTV+WS+S+GLPLYNAIVWMDART++IC 
Sbjct  61   VCMAKALDKATAAGHNVDAGLRAIGLTNQRETTVIWSRSTGLPLYNAIVWMDARTSTICH  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +L ++LPGGR HFV TCGLPISTYFSA+K++WLLENV+ V++AV
Sbjct  121  RLVRDLPGGRDHFVPTCGLPISTYFSALKIMWLLENVDVVRDAV  164



>gb|KJB66375.1| hypothetical protein B456_010G138000 [Gossypium raimondii]
Length=522

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MSKE Q F+ SIDQGTTSTRF IYD+SAR + SH +EFTQFYP+AGWVEHDP+EILESV+
Sbjct  1    MSKE-QTFIASIDQGTTSTRFFIYDKSARIIGSHHVEFTQFYPEAGWVEHDPMEILESVR  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C++KA+DKATADG+NV   LKAIG+TNQRET VVWSKS+G PLYNAIVWMD RT+SICR
Sbjct  60   SCMTKALDKATADGYNVDSGLKAIGLTNQRETVVVWSKSTGSPLYNAIVWMDVRTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            KLEKELPGGRTHFVE+CGLP+STYFSA+KLLWL+EN E V+ A+
Sbjct  120  KLEKELPGGRTHFVESCGLPLSTYFSAVKLLWLMENKEEVRAAI  163



>gb|AGH08245.1| glycerol kinase [Triticum aestivum]
Length=534

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
             K E+V+V SIDQGTTSTRFIIYDR A PV SHQ+EF Q YP+AGWVEHDP+EI+ESVKV
Sbjct  5    GKGEEVYVASIDQGTTSTRFIIYDRHASPVASHQLEFKQHYPEAGWVEHDPMEIIESVKV  64

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C++K ++KA A+G NV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMD RT+SICR+
Sbjct  65   CMAKTLEKAAANGLNVDAGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRR  124

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            LE EL GGRTHFVETCGLP+STYFSA+KLLWL+ENV+AVK+AV
Sbjct  125  LESELSGGRTHFVETCGLPLSTYFSALKLLWLMENVDAVKDAV  167



>ref|XP_010907017.1| PREDICTED: glycerol kinase [Elaeis guineensis]
Length=521

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+VF+GSIDQGTTSTRFIIYDR A+PV SHQ+EFTQ YP+AGWVEHDP EILESV+VC+ 
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDREAKPVASHQVEFTQHYPEAGWVEHDPTEILESVRVCME  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KAV+KA A G  V   +KAIG+TNQRETTV+WSKS+GLPLYNAIVWMDART+SIC++LEK
Sbjct  64   KAVEKAAAGGRQVKGRVKAIGLTNQRETTVMWSKSTGLPLYNAIVWMDARTSSICKRLEK  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR HFVETCGLPISTYFSA+K+LWL+ENV+AV EAV
Sbjct  124  ELSGGRNHFVETCGLPISTYFSALKILWLMENVDAVGEAV  163



>ref|XP_008795833.1| PREDICTED: glycerol kinase-like [Phoenix dactylifera]
Length=538

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            V+VGSIDQGT+STRF+IYDR A+P+ SHQ+EFTQFYP+AGWVE DP+EILESVKVC +KA
Sbjct  10   VYVGSIDQGTSSTRFVIYDREAKPIASHQVEFTQFYPEAGWVEQDPMEILESVKVCTAKA  69

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            VDKATADG+NV R LKAIGI NQRETTVVWSKSSGLP ++AIVWMD RT+SICR+LE EL
Sbjct  70   VDKATADGYNVDRGLKAIGIANQRETTVVWSKSSGLPFHHAIVWMDVRTSSICRRLESEL  129

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            PGG+ HF++ CGLPISTYFSA+KLLWL+E VEAVK AV
Sbjct  130  PGGKNHFLDACGLPISTYFSAIKLLWLMETVEAVKLAV  167



>ref|XP_004977029.1| PREDICTED: glycerol kinase-like [Setaria italica]
Length=523

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+V+V +IDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+E+VKVC+ 
Sbjct  6    EEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIIETVKVCMK  65

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            +AVDKA    +NV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ +CR+LE 
Sbjct  66   EAVDKAKDGKYNVVAGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPVCRRLES  125

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGRTHFVETCGLPISTYFSA+KLLWL+ENVEAVK+AV
Sbjct  126  ELSGGRTHFVETCGLPISTYFSALKLLWLMENVEAVKDAV  165



>ref|NP_001132106.2| uncharacterized protein LOC100193522 [Zea mays]
 gb|ACG42404.1| glycerol kinase [Zea mays]
 gb|ACF80804.2| unknown [Zea mays]
 tpg|DAA35707.1| TPA: glycerol kinase [Zea mays]
Length=523

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
             K ++V+V +IDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+E+VKV
Sbjct  3    GKGKEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIIETVKV  62

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C+ +AV KA    HNV   LKAIGITNQRETTV+WSKS+G PLYNAIVWMDART+ +CR+
Sbjct  63   CMKEAVGKAKDGKHNVVAGLKAIGITNQRETTVMWSKSTGRPLYNAIVWMDARTSPVCRR  122

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            LE EL GGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVK+AV
Sbjct  123  LENELSGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAV  165



>ref|XP_008779160.1| PREDICTED: glycerol kinase-like isoform X2 [Phoenix dactylifera]
Length=520

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+VF+GSIDQGTTSTRFIIYDR A+P+ SHQ+EFTQ+YP+A ++  DP EILESV+VC+ 
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDREAKPIASHQVEFTQYYPEAEYLT-DPAEILESVRVCME  62

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KAV+KA A G  V   LKAIG+TNQRETTV+WSKS+GLPLYNAIVWMDART+SIC++LEK
Sbjct  63   KAVEKAAAGGRKVEGRLKAIGLTNQRETTVMWSKSTGLPLYNAIVWMDARTSSICKRLEK  122

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGR HFVETCGLPISTYFSA+K+LWL+ENV+AV+EAV
Sbjct  123  ELSGGRNHFVETCGLPISTYFSALKILWLMENVDAVREAV  162



>gb|AAR18687.1| glycerol kinase-like protein [Oryza sativa Japonica Group]
 gb|EAZ32203.1| hypothetical protein OsJ_16410 [Oryza sativa Japonica Group]
Length=529

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+V+V SIDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+ESVK+C++
Sbjct  3    EEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKICMA  62

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKA ADGHN+   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR+LE 
Sbjct  63   KALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRLES  122

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +L GGRTHFVETCGLPISTYFSA+K+LWL+ENV+AVK AV
Sbjct  123  DLSGGRTHFVETCGLPISTYFSALKVLWLIENVDAVKNAV  162



>gb|EMT01355.1| Putative glycerol kinase [Aegilops tauschii]
Length=561

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 146/190 (77%), Gaps = 27/190 (14%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAG---------------  195
             K E+V+V SIDQGTTSTRFIIYDR A PV SHQ+EF Q YP+AG               
Sbjct  5    GKGEEVYVASIDQGTTSTRFIIYDRHASPVASHQLEFKQHYPEAGCDVVSPLGSTDLCLK  64

Query  196  ------------WVEHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTV  339
                        WVEHDP+EI+ESVKVC++K ++KA A+G NV   LKAIGITNQRETTV
Sbjct  65   LYLCVCYMILFIWVEHDPMEIIESVKVCMAKTLEKAAANGLNVDAGLKAIGITNQRETTV  124

Query  340  VWSKSSGLPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLL  519
            VWSKS+GLPLYNAIVWMD RT+SICR+LE EL GGRTHFVETCGLPISTYFSA+KLLWL+
Sbjct  125  VWSKSTGLPLYNAIVWMDVRTSSICRRLESELSGGRTHFVETCGLPISTYFSALKLLWLM  184

Query  520  ENVEAVKEAV  549
            ENV+AVK+AV
Sbjct  185  ENVDAVKDAV  194



>ref|XP_002448637.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
 gb|EES12965.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
Length=523

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+V+V +IDQGTTSTRFI+YDR A+PV SHQ+EFTQ YP+AGWVEHDP+EI+E+V VC++
Sbjct  6    EEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFTQHYPEAGWVEHDPMEIIETVMVCMN  65

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            +AV KA    +NV   LKAIGITNQRETTV+WSKS+G PLYNAIVWMDART+ +CR+LE 
Sbjct  66   EAVGKAKDGKYNVVAGLKAIGITNQRETTVMWSKSTGHPLYNAIVWMDARTSPVCRRLES  125

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            EL GGRTHFVE CGLPISTYFSA+KLLWL+ENV+AVK+A+
Sbjct  126  ELSGGRTHFVERCGLPISTYFSALKLLWLMENVDAVKDAI  165



>emb|CAJ86056.1| H0821G03.7 [Oryza sativa Indica Group]
 emb|CAH68428.1| H0811D08.16 [Oryza sativa Indica Group]
Length=529

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+V+V SIDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+ESVK+C++
Sbjct  3    EEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKICMA  62

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKA ADGHN+   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR+LE 
Sbjct  63   KALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRLES  122

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +L GGRTHFV+TCGLPISTYFSA+K+LWL+ENV+AVK AV
Sbjct  123  DLSGGRTHFVKTCGLPISTYFSALKVLWLIENVDAVKNAV  162



>ref|NP_001054071.1| Os04g0647800 [Oryza sativa Japonica Group]
 dbj|BAF15985.1| Os04g0647800 [Oryza sativa Japonica Group]
Length=529

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+V+V SIDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+ESVK+C++
Sbjct  3    EEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKICMA  62

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KA+DKA ADGHN+   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR+LE 
Sbjct  63   KALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRLES  122

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +L GGRTHFVETCGL ISTYFSA+K+LWL+ENV+AVK AV
Sbjct  123  DLSGGRTHFVETCGLAISTYFSALKVLWLIENVDAVKNAV  162



>gb|ABK24550.1| unknown [Picea sitchensis]
Length=534

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +1

Query  49   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILE  228
            E  M KEE   +GSIDQGTTSTRFIIYD+SA+ V +HQ+EFTQ  PQAGWVEHDP+EILE
Sbjct  2    ESTMEKEE-ALIGSIDQGTTSTRFIIYDQSAKVVAAHQVEFTQICPQAGWVEHDPLEILE  60

Query  229  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  408
            +VK+C+ +A +KA A G  V   LKAIGITNQRETT+VWS+S+GLPLYNAIVWMDART+S
Sbjct  61   TVKICMQEACEKAKAAGRAVETGLKAIGITNQRETTIVWSRSTGLPLYNAIVWMDARTSS  120

Query  409  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            ICR+LEKEL  G+ HFVET GLPISTYFSA+KL+WLLE+V+AVK AV
Sbjct  121  ICRRLEKELQNGKNHFVETTGLPISTYFSALKLMWLLESVDAVKTAV  167



>gb|ABK25673.1| unknown [Picea sitchensis]
Length=530

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M KEE  F+GSIDQGTTSTRF+IYD+ A+ V +HQ+EFTQ  PQAGWVEHDP+EILE+VK
Sbjct  1    MEKEE-TFIGSIDQGTTSTRFMIYDQYAKVVATHQVEFTQICPQAGWVEHDPLEILETVK  59

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            +C+ +A +KA   G  V   LKAIGITNQRETT+VWS+S+GLPLYNAIVWMDART+SICR
Sbjct  60   ICMQEACEKAKVAGKAVETGLKAIGITNQRETTIVWSRSTGLPLYNAIVWMDARTSSICR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +LEKEL  G+ HFVET GLPISTYFSA+KL+WLLE+V+ VK AV
Sbjct  120  RLEKELQNGKNHFVETTGLPISTYFSALKLMWLLESVDTVKTAV  163



>ref|XP_002984877.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
 gb|EFJ14127.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
Length=519

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +   FV +IDQGTTSTRFI+YD+ A+PV SHQ+EF Q YPQAGWVEHDP+EIL+SVKVC+
Sbjct  3    DAAAFVAAIDQGTTSTRFILYDQDAKPVASHQLEFEQIYPQAGWVEHDPLEILKSVKVCM  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
             + ++KA + G +V   +KAIGITNQRET+++WSKS+G PLYNAIVWMD RT+SIC++LE
Sbjct  63   EETLNKAPSKGLSVA--VKAIGITNQRETSIIWSKSTGKPLYNAIVWMDGRTSSICKRLE  120

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            + L GG  HFVE+CGLPISTYFSA+KLLWLLE V  VK AV
Sbjct  121  ENLSGGSKHFVESCGLPISTYFSALKLLWLLETVPEVKSAV  161



>ref|XP_002985935.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
 gb|EFJ13112.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
Length=519

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +   FV +IDQGTTSTRFI+YD+ A+PV SHQ+EF Q YPQAGWVEHDP+EIL+SVKVC+
Sbjct  3    DAAAFVAAIDQGTTSTRFILYDQDAKPVASHQLEFEQIYPQAGWVEHDPLEILKSVKVCM  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
             + ++KA + G +    +KAIGITNQRET+++WSKS+G PLYNAIVWMD RT+SIC++LE
Sbjct  63   EETLNKAASKGLSFA--VKAIGITNQRETSIIWSKSTGKPLYNAIVWMDGRTSSICKRLE  120

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            + L GG  HFVE+CGLPISTYFSA+KLLWLLE V  VK AV
Sbjct  121  ENLSGGSKHFVESCGLPISTYFSALKLLWLLETVPEVKSAV  161



>ref|XP_010911625.1| PREDICTED: glycerol kinase-like [Elaeis guineensis]
Length=131

 Score =   209 bits (532),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            + E+V+VGSIDQGT+STRF+IYDR A P+ SHQ+EFTQFYP+AGWVE DP+EILESVK+C
Sbjct  6    ENEEVYVGSIDQGTSSTRFVIYDREANPIASHQVEFTQFYPEAGWVEQDPMEILESVKMC  65

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             +KA+DKATADG+NV R LKAIGI NQRETTVVWSKSSGLPL+NAIVWMDART+S+CR
Sbjct  66   TAKALDKATADGYNVDRGLKAIGIANQRETTVVWSKSSGLPLHNAIVWMDARTSSVCR  123



>gb|AEZ00842.1| putative glycerol kinase protein, partial [Elaeis guineensis]
Length=125

 Score =   207 bits (526),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+VF+GSIDQGTTSTRFIIYDR A+PV SHQ+EFTQ YP+AGWVEHDP EIL+SV+VC+ 
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDREAKPVASHQVEFTQHYPEAGWVEHDPTEILKSVRVCME  63

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            KAV+KA A G  V   +KAIG+TNQRETTV+WSKS+GLPLYNAIVWMDART+SIC++LEK
Sbjct  64   KAVEKAVAGGRQVKGRVKAIGLTNQRETTVMWSKSTGLPLYNAIVWMDARTSSICKRLEK  123

Query  430  EL  435
            EL
Sbjct  124  EL  125



>ref|XP_001763943.1| predicted protein [Physcomitrella patens]
 gb|EDQ71347.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 130/169 (77%), Gaps = 2/169 (1%)
 Frame = +1

Query  43   EGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEI  222
            +GE++   +   +V +IDQGTTSTRFI+YD +A+ VVSHQ+EFTQ YPQAGWVEHDP+EI
Sbjct  2    KGEKR--PDTATYVAAIDQGTTSTRFIVYDTAAKVVVSHQLEFTQIYPQAGWVEHDPMEI  59

Query  223  LESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDART  402
            L++V+  +  A+ K    G ++   LKAIGITNQRETTV+WS+S+G P YNA+VWMD+RT
Sbjct  60   LDTVRKAMEGALAKGKEKGLDILDNLKAIGITNQRETTVIWSRSTGKPYYNAVVWMDSRT  119

Query  403  TSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            +SICR LEK+ P G   FV TCGLPI  YFSA K+LWL+E+V  VK  V
Sbjct  120  SSICRHLEKQHPEGGRRFVSTCGLPIHPYFSATKILWLMEHVPEVKAGV  168



>gb|KDO47427.1| hypothetical protein CISIN_1g0098681mg, partial [Citrus sinensis]
Length=477

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  196  WVEHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYN  375
            WVEH+P+EILESV+VC++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYN
Sbjct  1    WVEHEPMEILESVRVCMAKALDKATADGHNVDSGLKAIGLTNQRETTVLWSKSTGCPLYN  60

Query  376  AIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            AIVWMDART+S+CRKLEKELPGG+THF+E  GLPISTYFSA+KLLW++ENV+AVKEA+
Sbjct  61   AIVWMDARTSSVCRKLEKELPGGKTHFLEAVGLPISTYFSAVKLLWMMENVDAVKEAI  118



>gb|KIX03908.1| glycerol kinase [Rhinocladiella mackenziei CBS 650.93]
Length=512

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSMQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHNV   +KA+GITNQRETTVVW+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVKQFETQGHNV-NTIKAVGITNQRETTVVWNKETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL++ L  G     + CG+P+STY S  KLLWLLENV  V EA
Sbjct  120  KLKQRL--GADKLTDICGIPLSTYPSVGKLLWLLENVPQVNEA  160



>gb|KIW59223.1| glycerol kinase [Exophiala xenobiotica]
 gb|KIW59224.1| glycerol kinase, variant [Exophiala xenobiotica]
Length=512

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSIQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C++ AV +    GHN+   +KA+GITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ECINGAVKQFETQGHNINS-IKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL++ L  G     + CGLP+STY S  KLLWLLEN   VK+A
Sbjct  120  KLKQRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKQA  160



>ref|XP_007734806.1| glycerol kinase [Capronia epimyces CBS 606.96]
 gb|EXJ82683.1| glycerol kinase [Capronia epimyces CBS 606.96]
Length=512

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    +VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ+GW EHDP+EI+ SV+
Sbjct  1    MGSVPEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQSGWHEHDPLEIVTSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+ +A ++    GHN+   +KAIGITNQRETTV+W K +G PLYNAIVW D RT ++ R
Sbjct  61   RCIDEACNQFENQGHNLDS-IKAIGITNQRETTVLWDKETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G     E CGLP+STY S  KLLWLLENV  VK A
Sbjct  120  KLKHRL--GSDKLTEICGLPLSTYPSVGKLLWLLENVPKVKAA  160



>dbj|BAH56977.1| AT1G80460 [Arabidopsis thaliana]
Length=423

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +1

Query  214  VEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  393
            +EILESVKVC++KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMD
Sbjct  1    MEILESVKVCIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMD  60

Query  394  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            ART+SICR+LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+
Sbjct  61   ARTSSICRRLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAI  112



>ref|XP_006852853.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
 gb|ERN14320.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
Length=477

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  196  WVEHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYN  375
            WVEHDP+EILESV+ C+ KA+DKAT  GHNV   LKAIGITNQRETT+VWSKS+G PLYN
Sbjct  7    WVEHDPMEILESVRDCMEKALDKATVAGHNVESGLKAIGITNQRETTLVWSKSTGDPLYN  66

Query  376  AIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            AIVWMD RT+SICR+LE+ LPGGRTHF ET GLP+STYFSA+KL+WLLENV+AVK A
Sbjct  67   AIVWMDVRTSSICRRLEESLPGGRTHFTETTGLPVSTYFSALKLIWLLENVDAVKAA  123



>ref|XP_003072057.1| glycerol kinase, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER29912.1| glycerol kinase, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW18978.1| glycerol kinase [Coccidioides posadasii str. Silveira]
Length=510

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 120/163 (74%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K+ + F+GSIDQGTTS+RF+I++++   V SHQ+EFTQ YPQ GW EHDP EI+ SV+
Sbjct  1    MAKDIESFIGSIDQGTTSSRFLIFNKNGEVVASHQLEFTQIYPQPGWHEHDPKEIVTSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      G+NV   +KA+GITNQRETTVVW K +G PLYNAIVW D RT S+ R
Sbjct  61   RCIDGAVSSFEHQGYNV-ESIKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQSLIR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L++ L  G  H  E CGLP+STY S  KLLWLLENV  VK+A
Sbjct  120  RLKRRLGHGEVH--EHCGLPLSTYPSVGKLLWLLENVPKVKDA  160



>gb|KIW39098.1| glycerol kinase [Exophiala oligosperma]
Length=523

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 114/157 (73%), Gaps = 3/157 (2%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            VFVGSIDQGTTSTRF+I++R   PV SHQIEF Q YPQ+GW EHDP+EI+ SV+ C+  A
Sbjct  19   VFVGSIDQGTTSTRFLIFNRDGEPVASHQIEFKQIYPQSGWHEHDPLEIITSVEQCIEGA  78

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            V      GH+  + +KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RK++  L
Sbjct  79   VKDFETQGHSSAK-IKAVGITNQRETTVVWDYETGEPLYNAIVWTDTRTQALIRKIKLRL  137

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
              G     E CGLP+STY S  KLLWLLENV  VKEA
Sbjct  138  --GADRLQELCGLPLSTYPSVGKLLWLLENVPKVKEA  172



>ref|XP_002544072.1| glycerol kinase [Uncinocarpus reesii 1704]
 gb|EEP78743.1| glycerol kinase [Uncinocarpus reesii 1704]
Length=510

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 122/163 (75%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+K+ + F+GSIDQGTTS+RF+I++++   V SHQ+EFTQ YPQ GW EHDP+EI+ SV+
Sbjct  1    MAKDVESFIGSIDQGTTSSRFLIFNQNGEVVASHQLEFTQIYPQPGWHEHDPIEIVTSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      G+NVG  +KA+GITNQRETTVVW+K +G PLYNAIVW D RT S+ R
Sbjct  61   RCIDGAVSSFEHQGYNVGS-IKAVGITNQRETTVVWNKETGEPLYNAIVWTDTRTQSLIR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L++ L  G +   E CGLP+STY S  KLLWLL+ V  VKEA
Sbjct  120  RLKQRL--GHSELQEHCGLPLSTYPSVGKLLWLLDCVPRVKEA  160



>gb|KIW74117.1| glycerol kinase [Fonsecaea pedrosoi CBS 271.37]
Length=512

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSTQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN+   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHNI-NTIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A
Sbjct  120  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDA  160



>gb|KIW41707.1| glycerol kinase [Exophiala oligosperma]
Length=512

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+  V+
Sbjct  1    MGSVQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVAGVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN+   +KA+GITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ECIDGAVKQFENQGHNINS-IKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL++ L  G     + CGLP+STY S  KLLWLLEN   VK A
Sbjct  120  KLKQRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKAA  160



>gb|KIW53862.1| glycerol kinase [Exophiala xenobiotica]
Length=523

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            +VFVGSIDQGTTSTRF+I++R   PV SHQIEF QFYPQ GW EHDP+EI+ SV+ C+  
Sbjct  18   EVFVGSIDQGTTSTRFLIFNRDGEPVASHQIEFKQFYPQPGWHEHDPLEIVSSVEQCIEG  77

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV      GH+    +KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RK++  
Sbjct  78   AVKDLETQGHSSSN-IKAVGITNQRETTVVWDYETGEPLYNAIVWTDTRTQALIRKIKLR  136

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L  G     E CGLP+STY S  KLLWLLENV  V++A
Sbjct  137  L--GADRLQELCGLPLSTYPSVGKLLWLLENVPKVQDA  172



>gb|KIX96461.1| hypothetical protein Z520_07727 [Fonsecaea multimorphosa CBS 
102226]
Length=512

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSTQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN+   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHNI-NTIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALIR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A
Sbjct  120  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDA  160



>gb|KIW12125.1| glycerol kinase [Exophiala spinifera]
Length=515

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 113/157 (72%), Gaps = 3/157 (2%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            VFVGSIDQGTTSTRF+I++R   P+ SHQIEF Q YPQ GW EHDP+EI+ SV+ C+  A
Sbjct  11   VFVGSIDQGTTSTRFLIFNRDGEPIASHQIEFKQIYPQPGWHEHDPLEIISSVEQCIEGA  70

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            V      GH+  + +KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RK++  L
Sbjct  71   VKDFETQGHSSAK-IKAVGITNQRETTVVWDYETGEPLYNAIVWTDTRTQALIRKIKLRL  129

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
              G     E CGLP+STY S  KLLWLLENV  VKEA
Sbjct  130  --GADRLQELCGLPLSTYPSVGKLLWLLENVPKVKEA  164



>gb|KIW25190.1| glycerol kinase [Cladophialophora immunda]
Length=520

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  9    MGSTQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  68

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN+   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  69   KCIDGAVQQFQDQGHNI-NTIKAVGITNQRETTVLWNKETGEPLYNAIVWTDLRTQALVR  127

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A
Sbjct  128  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDA  168



>gb|KEF63543.1| glycerol kinase [Exophiala aquamarina CBS 119918]
Length=514

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 119/167 (71%), Gaps = 5/167 (3%)
 Frame = +1

Query  46   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  225
            G+ + SKE  VFVG+IDQGTTS+RF+I+++S  PV SHQIEF Q+YPQ GW EHDP+EI+
Sbjct  2    GDTQASKE--VFVGAIDQGTTSSRFLIFNKSGEPVASHQIEFKQYYPQPGWHEHDPLEII  59

Query  226  ESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  405
             SV+ C+  AV      GH  G  +KA+GITNQRETTVVW+  +G PLYNAIVW D RT 
Sbjct  60   SSVEQCIDGAVKDLENQGH-AGSSIKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQ  118

Query  406  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ RKL++ L  G        GLP+STY S  KLLWLLEN   VKEA
Sbjct  119  ALIRKLKRRL--GADQLPGLSGLPLSTYPSVGKLLWLLENEPKVKEA  163



>ref|XP_008082000.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
 gb|EHK98240.1| putative Glycerol kinase [Glarea lozoyensis 74030]
 gb|EPE30589.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
Length=518

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +E+ FVGSIDQGTTSTRF+I+++   PV SHQIEF QFYPQ GW EHDP EI+ESV  C+
Sbjct  11   QEESFVGSIDQGTTSTRFLIFNKDGEPVASHQIEFKQFYPQPGWHEHDPTEIIESVNQCI  70

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
              AV      GH+  R +KA+GITNQRETTVVW K +G PLYNAIVW D R  ++ RKL+
Sbjct  71   EGAVKAFEQQGHSA-RSIKAVGITNQRETTVVWDKQTGEPLYNAIVWTDTRHQNLVRKLK  129

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
              L  G       CGLP+STY S  KLLW++ENV+ V  A
Sbjct  130  ARL--GAEQLQALCGLPLSTYPSVGKLLWMIENVKEVSAA  167



>gb|EAS27500.3| glycerol kinase [Coccidioides immitis RS]
Length=546

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  55   KMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESV  234
            +M K+ + F+GSIDQGTTS+RF+I++++     SHQ+EFTQ YPQ GW EHDP EI+ SV
Sbjct  36   EMGKDIESFIGSIDQGTTSSRFLIFNKNGEVAASHQLEFTQIYPQPGWHEHDPKEIVTSV  95

Query  235  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  414
            + C+  AV      G+NV   +KA+GITNQRETTVVW K +G PLYNAIVW D RT S+ 
Sbjct  96   ERCIDGAVSSFEHQGYNV-ESIKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQSLI  154

Query  415  RKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            R+L++ L  G  H  E CGLP+STY S  KLLWLLENV  VK+A
Sbjct  155  RRLKRRLGHGEVH--ERCGLPLSTYPSVGKLLWLLENVPKVKDA  196



>gb|KIW13824.1| glycerol kinase [Exophiala spinifera]
Length=512

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    +VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+  V+
Sbjct  1    MGSVHEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVAGVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN+   +KA+GITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ECIDGAVKQFENQGHNINS-IKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL++ L  G     + CGLP+STY S  KLLWLLEN   V++A
Sbjct  120  KLKQRL--GADRLTDICGLPLSTYPSVGKLLWLLENEPKVQKA  160



>ref|XP_007746125.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
 gb|EXJ69310.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
Length=512

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSSQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVASVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GH+V   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHSVNS-IKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A
Sbjct  120  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDA  160



>ref|XP_007721505.1| glycerol kinase [Capronia coronata CBS 617.96]
 gb|EXJ94011.1| glycerol kinase [Capronia coronata CBS 617.96]
Length=515

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            + FVGSIDQGTTSTRF+I++RS  PV SHQIEF Q+YPQ+GW EHDP+EI+ SV+ C+  
Sbjct  10   ETFVGSIDQGTTSTRFLIFNRSGEPVASHQIEFKQYYPQSGWHEHDPLEIISSVEQCIEG  69

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV      GH     +KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL++ 
Sbjct  70   AVKDLENQGHAKAS-IKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALVRKLKQR  128

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L  G     E CGLP+STY S  KLLWLL N   VK+A
Sbjct  129  L--GADKLQELCGLPLSTYPSVGKLLWLLANEPKVKDA  164



>gb|EHL03740.1| putative Glycerol kinase [Glarea lozoyensis 74030]
Length=544

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 121/161 (75%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            KE++ FVGSIDQGTTS+RF+++D    PV SHQIEF   YP++GW EHDP+E+L SV+ C
Sbjct  67   KEKKWFVGSIDQGTTSSRFLVFDGEGTPVASHQIEFENIYPESGWHEHDPMELLSSVQEC  126

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +     GH+  + +KAIGITNQRETTV W  ++G PLYNA+VW D RTTSI ++L
Sbjct  127  IEKATESFIEKGHSKDQ-IKAIGITNQRETTVCWDTNTGEPLYNAVVWPDTRTTSIVKEL  185

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            + +   G    +E CGLP+STY S++KLLWLL NV+A+K+A
Sbjct  186  KAK--AGADELLEICGLPLSTYPSSVKLLWLLRNVDAIKQA  224



>ref|XP_008083904.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
 gb|EPE29795.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
Length=570

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 121/161 (75%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            KE++ FVGSIDQGTTS+RF+++D    PV SHQIEF   YP++GW EHDP+E+L SV+ C
Sbjct  56   KEKKWFVGSIDQGTTSSRFLVFDGEGTPVASHQIEFENIYPESGWHEHDPMELLSSVQEC  115

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +     GH+  + +KAIGITNQRETTV W  ++G PLYNA+VW D RTTSI ++L
Sbjct  116  IEKATESFIEKGHSKDQ-IKAIGITNQRETTVCWDTNTGEPLYNAVVWPDTRTTSIVKEL  174

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            + +   G    +E CGLP+STY S++KLLWLL NV+A+K+A
Sbjct  175  KAK--AGADELLEICGLPLSTYPSSVKLLWLLRNVDAIKQA  213



>gb|KIW93314.1| glycerol kinase [Cladophialophora bantiana CBS 173.52]
Length=512

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSSQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVASVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GH+V   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHSVNS-IKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G       CGLP+STY S  KLLWLLEN   VK+A
Sbjct  120  KLKHRL--GADKLTNICGLPLSTYPSVGKLLWLLENEPKVKDA  160



>gb|KIV83409.1| glycerol kinase [Exophiala sideris]
Length=512

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    +VF+GSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP EI+ SV+
Sbjct  1    MGSVPEVFIGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPEEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN+   +KA+GITNQRETTVVW+K +G  LYNAIVW D R   + R
Sbjct  61   QCIDGAVKQFETQGHNI-NTIKAVGITNQRETTVVWNKETGEALYNAIVWTDTRHQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL++ L  G     + CGLP+STY S  KLLWL+ENV+ VK+A
Sbjct  120  KLKQRL--GADKLTDICGLPLSTYPSVGKLLWLIENVDKVKQA  160



>ref|XP_009154657.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
 ref|XP_009154658.1| glycerol kinase, variant [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54196.1| glycerol kinase, variant [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54197.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
Length=523

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 115/158 (73%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            + FVGSIDQGTTSTRF+I+++S  P+ SHQIEF Q+YPQ+GW EHDP+EI+ SV+ C+  
Sbjct  18   ETFVGSIDQGTTSTRFLIFNKSGEPIASHQIEFKQYYPQSGWHEHDPLEIISSVEQCIDG  77

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV      GH+    +KA+GITNQRETTVVW+  +G PLY+AIVW D RT ++ RKL+  
Sbjct  78   AVKDLENQGHSRAS-IKAVGITNQRETTVVWNHETGEPLYHAIVWTDTRTQALVRKLKHR  136

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L  G     E CGLP+STY S  KLLWLLEN   VKEA
Sbjct  137  L--GADRLQELCGLPLSTYPSVGKLLWLLENEPKVKEA  172



>gb|KEF52126.1| glycerol kinase [Exophiala aquamarina CBS 119918]
Length=512

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSTQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVASVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GH+V   +KA+GITNQRETTV+W K +G PLYNAIVW D RT S+ R
Sbjct  61   TCIDGAVKQFETQGHSVNS-IKAVGITNQRETTVLWDKETGEPLYNAIVWTDTRTQSLIR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G        GLP+STY S  KLLWLLEN   VK A
Sbjct  120  KLKTRL--GADKLTAISGLPLSTYPSVGKLLWLLENEPKVKAA  160



>gb|KIX09632.1| glycerol kinase [Rhinocladiella mackenziei CBS 650.93]
Length=516

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 114/167 (68%), Gaps = 3/167 (2%)
 Frame = +1

Query  46   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  225
            G+       ++FVGSIDQGTTSTRF+I++R   P+ SHQ+EF Q YP  GW EHDP+EI+
Sbjct  2    GDTARHPSHEIFVGSIDQGTTSTRFLIFNRDGDPIASHQVEFKQMYPHPGWHEHDPLEII  61

Query  226  ESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  405
             SV+ C+  AV      GH     +KA+GITNQRETTVVW+  +G PLYNAIVW D RT 
Sbjct  62   SSVEECIEGAVKDLENQGHASAN-IKAVGITNQRETTVVWNSETGEPLYNAIVWTDTRTQ  120

Query  406  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ RKL+  L  G     + CGLP+STY S  KLLWLLENV  VK+A
Sbjct  121  ALVRKLKNRL--GADQLQQHCGLPLSTYPSVGKLLWLLENVPKVKDA  165



>ref|XP_008779159.1| PREDICTED: glycerol kinase-like isoform X1 [Phoenix dactylifera]
Length=476

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +1

Query  208  DPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVW  387
            DP EILESV+VC+ KAV+KA A G  V   LKAIG+TNQRETTV+WSKS+GLPLYNAIVW
Sbjct  5    DPAEILESVRVCMEKAVEKAAAGGRKVEGRLKAIGLTNQRETTVMWSKSTGLPLYNAIVW  64

Query  388  MDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            MDART+SIC++LEKEL GGR HFVETCGLPISTYFSA+K+LWL+ENV+AV+EAV
Sbjct  65   MDARTSSICKRLEKELSGGRNHFVETCGLPISTYFSALKILWLMENVDAVREAV  118



>gb|ERS98066.1| glycerol kinase [Sporothrix schenckii ATCC 58251]
Length=625

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 127/182 (70%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ETHRQSANCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQF  180
            +  R  A+   T EE ERK       FVGSIDQGTTS+RFII+D    PV SHQ+EF   
Sbjct  49   QAERLPADLFVTDEEKERKW------FVGSIDQGTTSSRFIIFDGDGSPVASHQLEFENL  102

Query  181  YPQAGWVEHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSG  360
            YP +GW EHDP+E+L SV  C+ KAV++    GH+  +L++++GITNQRETT+VW   +G
Sbjct  103  YPNSGWHEHDPMELLASVTTCMEKAVEQFVEKGHS-KQLIRSVGITNQRETTLVWDSETG  161

Query  361  LPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVK  540
             PLYNA+VW D RTT + R+L K  P   T  ++ CGLP+STY S++KL WLL+NVEAV+
Sbjct  162  EPLYNAVVWPDTRTTGLVRQL-KNAPMADT-LLDLCGLPLSTYPSSVKLRWLLDNVEAVR  219

Query  541  EA  546
            +A
Sbjct  220  KA  221



>gb|KIV86319.1| glycerol kinase [Exophiala sideris]
 gb|KIV86320.1| glycerol kinase, variant [Exophiala sideris]
Length=523

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            + FVGSIDQGTTSTRF+I+     P+ SHQIEF Q YP  GW EHDP+EI+ESV+ C+  
Sbjct  18   ETFVGSIDQGTTSTRFLIFKPDGEPIASHQIEFKQIYPHPGWHEHDPLEIIESVQQCIEG  77

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV      GH+ G  +KA+GITNQRETTV+W+  +G PLYNAIVW D RT ++ RKL++ 
Sbjct  78   AVKDLENQGHSAGN-IKAVGITNQRETTVLWNHETGEPLYNAIVWTDTRTAALVRKLKQR  136

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L  G     + CGLP+STY S  KLLWLLEN   VKEA
Sbjct  137  L--GADRLPDLCGLPLSTYPSVGKLLWLLENEPKVKEA  172



>ref|XP_007722970.1| glycerol kinase [Capronia coronata CBS 617.96]
 gb|EXJ90776.1| glycerol kinase [Capronia coronata CBS 617.96]
Length=512

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   ++VFVGSIDQGTTS+RF+I++++  PV SHQIEFTQ YPQ GW EHDP EI+ SV+
Sbjct  1    MGSLQEVFVGSIDQGTTSSRFLIFNKAGEPVASHQIEFTQIYPQPGWHEHDPQEIVTSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+++A  +    GH++   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT  + R
Sbjct  61   ECINEACKQFENQGHSLSS-IKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G    +E CG+P+STY S  KLLWLL+N   V+ A
Sbjct  120  KLKHRL--GADKLMEICGVPLSTYPSVGKLLWLLDNEPKVRAA  160



>gb|KIH87229.1| glycerol kinase [Sporothrix brasiliensis 5110]
Length=625

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 126/182 (69%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ETHRQSANCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQF  180
            +  R  A+   T EE ERK       FVGSIDQGTTS+RFII+D    PV SHQ+EF   
Sbjct  49   QAERLPADLFVTDEEKERKW------FVGSIDQGTTSSRFIIFDGDGSPVASHQLEFENL  102

Query  181  YPQAGWVEHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSG  360
            YP +GW EHDP+E+L SV  C+ KAV++    GH+  +L++++GITNQRETT+VW   +G
Sbjct  103  YPNSGWHEHDPMELLASVTTCMEKAVEQFVEKGHS-KQLIRSVGITNQRETTLVWDSETG  161

Query  361  LPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVK  540
             PLYNA+VW D RTT + R+L K  P   T   + CGLP+STY S++KL WLL+NVEAV+
Sbjct  162  EPLYNAVVWPDTRTTGLVRQL-KNAPKADT-LQDICGLPLSTYPSSVKLRWLLDNVEAVR  219

Query  541  EA  546
            +A
Sbjct  220  KA  221



>ref|XP_008715149.1| glycerol kinase [Cyphellophora europaea CBS 101466]
 gb|ETN43413.1| glycerol kinase [Cyphellophora europaea CBS 101466]
Length=513

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    + F+GSIDQGTTS+RF+I+++   PV SHQIEF Q YP  GW EHDP+EI++SV+
Sbjct  1    MGSVAESFIGSIDQGTTSSRFLIFNKHGDPVASHQIEFKQIYPHPGWHEHDPLEIIDSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH+V   +KA+GITNQRETTVVW K++G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVAAFEQQGHSVNS-IKAVGITNQRETTVVWDKTTGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+  L  G     + CGLP+STY S  KLLW +ENV A KEA
Sbjct  120  RLKLRL--GADKLQDLCGLPLSTYPSVGKLLWFIENVPAAKEA  160



>gb|ESZ94780.1| glycerol kinase [Sclerotinia borealis F-4157]
Length=514

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 117/167 (70%), Gaps = 3/167 (2%)
 Frame = +1

Query  46   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  225
            G+R +    + F+GSIDQGTTSTRF+I++R   PV SHQ+EF+Q YPQ+GW EHDP+EI+
Sbjct  2    GDRNLVSSHESFIGSIDQGTTSTRFLIFNREGEPVASHQVEFSQIYPQSGWHEHDPLEII  61

Query  226  ESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  405
            +S++ C+  AV +    GH + R +KA+G+TNQRETTVVW   +G PL NAIVW D R  
Sbjct  62   DSIEACIEGAVKQLEEQGH-LARQIKAVGLTNQRETTVVWDHETGEPLANAIVWTDTRNQ  120

Query  406  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ RKL+  L  G       CGLP+STY S  KLLWL+EN + V +A
Sbjct  121  ALVRKLKLRL--GSDKLQSLCGLPLSTYPSVGKLLWLIENNDKVADA  165



>ref|XP_002623248.1| glycerol kinase [Blastomyces dermatitidis SLH14081]
 gb|EEQ71496.1| glycerol kinase [Blastomyces dermatitidis SLH14081]
 gb|EGE78851.1| glycerol kinase [Blastomyces dermatitidis ATCC 18188]
 gb|EQL36571.1| glycerol kinase [Blastomyces dermatitidis ATCC 26199]
 gb|EQL36572.1| glycerol kinase, variant [Blastomyces dermatitidis ATCC 26199]
Length=510

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    Q FVGSIDQGTTS+RF+I++ +   VVSHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSVGQTFVGSIDQGTTSSRFLIFNPAGDVVVSHQLEFRQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++ + +KA+GITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KTIKAVGITNQRETTVVWDRETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+K L  G       CGLP+STY S  KLLW++ENV   KEA
Sbjct  120  KLKKRL--GANDLQALCGLPLSTYPSVGKLLWIIENVPKAKEA  160



>ref|XP_003053171.1| hypothetical protein NECHADRAFT_67500 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU47458.1| hypothetical protein NECHADRAFT_67500 [Nectria haematococca mpVI 
77-13-4]
Length=599

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = +1

Query  49   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILE  228
            E +  K++  FVGSIDQGTTSTRF+I++    PV SHQIEF   YP +GW EH P+E+LE
Sbjct  76   ETEEEKQKHWFVGSIDQGTTSTRFLIFNGHGEPVASHQIEFENHYPHSGWHEHKPMELLE  135

Query  229  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  408
            SV+ C++KA +K  ADGH     + +IGITNQRETTV+W K++G PLYNA+VW D RT +
Sbjct  136  SVETCIAKATEKFCADGHTASE-IHSIGITNQRETTVLWDKNTGEPLYNAVVWPDTRTAA  194

Query  409  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            + R L K  PG      E CGLP+STY S++KLLW+L+NV++V++A
Sbjct  195  LVRDL-KARPGA-DKLQEKCGLPLSTYPSSVKLLWVLQNVDSVRKA  238



>ref|XP_009161485.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY61024.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
Length=512

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    +VFVGSIDQGTTS+RF+I++++  PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSSPEVFVGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+ +A  +    GH++   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDEACKQFETQGHSL-HSIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G    +E CG+P+STY S  KLLWLLE+   VK A
Sbjct  120  KLKHRL--GADKLMEICGVPLSTYPSVGKLLWLLEHEPKVKAA  160



>gb|KIV91759.1| glycerol kinase [Exophiala mesophila]
Length=512

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    +VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSTSEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN+   +KAIGITNQRETTV+W + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVAQFETQGHNINS-IKAIGITNQRETTVLWDQQTGEPLYNAIVWTDTRTQNMIR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            K++  L  G     E  GLP+STY S  KLLWLLEN   VK A
Sbjct  120  KIKHRL--GADLLNEISGLPLSTYPSVGKLLWLLENEPKVKTA  160



>gb|EZF30633.1| glycerol kinase, partial [Trichophyton interdigitale H6]
Length=322

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>gb|EEH03542.1| glycerol kinase [Histoplasma capsulatum G186AR]
Length=510

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    Q F+GSIDQGTTS+RF+I+  +   V SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSIGQTFLGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYPQPGWHEHDPLEIISSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++ + +KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KAIKAIGITNQRETTVVWDKDTGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+K L G     +  CGLP+STY S  KLLW++ENV   KEA
Sbjct  120  KLKKRLGGNDLQAL--CGLPLSTYPSVGKLLWIIENVPKAKEA  160



>ref|XP_009257820.1| hypothetical protein FPSE_06427 [Fusarium pseudograminearum CS3096]
 gb|EKJ73355.1| hypothetical protein FPSE_06427 [Fusarium pseudograminearum CS3096]
 gb|EYB29448.1| hypothetical protein FG05_30234 [Fusarium graminearum]
 emb|CEF76919.1| unnamed protein product [Fusarium graminearum]
Length=606

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +1

Query  49   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILE  228
            E +  +++  FVGSIDQGTTSTRF+I++    PV SHQ+EF   YP +GW EHDP+ +LE
Sbjct  83   ETEEERQKHWFVGSIDQGTTSTRFLIFNGHGEPVASHQMEFENLYPASGWHEHDPMTLLE  142

Query  229  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  408
            S ++C+ KA +K  A GH++   +++IGITNQRETTV+W  ++G PLYNA+VW D RT++
Sbjct  143  SAEICIEKATEKFCAQGHSIEE-IRSIGITNQRETTVLWDNTTGEPLYNAVVWPDTRTSA  201

Query  409  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            + R L K  PG      E CGLP+STY S++KLLW+L+NVE+V+EA
Sbjct  202  LVRDL-KNKPGAE-KLQEACGLPLSTYPSSVKLLWVLQNVESVREA  245



>ref|XP_007290490.1| glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
 gb|EKD19364.1| glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
Length=579

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 115/159 (72%), Gaps = 3/159 (2%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            ++ ++GSIDQGTTSTRF+I++R   PV SHQ+EF Q+YPQ GW EHDP EI+ S++ C+ 
Sbjct  74   QEAYIGSIDQGTTSTRFLIFNREGEPVASHQVEFKQYYPQPGWHEHDPREIITSIETCIE  133

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
             AV+    +GH+V R +KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RKL+ 
Sbjct  134  GAVEAFEENGHSV-RSIKAVGITNQRETTVVWDNVTGDPLYNAIVWTDTRTQALIRKLKL  192

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L  G     + CGLP+STY S  KLLWL+EN   V +A
Sbjct  193  RL--GSDQLQDICGLPLSTYPSVGKLLWLIENEPKVADA  229



>gb|EER38708.1| glycerol kinase [Histoplasma capsulatum H143]
Length=509

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    Q F+GSIDQGTTS+RF+I+  +   V SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSIGQTFLGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++ + +KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KAIKAIGITNQRETTVVWDKDTGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+K L  G       CGLP+STY S  KLLW++ENV   KEA
Sbjct  120  KLKKRL--GANDLQALCGLPLSTYPSVGKLLWIIENVPKAKEA  160



>gb|EGC47863.1| glycerol kinase [Histoplasma capsulatum H88]
Length=510

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    Q F+GSIDQGTTS+RF+I+  +   V SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSIGQTFLGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++ + +KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KAIKAIGITNQRETTVVWDKDTGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+K L  G       CGLP+STY S  KLLW++ENV   KEA
Sbjct  120  KLKKRL--GANDLQALCGLPLSTYPSVGKLLWIIENVPKAKEA  160



>gb|EEQ90810.1| glycerol kinase [Blastomyces dermatitidis ER-3]
Length=510

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    Q FVGSIDQGTTS+RF+I++ +   VVSHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSVGQTFVGSIDQGTTSSRFLIFNPAGDVVVSHQLEFRQIYPQPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++ + +KA+GITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KTIKAVGITNQRETTVVWDRETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+K L       +  CGLP+STY S  KLLW++ENV   KEA
Sbjct  120  KLKKRLEANDLQAL--CGLPLSTYPSVGKLLWIIENVPKAKEA  160



>gb|KIW30265.1| glycerol kinase [Cladophialophora immunda]
Length=524

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 112/167 (67%), Gaps = 3/167 (2%)
 Frame = +1

Query  46   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  225
            G+   S   + FVGSIDQGTTSTRF+I++R    + SHQIEF QFYP  GW EHDP+EI+
Sbjct  10   GDTTKSASHETFVGSIDQGTTSTRFLIFNRHGEVIASHQIEFKQFYPHPGWHEHDPLEII  69

Query  226  ESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  405
             SV+ C+  AV      GH     +KA+GITNQRETTVVW+  +G PLY AIVW D RT 
Sbjct  70   SSVEQCIDGAVKDLETQGHASAN-IKAVGITNQRETTVVWNHETGEPLYRAIVWTDTRTQ  128

Query  406  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ RKL+  L  G     + CGLP+STY S  KLLWLLEN   VKEA
Sbjct  129  ALIRKLKHRL--GSDQLQQLCGLPLSTYPSVGKLLWLLENEPKVKEA  173



>gb|KIW62746.1| glycerol kinase [Capronia semiimmersa]
Length=521

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    + F+GSIDQGTTS+RF+I++++  PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  10   MGSTSEHFIGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  69

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV++    GHN    +KAIGITNQRETTV+W+K +G PLYNAIVW D R  ++ R
Sbjct  70   QCIDGAVEQFENQGHNANS-IKAIGITNQRETTVLWNKETGEPLYNAIVWTDTRHQNLVR  128

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G    ++  G+P+STY S  KLLWLLEN   VKEA
Sbjct  129  KLKHRL--GADQLIQLAGVPLSTYPSVGKLLWLLENEPKVKEA  169



>gb|EXK30956.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
Length=603

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  83   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFKNHYPNSGWHEHDPMTLLESVETC  142

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+++ R+L
Sbjct  143  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSALVREL  201

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  202  -KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKA  240



>ref|XP_007762002.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
 gb|EXJ54487.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
Length=512

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    + F+GSIDQGTTS+RF+I++++  PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSPSEHFIGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPHPGWHEHDPLEIISSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GH+  + +KAIGITNQRETTV+W+K +G PLYNAIVW D R  ++ R
Sbjct  61   QCIDGAVKQFETQGHSA-QSIKAIGITNQRETTVLWNKETGEPLYNAIVWTDTRHQNLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL++ L  G    +E  G+P+STY S  KLLWLLEN   VKEA
Sbjct  120  KLKQRL--GADQLIELAGVPLSTYPSVGKLLWLLENEAKVKEA  160



>gb|EWG39393.1| glycerol kinase [Fusarium verticillioides 7600]
Length=606

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  86   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPMTLLESVETC  145

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+++ R+L
Sbjct  146  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSALVREL  204

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  205  -KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKA  243



>ref|XP_008730990.1| glycerol kinase [Cladophialophora carrionii CBS 160.54]
 gb|ETI20422.1| glycerol kinase [Cladophialophora carrionii CBS 160.54]
Length=512

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    + F+GSIDQGTTS+RF+I++++  PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSPSEHFIGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV +    GHN    +KA+GITNQRETTV+W+K +G PLYNAIVW D R  ++ R
Sbjct  61   QCIDGAVKQFETQGHNA-HSIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRHQNLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G    +E  G+P+STY S  KLLWLLEN   VKEA
Sbjct  120  KLKHRL--GADQLIELAGVPLSTYPSVGKLLWLLENEPKVKEA  160



>gb|EGU77732.1| hypothetical protein FOXB_11754 [Fusarium oxysporum Fo5176]
 gb|EXK98580.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL88576.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXM35247.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=606

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  86   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPMTLLESVETC  145

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+++ R+L
Sbjct  146  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSALVREL  204

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  205  -KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKA  243



>gb|EXM09636.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=606

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  86   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPMTLLESVETC  145

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+++ R+L
Sbjct  146  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSALVREL  204

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  205  -KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKA  243



>gb|EXA40461.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
Length=602

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  82   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPMTLLESVETC  141

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+++ R+L
Sbjct  142  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSALVREL  200

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  201  -KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKA  239



>gb|EWY88820.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
Length=606

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  86   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPMTLLESVETC  145

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+++ R+L
Sbjct  146  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSALVREL  204

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  205  -KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKA  243



>gb|EWZ39665.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ88239.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXL51213.1| glycerol kinase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=606

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  86   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPMTLLESVETC  145

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+++ R+L
Sbjct  146  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSALVREL  204

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  205  -KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKA  243



>emb|CCT70018.1| probable GUT1-glycerol kinase [Fusarium fujikuroi IMI 58289]
Length=606

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+ +LESV+ C
Sbjct  86   KQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPMTLLESVETC  145

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D RT+S+ R+L
Sbjct  146  IEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDTRTSSLVREL  204

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      +TCGLP+STY S++KLLW+L+NVE+V++A
Sbjct  205  -KNKPGAE-KLQKTCGLPLSTYPSSVKLLWVLQNVESVRKA  243



>dbj|GAM87358.1| hypothetical protein ANO11243_053820 [fungal sp. No.11243]
Length=514

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 114/159 (72%), Gaps = 3/159 (2%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            EEQVFVGSIDQGTTS+RF+I+D+   PV  HQ EF+Q YP +GW EHDP EI+ SV  C+
Sbjct  3    EEQVFVGSIDQGTTSSRFLIFDKQGEPVAVHQQEFSQIYPHSGWHEHDPEEIVSSVTECI  62

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
             KAV++  + GH+V   +KA+G+TNQRETTVVW + +G  LYNAIVW D RT +I  +L+
Sbjct  63   DKAVEQFKSKGHSV-SAIKAVGVTNQRETTVVWDRKTGKSLYNAIVWTDTRTAAIVHELK  121

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKE  543
                 G    ++ CG P+STY S  KLLWLL+NV  VKE
Sbjct  122  AR--KGSDELMDICGEPLSTYPSVTKLLWLLKNVPEVKE  158



>gb|KIW80416.1| glycerol kinase [Fonsecaea pedrosoi CBS 271.37]
Length=521

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 110/158 (70%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            +VFVGSIDQGTTSTRF++++R    V SHQIEF Q YP  GW EHDP+EI+ SV+ C+  
Sbjct  16   EVFVGSIDQGTTSTRFLVFNRHGEVVASHQIEFKQIYPHPGWHEHDPLEIISSVEQCIDG  75

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV      GH     +KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL+  
Sbjct  76   AVKDLENQGHASAS-IKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALIRKLKHR  134

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L  G     E CGLP+STY S  KLLWLL+N   VKEA
Sbjct  135  L--GSDQLQELCGLPLSTYPSVGKLLWLLDNEPKVKEA  170



>gb|EGE01178.1| glycerol kinase [Trichophyton equinum CBS 127.97]
Length=514

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHRKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+  L  G       CGLP+STY S  K+LWL+ENV  V+EA
Sbjct  120  RLKSRL--GHKELQPICGLPLSTYPSVGKVLWLIENVPKVREA  160



>gb|EGD95974.1| glycerol kinase [Trichophyton tonsurans CBS 112818]
Length=514

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHRKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+  L  G       CGLP+STY S  K+LWL+ENV  V+EA
Sbjct  120  RLKSRL--GHKELQPICGLPLSTYPSVGKVLWLIENVPQVREA  160



>ref|XP_007761772.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
 gb|EXJ54257.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
Length=532

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K ++ FVG+ID GTTS+RF+I+DR   PV  HQIEF Q YP +GW EHDP E++ SV  C
Sbjct  4    KSDESFVGAIDNGTTSSRFLIFDRKGNPVAEHQIEFKQHYPHSGWHEHDPNELVSSVSTC  63

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + +A DK T+ G+++   +KA+GITNQRETTVVW   +G PLYNAIVW D R+  I R+L
Sbjct  64   IDEASDKFTSQGYSLSN-IKAVGITNQRETTVVWDIKTGEPLYNAIVWTDTRSAHIVREL  122

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +++   G    +  CGLP+STY S+ KLLW+L +V+ VK+A
Sbjct  123  KQK--SGADELISLCGLPLSTYPSSTKLLWMLRHVDKVKQA  161



>gb|KIX93773.1| hypothetical protein Z520_10397 [Fonsecaea multimorphosa CBS 
102226]
Length=517

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 111/162 (69%), Gaps = 3/162 (2%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
            +K  + F+GSIDQGTTSTRF+I++R    + SHQIEF Q YP  GW EHDP+EI+ SV+ 
Sbjct  8    NKSHETFIGSIDQGTTSTRFLIFNRHGEVIASHQIEFKQIYPHPGWHEHDPLEIISSVEQ  67

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C+  AV      GH     +KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RK
Sbjct  68   CIDGAVKDLETQGHASAN-IKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALIRK  126

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L+  L  G     + CGLP+STY S  KLLWLL+N   VKEA
Sbjct  127  LKHRL--GSDQLQQLCGLPLSTYPSVGKLLWLLDNEPKVKEA  166



>ref|XP_010761524.1| glycerol kinase [Paracoccidioides brasiliensis Pb18]
 gb|EEH49997.1| glycerol kinase [Paracoccidioides brasiliensis Pb18]
Length=510

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    + FVGSIDQGTTS+RF+I+  +   V SHQ+EF Q Y Q GW EHDP+EI+ESV+
Sbjct  1    MGCANESFVGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYSQPGWHEHDPLEIVESVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++   +KAIGITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-ESIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+  L  G     E CGLP+STY S  KLLW++ENV  VKEA
Sbjct  120  RLKSRL--GANELQELCGLPLSTYPSVGKLLWMMENVRKVKEA  160



>ref|XP_003172411.1| glycerol kinase [Microsporum gypseum CBS 118893]
 gb|EFR02000.1| glycerol kinase [Microsporum gypseum CBS 118893]
Length=514

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   ++FVGSIDQGTTS+RF+I++     VVSHQ+EF Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAASGKLFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFKQIYPQPGWHEHDPNEIVESVI  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  QLKTRL--GYRELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>gb|KIW98601.1| glycerol kinase [Cladophialophora bantiana CBS 173.52]
Length=515

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 110/158 (70%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            + FVGSIDQGTTSTRF+I++R+   + SHQ+EF Q YP  GW EHDP+EI+ SV+ C+  
Sbjct  10   ETFVGSIDQGTTSTRFLIFNRNGEVIASHQMEFKQIYPHPGWHEHDPLEIISSVEQCIDG  69

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV      GH     +KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL+  
Sbjct  70   AVQDLETQGHASAN-IKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALVRKLKHR  128

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L  G     E CGLP+STY S  KLLWLL+N   VKEA
Sbjct  129  L--GSDQLQELCGLPLSTYPSVGKLLWLLDNEPKVKEA  164



>gb|KFA61070.1| hypothetical protein S40285_06341 [Stachybotrys chlorohalonata 
IBT 40285]
Length=539

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 123/182 (68%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    ETHRQSANCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQF  180
            E  R  +    T EE      K++  FVGSIDQGTTSTRF+I++    PV  HQIEF   
Sbjct  10   EEERLPSGITETAEE------KKQHWFVGSIDQGTTSTRFLIFNGLGDPVAKHQIEFKNI  63

Query  181  YPQAGWVEHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSG  360
            YP +GW E DP+E+L SV+ C+ KA +   A GH V   ++++GITNQRETTV+W K++G
Sbjct  64   YPHSGWHEQDPLELLRSVETCIEKATEDFCAQGHTVSE-IRSVGITNQRETTVLWDKNTG  122

Query  361  LPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVK  540
             PLYNA+ W D RTT++ R+L+     G    ++ CGLP+STY S++KLLWLL+NV++VK
Sbjct  123  EPLYNAVAWPDTRTTALVRELKTR--DGADKLLDLCGLPLSTYPSSVKLLWLLQNVDSVK  180

Query  541  EA  546
             A
Sbjct  181  AA  182



>gb|KEZ40309.1| Glycerol kinase 2 [Scedosporium apiospermum]
Length=554

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 123/175 (70%), Gaps = 8/175 (5%)
 Frame = +1

Query  22   NCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWV  201
            + I   EEG++      + FVGSIDQGTTS+RF+I++    PV SHQIEF   YP++GW 
Sbjct  28   DGITATEEGQKN-----RWFVGSIDQGTTSSRFLIFNGDGDPVASHQIEFENLYPESGWH  82

Query  202  EHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAI  381
            EHDP+E+L SV+ C+  AV   T  G+++ R ++++GITNQRETT+VW   +G PLYNA+
Sbjct  83   EHDPLELLRSVEKCIEGAVANFTKAGNDISR-IRSVGITNQRETTIVWDTQTGEPLYNAV  141

Query  382  VWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            VW D RT  + R+L  +   G    +  CGLP+STY S++KLLWL+ENVEAVK+A
Sbjct  142  VWPDTRTKHLVRELRNKE--GADDLLNLCGLPLSTYPSSVKLLWLIENVEAVKKA  194



>dbj|GAD93635.1| glycerol kinase, putative [Byssochlamys spectabilis No. 5]
Length=568

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M      FVGSIDQGTTS+RF+I++R   PV SHQ+EF Q YP +GW EHDP+E++ SV+
Sbjct  1    MGSIGDTFVGSIDQGTTSSRFLIFNRDGEPVASHQVEFNQIYPHSGWHEHDPLELVTSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+S+A+ +  A G + G  +K IGITNQRETT+VW   +G PLYNAIVW D R+ SI  
Sbjct  61   TCISEAMKEFEAAGFSRG-AIKGIGITNQRETTIVWDYETGEPLYNAIVWTDTRSQSIVH  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+     G     + CGLP+STY S+ KLLW+LENV  V+EA
Sbjct  120  KLKNR--KGAAELQQICGLPLSTYSSSTKLLWMLENVPKVREA  160



>ref|XP_007875438.1| hypothetical protein PNEG_03356 [Pneumocystis murina B123]
 gb|EMR08184.1| hypothetical protein PNEG_03356 [Pneumocystis murina B123]
Length=514

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
            SK    ++G+IDQGTTSTRF+I+DR+   V  HQ EF Q YP  GW+EHDP+EILESV++
Sbjct  5    SKMFSEYIGAIDQGTTSTRFLIFDRTGSIVSLHQHEFKQIYPHPGWIEHDPMEILESVEI  64

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C+ K ++       +V R +K +GITNQRET VVW K +G PLYNAIVW D RT  + R+
Sbjct  65   CIRKTIEDFVKKNKSV-RQIKGLGITNQRETIVVWDKDTGKPLYNAIVWSDTRTIEVVRE  123

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKE  543
            L+++      H  + CGLPISTYFSA+KL WLL+NV +V+E
Sbjct  124  LKQKEDASEVH--KICGLPISTYFSAVKLRWLLDNVRSVRE  162



>ref|XP_005702903.1| glycerol kinase [Galdieria sulphuraria]
 ref|XP_005709063.1| glycerol kinase [Galdieria sulphuraria]
 gb|EME26383.1| glycerol kinase [Galdieria sulphuraria]
 gb|EME32543.1| glycerol kinase [Galdieria sulphuraria]
Length=500

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 5/160 (3%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            + V+VG++DQGTTSTRF+++++   P+  HQ+E  Q YPQ GWVEHDPVEI+ +  +C+ 
Sbjct  2    QDVYVGAVDQGTTSTRFMLFNKQGEPIAFHQVEHKQIYPQPGWVEHDPVEIINNTILCID  61

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            + V K  A G    + +KAIGITNQRETTVVW K +G PL+NAIVW+D RT   C KL K
Sbjct  62   ETVKKCQAKGIQTSQ-IKAIGITNQRETTVVWDKYTGKPLFNAIVWLDTRTKETCEKLGK  120

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
                 R  + + CGLP+STYFS +KL W+++NV  VK A+
Sbjct  121  N----RDQYRDLCGLPVSTYFSGVKLRWIIDNVPDVKAAL  156



>gb|ELQ38941.1| glycerol kinase [Magnaporthe oryzae Y34]
 gb|ELQ61524.1| glycerol kinase [Magnaporthe oryzae P131]
Length=651

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  34   TREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDP  213
            T E GE    K    FVG+IDQGTTS+RF+I++ +   V SHQ+EF Q+YPQ GW EHDP
Sbjct  133  TTEMGEATHHKSSGSFVGAIDQGTTSSRFLIFNTAGEVVASHQLEFKQYYPQPGWHEHDP  192

Query  214  VEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  393
            +EI+ SV+ C+  AV    A GH+  R +K++GITNQRETTVVW +++G PL+NAIVW D
Sbjct  193  LEIVSSVETCIDGAVQAFEAQGHDP-RQIKSVGITNQRETTVVWDRTTGEPLHNAIVWTD  251

Query  394  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             R + + R+L++ L  G +   +  GLP+STY S  KLLW++ NV+ V+EA
Sbjct  252  VRASDLVRRLKRRL--GASELTQRSGLPLSTYPSVSKLLWMIANVDKVREA  300



>ref|XP_002843966.1| glycerol kinase 2 [Arthroderma otae CBS 113480]
 gb|EEQ34930.1| glycerol kinase 2 [Arthroderma otae CBS 113480]
Length=514

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + F+GSIDQGTTS+RF+I++     V SHQ+EFTQ YP  GW EHDP EI+ESV 
Sbjct  1    MAGVGKSFIGSIDQGTTSSRFLIFNTDGEVVASHQLEFTQIYPHPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C++ AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ R
Sbjct  61   ACINGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  KLKTRL--GHNELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>gb|KFY31403.1| hypothetical protein V493_01143 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=513

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            +F+GSIDQGTTS+RF+I++ +  PV SHQIEF Q YPQ GW EHDP+EI+ SV+ C+  A
Sbjct  10   LFIGSIDQGTTSSRFLIFNEAGDPVASHQIEFKQIYPQPGWHEHDPLEIVSSVEKCIDSA  69

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            V   T  GH +G+ +KAIGITNQRETTVVW++ +G PLYNAIVW D RT ++ R L++ L
Sbjct  70   VSAFTKQGHFLGQ-IKAIGITNQRETTVVWNQETGEPLYNAIVWTDTRTQALVRALKERL  128

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
              G    +E  G+P+STY S  KLLWLL N   V++A
Sbjct  129  --GADKILERVGVPLSTYPSIGKLLWLLHNEPKVQDA  163



>ref|XP_003237179.1| glycerol kinase [Trichophyton rubrum CBS 118892]
 gb|EGD85630.1| glycerol kinase [Trichophyton rubrum CBS 118892]
 gb|EZF12739.1| glycerol kinase [Trichophyton rubrum MR850]
 gb|EZF39186.1| glycerol kinase [Trichophyton rubrum CBS 100081]
 gb|EZF50020.1| glycerol kinase [Trichophyton rubrum CBS 288.86]
 gb|EZF60605.1| glycerol kinase [Trichophyton rubrum CBS 289.86]
 gb|EZF81884.1| glycerol kinase [Trichophyton rubrum MR1448]
 gb|EZF92546.1| glycerol kinase [Trichophyton rubrum MR1459]
 gb|EZG03731.1| glycerol kinase [Trichophyton rubrum CBS 735.88]
 gb|EZG14156.1| glycerol kinase [Trichophyton rubrum CBS 202.88]
 gb|KDB31096.1| glycerol kinase [Trichophyton rubrum D6]
Length=514

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>gb|EZF71154.1| glycerol kinase [Trichophyton soudanense CBS 452.61]
Length=514

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>gb|KDB23476.1| glycerol kinase [Trichophyton interdigitale MR816]
Length=514

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>ref|XP_002792127.1| glycerol kinase [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH34868.1| glycerol kinase [Paracoccidioides sp. 'lutzii' Pb01]
Length=510

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    + FVGSIDQGTTS+RF+I+  +   V SHQ+EF Q Y Q GW EHDP+EI+ SV+
Sbjct  1    MGSANESFVGSIDQGTTSSRFLIFSPAGEVVASHQLEFRQIYSQPGWHEHDPLEIVGSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++ + +KAIGITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-QSIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQTLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KL+  L  G     + CGLP+STY S  KLLW++ENV  VKEA
Sbjct  120  KLKNRL--GANELQDLCGLPLSTYPSVGKLLWMIENVRKVKEA  160



>ref|XP_007739070.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
 gb|EXJ75753.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
Length=515

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 109/158 (69%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            + FVGSIDQGTTSTRF+I+ R+   + SHQ+EF Q YP  GW EHDP+EI+ SV+ C+  
Sbjct  10   ETFVGSIDQGTTSTRFLIFSRNGEVIASHQMEFKQIYPHPGWHEHDPLEIISSVEQCIDG  69

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV      GH     +KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL+  
Sbjct  70   AVKDLETQGHASAN-IKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALIRKLKHR  128

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L  G     E CGLP+STY S  KLLWLL+N   VKEA
Sbjct  129  L--GSDQLQELCGLPLSTYPSVGKLLWLLDNEPKVKEA  164



>ref|XP_003717501.1| glycerol kinase [Magnaporthe oryzae 70-15]
 gb|EHA51182.1| glycerol kinase [Magnaporthe oryzae 70-15]
Length=516

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +1

Query  46   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  225
            GE    K    FVG+IDQGTTS+RF+I++ +   V SHQ+EF Q+YPQ GW EHDP+EI+
Sbjct  2    GEATHHKSSGSFVGAIDQGTTSSRFLIFNTAGEVVASHQLEFKQYYPQPGWHEHDPLEIV  61

Query  226  ESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  405
             SV+ C+  AV    A GH+  R +K++GITNQRETTVVW +++G PL+NAIVW D R +
Sbjct  62   SSVETCIDGAVQAFEAQGHDP-RQIKSVGITNQRETTVVWDRTTGEPLHNAIVWTDVRAS  120

Query  406  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             + R+L++ L  G +   +  GLP+STY S  KLLW++ NV+ V+EA
Sbjct  121  DLVRRLKRRL--GASELTQRSGLPLSTYPSVSKLLWMIANVDKVREA  165



>gb|KDB23477.1| glycerol kinase [Trichophyton interdigitale MR816]
Length=509

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>gb|EZF12740.1| glycerol kinase [Trichophyton rubrum MR850]
 gb|EZF39187.1| glycerol kinase [Trichophyton rubrum CBS 100081]
 gb|EZF50021.1| glycerol kinase [Trichophyton rubrum CBS 288.86]
 gb|EZF60606.1| glycerol kinase [Trichophyton rubrum CBS 289.86]
 gb|EZF81885.1| glycerol kinase [Trichophyton rubrum MR1448]
 gb|EZF92547.1| glycerol kinase [Trichophyton rubrum MR1459]
 gb|EZG03732.1| glycerol kinase [Trichophyton rubrum CBS 735.88]
 gb|EZG14157.1| glycerol kinase [Trichophyton rubrum CBS 202.88]
 gb|KDB31097.1| glycerol kinase [Trichophyton rubrum D6]
 gb|KFL60719.1| glycerol kinase [Trichophyton rubrum CBS 118892]
Length=509

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>gb|EEH23527.1| glycerol kinase [Paracoccidioides brasiliensis Pb03]
Length=510

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M    + FVGSIDQGTTS+RF+I+  +   V SHQ+EF Q Y Q GW EHDP+EI+ESV+
Sbjct  1    MGCANESFVGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYSQPGWHEHDPLEIVESVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV    + GH++   +KAIGITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-ESIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQALVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+  L  G     + CGLP+STY S  KLLW++ENV  VKEA
Sbjct  120  RLKSRL--GANELQDLCGLPLSTYPSVGKLLWMIENVRKVKEA  160



>gb|EZF71155.1| glycerol kinase [Trichophyton soudanense CBS 452.61]
Length=509

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 111/163 (68%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI+ESV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  AV      GH +   +KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDS-IKAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEA  160



>ref|XP_661520.1| hypothetical protein AN3916.2 [Aspergillus nidulans FGSC A4]
 gb|EAA59225.1| hypothetical protein AN3916.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF75098.1| TPA: glycerol kinase, putative (AFU_orthologue; AFUA_6G08470) 
[Aspergillus nidulans FGSC A4]
Length=608

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            ++FVGSIDQGTTSTRF+I++R   PV SHQ+EF Q YP  GW EHDP+E++ SV+ C+ +
Sbjct  5    KIFVGSIDQGTTSTRFLIFNREGDPVASHQVEFKQIYPNPGWHEHDPLELVSSVETCIEE  64

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV +   +G++  + +KA+GITNQRETTVVW   +G PLYNAIVW D R+ ++  +L+K+
Sbjct  65   AVKQFEINGYDQ-QSIKAVGITNQRETTVVWDHETGEPLYNAIVWTDTRSQAVVDELKKK  123

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             PG  +   + CGLP+STY S+ KLLW+L NV  VKEA
Sbjct  124  -PGA-SQLQQICGLPLSTYSSSSKLLWMLTNVPKVKEA  159



>gb|KIL91975.1| hypothetical protein FAVG1_04380 [Fusarium avenaceum]
Length=606

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            +VGSIDQGTTSTRF+I++    PV SHQ+EF   YP +GW EHDP+E+LESV+ C+ KA 
Sbjct  93   YVGSIDQGTTSTRFLIFNGHGEPVASHQMEFKNHYPNSGWHEHDPMELLESVETCIEKAT  152

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
            +K  A GH+    +++IG+TNQRETT++W  ++G  LYNA+VW D RT+++ R+L K  P
Sbjct  153  EKFIAQGHSADD-IRSIGLTNQRETTILWDSTTGEALYNAVVWPDTRTSALVREL-KNKP  210

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            G      ETCGLP+STY S++KLLW+L+NV++V++A
Sbjct  211  GAE-KLQETCGLPLSTYPSSVKLLWVLQNVDSVRQA  245



>gb|KEY70743.1| hypothetical protein S7711_03239 [Stachybotrys chartarum IBT 
7711]
 gb|KFA50933.1| hypothetical protein S40293_02410 [Stachybotrys chartarum IBT 
40293]
Length=539

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGSIDQGTTSTRF+I++    P+  HQ+EF   YP +GW E DP+E+L SV+ C
Sbjct  25   KKQHWFVGSIDQGTTSTRFLIFNGLGDPIAKHQMEFKNIYPHSGWHEQDPLELLRSVETC  84

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +   A GH V   ++++GITNQRETTV+W K++G PLYNA+ W D RTT++ R+L
Sbjct  85   IEKATEDFCAQGHTVSE-IRSVGITNQRETTVLWDKNTGEPLYNAVAWPDTRTTTLVREL  143

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +     G    ++ CGLP+STY S++KLLWLL+NV++VK A
Sbjct  144  KTR--DGADKLLDLCGLPLSTYPSSVKLLWLLQNVDSVKAA  182



>gb|KFA76269.1| hypothetical protein S40288_03598 [Stachybotrys chartarum IBT 
40288]
Length=539

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  FVGSIDQGTTSTRF+I++    P+  HQ+EF   YP +GW E DP+E+L SV+ C
Sbjct  25   KKQHWFVGSIDQGTTSTRFLIFNGLGDPIAKHQMEFKNIYPHSGWHEQDPLELLRSVETC  84

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA +   A GH V   ++++GITNQRETTV+W K++G PLYNA+ W D RTT++ R+L
Sbjct  85   IEKATEDFCAQGHTVSE-IRSVGITNQRETTVLWDKNTGEPLYNAVAWPDTRTTTLVREL  143

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +     G    ++ CGLP+STY S++KLLWLL+NV++VK A
Sbjct  144  KTR--DGADKLLDLCGLPLSTYPSSVKLLWLLQNVDSVKAA  182



>gb|KIN04900.1| hypothetical protein OIDMADRAFT_157379 [Oidiodendron maius Zn]
Length=580

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +1

Query  46   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  225
            GE    K++  F+GSID GTTS+RF+I+D   +PV SHQIEFT  +P++GW EHDP E+ 
Sbjct  41   GETDEEKQKHWFIGSIDCGTTSSRFLIFDGEGQPVASHQIEFTNLFPESGWHEHDPEELA  100

Query  226  ESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  405
             +V+ C+ KA +K    GH   + ++ IGITNQRETT+ W  ++G PLYNAIVW D RTT
Sbjct  101  TTVQECIDKATEKFFELGHKK-KDIRTIGITNQRETTICWDTNTGKPLYNAIVWPDTRTT  159

Query  406  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +I R+L+K    G     + CGLP+STY S++K LWL ENVEAVK+A
Sbjct  160  AIVRELKKR--KGADELPQKCGLPLSTYPSSVKFLWLYENVEAVKQA  204



>gb|EWM26199.1| glycerol kinase, partial [Nannochloropsis gaditana]
Length=222

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 109/155 (70%), Gaps = 4/155 (3%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            +VG+IDQGT+ST+FIIY+ S + V  HQ+E  Q YPQ GWVEHDP+EI  +   C+ +A+
Sbjct  9    YVGAIDQGTSSTKFIIYNHSGQQVGLHQLEHAQIYPQPGWVEHDPMEIWANTVTCIRRAM  68

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
            + A  D      LL+A+GITNQRE+T++W+K +G+P YN IVW DART  IC  L+    
Sbjct  69   ESANVDA----ELLEAVGITNQRESTLIWNKKTGVPYYNVIVWNDARTRGICEDLKTAGR  124

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKE  543
             G   F E  GLPI+TYFSA K+LWLL+NV  +++
Sbjct  125  RGIDRFREKTGLPIATYFSASKILWLLDNVPGLRD  159



>ref|XP_009216069.1| glycerol kinase [Gaeumannomyces graminis var. tritici R3-111a-1]
 gb|EJT80060.1| glycerol kinase [Gaeumannomyces graminis var. tritici R3-111a-1]
Length=607

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = +1

Query  22   NCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWV  201
            N    RE        E +VFVGSIDQGTTS+RFII++R   PV  HQIEF   YP++GW 
Sbjct  63   NVAQPREAQPVVQDTEGEVFVGSIDQGTTSSRFIIFNRQGEPVEGHQIEFENLYPESGWH  122

Query  202  EHDPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAI  381
            EHDP+E+L SV+ C+ + + K +A     G  ++A+GITNQRETTVVW   +G PLYNA+
Sbjct  123  EHDPLELLSSVEECIEQTMRKFSAS--RPGASVRAVGITNQRETTVVWDSVTGEPLYNAV  180

Query  382  VWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            VW D RT  + R+L      G    ++ CGLP+STY S++KLLWLL NVEAV  A
Sbjct  181  VWPDTRTGGLVRELRARE--GSADLLQLCGLPLSTYPSSVKLLWLLRNVEAVSRA  233



>ref|XP_007583629.1| putative glycerol kinase protein [Neofusicoccum parvum UCRNP2]
 gb|EOD48902.1| putative glycerol kinase protein [Neofusicoccum parvum UCRNP2]
Length=580

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 118/159 (74%), Gaps = 3/159 (2%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E VFVG+IDQGTTS+RF+I++ +   V SHQ+EFTQ++P +GW EHDP EI+ SV+VC+ 
Sbjct  6    EDVFVGAIDQGTTSSRFLIFNPAGELVASHQVEFTQYFPNSGWHEHDPQEIISSVEVCIE  65

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            +AV    + G++    +KA+GITNQRETTVVW + +G PLYNAIVW D R  ++ R+L K
Sbjct  66   EAVKSFESQGYSR-SAIKAVGITNQRETTVVWDRETGKPLYNAIVWTDTRAQALVREL-K  123

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            + PG     ++ CGLP+STY S+ KLLW+L+NV  VK A
Sbjct  124  QRPGA-DKLLQVCGLPLSTYPSSAKLLWMLDNVPDVKAA  161



>ref|XP_001214980.1| glycerol kinase 2 [Aspergillus terreus NIH2624]
 gb|EAU33563.1| glycerol kinase 2 [Aspergillus terreus NIH2624]
Length=584

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            +FVGSIDQGTTSTRF+I++    PV SHQ+EFTQ YP  GW EHDP+E+  SV  CV +A
Sbjct  1    MFVGSIDQGTTSTRFLIFNHEGEPVASHQVEFTQIYPNPGWHEHDPLELESSVYTCVEEA  60

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            V K  A G++    +K IGITNQRETTVVW   +G PLYNAIVW D R+ SI  +L+K  
Sbjct  61   VKKFEATGYSR-ETIKGIGITNQRETTVVWDHETGEPLYNAIVWTDTRSQSIVDELKKRP  119

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
               +    + CGLP+STY SA KLLW+LENV  VK+A
Sbjct  120  EASQLQ--QLCGLPLSTYSSATKLLWMLENVPRVKDA  154



>ref|XP_008020290.1| hypothetical protein SETTUDRAFT_40870 [Setosphaeria turcica Et28A]
 gb|EOA91980.1| hypothetical protein SETTUDRAFT_40870 [Setosphaeria turcica Et28A]
Length=551

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
             K +Q F+GSIDQGTTSTRFII+D    PV  HQIEFTQ YPQ+GW EHDP EI++SV+ 
Sbjct  32   GKLKQFFIGSIDQGTTSTRFIIFDGLGEPVAQHQIEFTQKYPQSGWHEHDPWEIIDSVEQ  91

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C+ +A +    +GHN+   +KA+GITNQRETT+VW  ++GLPL NAI W D RT  + R+
Sbjct  92   CIDRATNIFIDNGHNI-EDIKAVGITNQRETTIVWDTNTGLPLCNAIAWPDTRTKGLVRE  150

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L+     G    +  CGLP+STY S++KL W+L++ E V++A
Sbjct  151  LKDRK--GADELLNMCGLPLSTYPSSVKLRWMLDHDENVRKA  190



>gb|EKG13278.1| Carbohydrate kinase FGGY [Macrophomina phaseolina MS6]
Length=564

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 117/166 (70%), Gaps = 6/166 (4%)
 Frame = +1

Query  49   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILE  228
            E++M   EQ F+GSIDQGTTS+RFII+D +  PV  HQIEFTQ YP++GW EHDP E+++
Sbjct  45   EKRM---EQFFIGSIDQGTTSSRFIIFDGTGTPVAMHQIEFTQKYPESGWHEHDPWELVQ  101

Query  229  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  408
            SVK C+ +A +K    GH V   +KA+GITNQRET +VW   +G PL+NAI W D RT  
Sbjct  102  SVKECIEEATNKFIKLGHKVSD-IKAVGITNQRETVLVWDAETGQPLHNAIAWPDTRTKG  160

Query  409  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            + R  + +   G     E CGLP+STY SA+KL+WL+ NV AVK+A
Sbjct  161  LVRDFKSK--AGSEVLPEICGLPLSTYPSAVKLVWLIRNVPAVKQA  204



>ref|XP_007785100.1| glycerol kinase [Coniosporium apollinis CBS 100218]
 gb|EON69783.1| glycerol kinase [Coniosporium apollinis CBS 100218]
Length=580

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 115/159 (72%), Gaps = 3/159 (2%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            ++ FVG+IDQGTTS+RF+I+++   PV SHQIEF Q YP  GW EHDP EI+ SV++C+ 
Sbjct  73   DETFVGAIDQGTTSSRFLIFNKEGEPVASHQIEFKQIYPHPGWHEHDPEEIVTSVQLCMD  132

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            +AV      G++    +KAIGITNQRETTVVW K++G PLYNAIVW D R+ ++ R+L+ 
Sbjct  133  EAVKLFKRRGYSRDS-IKAIGITNQRETTVVWDKNTGEPLYNAIVWTDTRSAALVRELKT  191

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
                G     + CGLP+STY S  KLLW+LENV+ VK+A
Sbjct  192  R--SGADKLQDKCGLPLSTYPSVSKLLWMLENVDKVKQA  228



>gb|KHO01811.1| Glycerol kinase [Metarhizium album ARSEF 1941]
Length=527

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E+ F+GSIDQGTTSTRF+I++ +  PV  HQ+  +  +P++GW EHDP+E+LE+V+ C+ 
Sbjct  16   EETFLGSIDQGTTSTRFVIFNANGEPVALHQMGLSNVHPESGWHEHDPLELLETVETCIK  75

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE-  426
            +A  K T  G ++ + + AIG+TNQRETTV+W+K++G PLYNAIVW D RT ++ R+L+ 
Sbjct  76   EAAKKFTDKGFDIAK-INAIGVTNQRETTVLWNKNTGEPLYNAIVWPDTRTKALVRELKV  134

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            KE   G    ++ CGLP+STY S++KLLWLL+N EAVK A
Sbjct  135  KE---GSDKLLDLCGLPLSTYPSSVKLLWLLQNNEAVKAA  171



>gb|EKG19925.1| Carbohydrate kinase FGGY [Macrophomina phaseolina MS6]
Length=579

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
              E +FVG+IDQGTTS+RF+I++ S   V SHQ+EFTQ++P +GW EHDP+EI+ SV++C
Sbjct  4    NNEDIFVGAIDQGTTSSRFLIFNPSGELVASHQVEFTQYFPNSGWHEHDPLEIVSSVEIC  63

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + +AV    + G+   + +KA+GITNQRETTVVW + +G PLYNAIVW D R  ++ R+L
Sbjct  64   IDEAVKSFESQGYTRSQ-IKAVGITNQRETTVVWDRETGEPLYNAIVWTDTRAQALVREL  122

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             K  PG      + CGLP+STY S  KLLW+LENV  V+ A
Sbjct  123  -KARPGA-DKLQQVCGLPLSTYPSCAKLLWMLENVPDVQAA  161



>gb|EFX03253.1| glycerol kinase [Grosmannia clavigera kw1407]
Length=591

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +EQ FVGSIDQGTTS+RFII+D +  PV SHQ EF   YP +GW E +P+E+L SV  C+
Sbjct  56   KEQWFVGSIDQGTTSSRFIIFDGNGVPVASHQFEFENLYPNSGWHEQNPMELLASVNHCI  115

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
             KA+ K TA GH   R ++A+GITNQRET +VW   +G  LYNA+VW D RT ++ R+L+
Sbjct  116  DKAMRKFTALGHQKSR-IRAVGITNQRETAIVWDTVTGKALYNAVVWPDTRTAALVRELK  174

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            K     +   ++ CGLP+STY S++KL WLL+NV+AV+EA 
Sbjct  175  KRPDADK--LLDLCGLPLSTYPSSVKLSWLLQNVDAVREAA  213



>ref|XP_008724472.1| glycerol kinase [Cladophialophora carrionii CBS 160.54]
 gb|ETI26813.1| glycerol kinase [Cladophialophora carrionii CBS 160.54]
Length=532

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K ++ FVG+ID GTTS+RF+I+DR   PV  HQIEF Q YP +GW EHDP E++ SV  C
Sbjct  4    KSDESFVGAIDNGTTSSRFLIFDRKGNPVAEHQIEFKQHYPHSGWHEHDPNELVSSVSTC  63

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA  + T+ G+++   +KA+GITNQRETTVVW   +G PLYNAIVW D R+  I R+L
Sbjct  64   IDKACAEFTSQGYSLSN-IKAVGITNQRETTVVWDVKTGEPLYNAIVWTDTRSAHIVREL  122

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +++   G    +  CGLP+STY S+ KLLW++ +V+ VK+A
Sbjct  123  KQK--SGADELIGLCGLPLSTYPSSTKLLWMMRHVDKVKKA  161



>gb|EPE08983.1| glycerol kinase [Ophiostoma piceae UAMH 11346]
Length=628

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 9/171 (5%)
 Frame = +1

Query  34   TREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDP  213
            T EE +RK       FVGSIDQGTTS+RFII+D   +PV SHQ+EF   YP +GW E DP
Sbjct  57   TEEERQRKW------FVGSIDQGTTSSRFIIFDGDGKPVASHQLEFENLYPNSGWHEQDP  110

Query  214  VEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  393
            +E+L SV+ C+ K V K    GH+   L++++GITNQRETT+VW   +G PL NA+VW D
Sbjct  111  MELLASVETCIEKGVQKFIELGHDK-LLIRSVGITNQRETTLVWDTETGKPLNNAVVWPD  169

Query  394  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             RTT++ R+L+      +    + CGLP+STY S++KL WLLENV+AV+EA
Sbjct  170  TRTTALVRELKARPDADK--LTDLCGLPLSTYPSSVKLKWLLENVDAVREA  218



>ref|XP_003845263.1| similar to glycerol kinase [Leptosphaeria maculans JN3]
 emb|CBY01784.1| similar to glycerol kinase [Leptosphaeria maculans JN3]
Length=551

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            +Q F+GSIDQGTTSTRFII+D    PV  HQIEF Q+YPQ+GW EHDP EI+ SV+ C+ 
Sbjct  35   KQFFIGSIDQGTTSTRFIIFDGVGDPVAQHQIEFKQYYPQSGWHEHDPKEIITSVEECID  94

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
            +A +     GH+V   +KA+GITNQRETTVVW   +G PLYNAI W D RT  + R+L+ 
Sbjct  95   RATNIFLDQGHDVSD-IKAVGITNQRETTVVWDTKTGEPLYNAIAWPDTRTKGLVRELKN  153

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
                G    +  CGLP+STY S++KL W+L++VE  ++A
Sbjct  154  R--KGADELLNICGLPLSTYPSSVKLRWILDHVEPARKA  190



>gb|EKV13298.1| Glycerol kinase, putative [Penicillium digitatum PHI26]
 gb|EKV19172.1| Glycerol kinase, putative [Penicillium digitatum Pd1]
Length=523

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            + FVGSIDQGTTSTRF+I++R+  PV SHQ+EF+Q YP  GW EHDP+EI+ SV+ C+ +
Sbjct  5    ETFVGSIDQGTTSTRFLIFNRAGEPVASHQVEFSQIYPIPGWHEHDPLEIMISVETCIEE  64

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV    A G+N    +++IGITNQRETT+VW   +G PLYNAIVW D R+ SI  +L K+
Sbjct  65   AVQNFEAQGYNRSS-IQSIGITNQRETTIVWDHKTGEPLYNAIVWTDTRSQSIVVEL-KQ  122

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             PG        CGLP+STY SA KLLW+L +V  VK+A
Sbjct  123  KPGA-AQIQTLCGLPLSTYSSATKLLWMLAHVPRVKDA  159



>ref|XP_001796578.1| hypothetical protein SNOG_06196 [Phaeosphaeria nodorum SN15]
 gb|EAT86027.1| hypothetical protein SNOG_06196 [Phaeosphaeria nodorum SN15]
Length=550

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  34   TREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDP  213
            T++  +    K +  F+GSIDQGTTSTRFII+D    PV  HQIEFTQ YPQ+GW EHDP
Sbjct  22   TQDGSQLDEEKLKNFFIGSIDQGTTSTRFIIFDGLGEPVAQHQIEFTQKYPQSGWHEHDP  81

Query  214  VEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  393
             EI+ SV+ C+ +A        H +   +KAIGITNQRETTVVW   +G PLYNAI W D
Sbjct  82   KEIIASVEECMERATSIFVDMEHEISD-IKAIGITNQRETTVVWDTHTGEPLYNAIAWPD  140

Query  394  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             RT  + R+L+     G     + CGLP+STY S++KL+WLL++V+AVKEA
Sbjct  141  TRTKGLVRELKAR--DGADKLQDMCGLPLSTYPSSVKLMWLLQHVDAVKEA  189



>gb|ESA10637.1| hypothetical protein GLOINDRAFT_3264 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71814.1| glycerol kinase [Rhizophagus irregularis DAOM 197198w]
Length=502

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+GSIDQGTTS+RF+I+D     +  HQ+EF Q+YP  GW+EHDP++ILESV  C+ K +
Sbjct  4    FIGSIDQGTTSSRFLIFDSKGALIDYHQVEFAQYYPNPGWIEHDPIDILESVYECIEKGL  63

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
             K    G++V   +KAIG+TNQRETT+VW K +G  L NAIVW DART  +   L  +  
Sbjct  64   KKFIDKGYSVTD-IKAIGVTNQRETTIVWDKFTGKHLCNAIVWCDARTHHLVHDLNSK--  120

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G     E CGLPISTYFSA+KL WLLENV  VKEA
Sbjct  121  HGTNALKELCGLPISTYFSAVKLKWLLENVSTVKEA  156



>ref|XP_750736.1| glycerol kinase [Aspergillus fumigatus Af293]
 gb|EAL88698.1| glycerol kinase, putative [Aspergillus fumigatus Af293]
 gb|EDP49416.1| glycerol kinase, putative [Aspergillus fumigatus A1163]
Length=593

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   E++FVGSIDQGTTS+RF+I+++   PV SHQ+EFTQ YP  GW EHDP E++ SV+
Sbjct  1    MQPSEEIFVGSIDQGTTSSRFLIFNKEGEPVASHQVEFTQIYPNPGWHEHDPFELVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+ +AV +  ++G++    +KAIGITNQRETTVVW   +G PLYNAIVW D R  +I  
Sbjct  61   KCIEEAVKQFESEGYSR-YGIKAIGITNQRETTVVWDHDTGEPLYNAIVWTDTRPQAIVH  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+++    +   +  CGLP++TY SA KLLW++E+V  VK+A
Sbjct  120  ELKQKRESSQLQAI--CGLPLTTYSSATKLLWMIEHVPKVKDA  160



>gb|KEY82231.1| glycerol kinase [Aspergillus fumigatus var. RP-2014]
Length=593

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M   E++FVGSIDQGTTS+RF+I+++   PV SHQ+EFTQ YP  GW EHDP E++ SV+
Sbjct  1    MQPSEEIFVGSIDQGTTSSRFLIFNKEGEPVASHQVEFTQIYPNPGWHEHDPFELVSSVE  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+ +AV +  ++G++    +KAIGITNQRETTVVW   +G PLYNAIVW D R  +I  
Sbjct  61   KCIEEAVKQFESEGYSR-YGIKAIGITNQRETTVVWDHDTGEPLYNAIVWTDTRPQAIVH  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+++    +   +  CGLP++TY SA KLLW++E+V  VK+A
Sbjct  120  ELKQKRESSQLQAI--CGLPLTTYSSATKLLWMIEHVPKVKDA  160



>emb|CDM35394.1| Putative glycerol kinase 3 [Penicillium roqueforti FM164]
Length=620

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 110/157 (70%), Gaps = 3/157 (2%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            +FVGSIDQGTTSTRF+I++R   PV SHQ+EF+Q YP  GW EHDP EI+ SV+ C+ +A
Sbjct  6    IFVGSIDQGTTSTRFLIFNREGEPVTSHQVEFSQIYPNPGWHEHDPFEIITSVETCMEEA  65

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            V K  A GH     ++ IGITNQRETT+VW   +G PLYNAIVW D R+  I  +L K+ 
Sbjct  66   VHKFEAQGHTRSS-IQGIGITNQRETTIVWDHETGEPLYNAIVWTDTRSQGIVAEL-KQK  123

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            PG        CGLP+STY SA KL+W+L +V  VK+A
Sbjct  124  PGAE-QLQALCGLPLSTYSSATKLIWMLRHVPRVKDA  159



>ref|XP_007289663.1| putative glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD19822.1| putative glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=648

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K++  F+GSID GTTS+RF+I++    PV SHQIEF   YP++GW EH+P E++ SV+ C
Sbjct  124  KQKHWFIGSIDCGTTSSRFLIFNGEGNPVASHQIEFDNIYPESGWHEHNPQELVASVEEC  183

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + KA  K   DG+   + +KAIGITNQRETT+ W  ++G PLYNAIVW D RTTSI R+L
Sbjct  184  IDKATAKFQEDGYTTSQ-IKAIGITNQRETTICWDTNTGEPLYNAIVWPDTRTTSIVREL  242

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +K    G     + CGLP+STY S++KLLWL  NV+AVK A
Sbjct  243  KKRE--GADELQQLCGLPLSTYPSSVKLLWLCRNVDAVKNA  281



>ref|XP_007674509.1| hypothetical protein BAUCODRAFT_32546 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC98500.1| hypothetical protein BAUCODRAFT_32546 [Baudoinia compniacensis 
UAMH 10762]
Length=604

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            Q F+GSIDQGTTSTRFII+D + +PV SHQ EF Q YPQ+GW EHDP E++ SV+VCV K
Sbjct  89   QFFIGSIDQGTTSTRFIIFDGTGQPVASHQHEFKQHYPQSGWHEHDPKELIASVEVCVKK  148

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV    A GH++   +KA+G+TNQRETT VW+  +G PLYN I W D RT  + R L+++
Sbjct  149  AVATFQAMGHDI-EDIKAVGLTNQRETTCVWNVETGEPLYNTIAWPDTRTKGLVRDLKQK  207

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
                        GLP+STY S++KL+WLL++V AVKEA
Sbjct  208  EKDMGLDLTYLTGLPLSTYPSSVKLVWLLQHVPAVKEA  245



>gb|KIW77253.1| glycerol kinase [Fonsecaea pedrosoi CBS 271.37]
Length=534

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            + K  + FVG+ID GTTSTRF+I+D +  PV  HQIEF Q+YP +GW EHDP E++ SV 
Sbjct  2    VDKSNKTFVGAIDNGTTSTRFLIFDPAGNPVAEHQIEFEQYYPHSGWHEHDPEELVSSVC  61

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+ +A    T+ GH++   +KAIGITNQRETTVVW   +G PL+NAIVW D R+  I R
Sbjct  62   TCIDEACASFTSQGHSLSD-IKAIGITNQRETTVVWDVKTGEPLHNAIVWTDTRSAHIVR  120

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+++   G    ++ CGLP+STY S+ KLLW+L +V+ VK+A
Sbjct  121  ELKQK--KGADKLMDLCGLPLSTYPSSTKLLWMLNHVDKVKKA  161



>dbj|BAE57019.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=513

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            +  ++FVGSIDQGTTSTRF+I++R   PV SHQ+EF Q YP++GW EH+P++++ SV+ C
Sbjct  2    QPSEIFVGSIDQGTTSTRFLIFNREGEPVASHQVEFPQIYPKSGWHEHNPLDLVSSVETC  61

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            V +AV +  + G++    +KA+GITNQRETTVVW   +G PL NAIVW D R+ +I + L
Sbjct  62   VEQAVKQFESTGYSRND-IKAVGITNQRETTVVWDYETGEPLCNAIVWTDTRSQAIVKDL  120

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             KE PG  +   + CGLP+STY S+ KLLW+L NV  VK+A
Sbjct  121  -KEKPGA-SRLQQICGLPLSTYSSSSKLLWMLTNVPRVKDA  159



>ref|XP_002478964.1| glycerol kinase, putative [Talaromyces stipitatus ATCC 10500]
 gb|EED22001.1| glycerol kinase, putative [Talaromyces stipitatus ATCC 10500]
Length=576

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            FVGSIDQGTTSTRF+I++R   PV SHQ+EF Q YP  GW EHDP+E++ SV+ C+ +AV
Sbjct  8    FVGSIDQGTTSTRFLIFNRDGEPVASHQVEFEQIYPNPGWHEHDPLELVSSVETCIEEAV  67

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
             K    GH     +KAIGITNQRETTV+W   +G PL+NAIVW D R+ +I R+L     
Sbjct  68   KKFEEIGHTR-ESIKAIGITNQRETTVLWDSETGEPLHNAIVWTDTRSQTIVRELRSR--  124

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G     + CGLP+STY S+ KLLW+++NV  VKEA
Sbjct  125  KGAEDLQQICGLPLSTYPSSTKLLWMVKNVPKVKEA  160



>emb|CCF45414.1| glycerol kinase [Colletotrichum higginsianum]
Length=547

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  67   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCV  246
            +EQ FVGSIDQGTTSTRF+I++    PV  HQIEF   YP++GW EHDP+E+L SV+ C+
Sbjct  32   KEQWFVGSIDQGTTSTRFLIFNGLGDPVAMHQIEFENHYPRSGWHEHDPLELLASVEECI  91

Query  247  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  426
             KA  K  A GH     ++ +GITNQRETTV+W   +G PL+NA+VW D RT S+ R L 
Sbjct  92   EKATAKFVAKGHPA-SAIRGVGITNQRETTVLWDARTGEPLHNALVWPDTRTASLVRDL-  149

Query  427  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +  PG  T   + CGLP+STY S++KL WLL+NV AV+EA
Sbjct  150  RARPGADT-LQDLCGLPLSTYPSSVKLRWLLDNVPAVREA  188



>gb|EMF13374.1| glycerol kinase [Sphaerulina musiva SO2202]
Length=539

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+  E+VFVGSIDQGTTS+RF+I+D++  PV  HQ EF+Q YP  GW EHDP EI++SV+
Sbjct  1    MAPPEEVFVGSIDQGTTSSRFLIFDKNGEPVAVHQEEFSQIYPNPGWHEHDPEEIVQSVQ  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  A+    + G++    +++IGITNQRETTVVW   +G PLYNAIVW D RT ++ R
Sbjct  61   NCIEGALKDFESKGYSKAS-IQSIGITNQRETTVVWDNKTGEPLYNAIVWTDTRTAALAR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+      +    + CGLPISTY S  KLLWLL+N + VK+A
Sbjct  120  ELKARPDSDK--LTDICGLPISTYPSVTKLLWLLKNEDKVKKA  160



>gb|EXL75811.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
Length=494

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|EXK28283.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
Length=494

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|EMT71501.1| Glycerol kinase [Fusarium oxysporum f. sp. cubense race 4]
 gb|EWZ32750.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ85854.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA35800.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK84478.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL45424.1| glycerol kinase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL99600.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=494

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|ENH75487.1| Glycerol kinase [Fusarium oxysporum f. sp. cubense race 1]
Length=494

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|KEQ89714.1| glycerol kinase [Aureobasidium pullulans EXF-150]
Length=514

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+GSIDQGTTS+RF+I++++  PV SHQ EF+Q YPQ GW EHDP EI+ SV  C+  AV
Sbjct  4    FIGSIDQGTTSSRFLIFNKNGEPVASHQEEFSQIYPQPGWHEHDPEEIVSSVHSCIEGAV  63

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
            +    DG++V   +KAIGITNQRETTVVW   SG  LYNAIVW D R+ +I ++L+    
Sbjct  64   EAFKKDGNSVDS-IKAIGITNQRETTVVWDIESGEALYNAIVWTDTRSQAIVKELKSR--  120

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G    ++ CGLP+STY S  KLLWLL+N   VKEA
Sbjct  121  KGADELMQKCGLPLSTYPSVTKLLWLLKNEPKVKEA  156



>emb|CCJ30886.1| unnamed protein product [Pneumocystis jirovecii]
Length=507

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 117/162 (72%), Gaps = 6/162 (4%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            MS E   ++G+IDQGTTS+RF I+D++      +Q EF Q Y   GW+EH+P+EIL SVK
Sbjct  1    MSSE---YIGAIDQGTTSSRFFIFDKNGCIASLYQHEFPQIYSSPGWIEHNPMEILNSVK  57

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
            +C+ KA+ +    G ++ RL+KA+GI NQRETTVVW K++G+PLYNAIVW D RTT    
Sbjct  58   ICIEKAIGEFVKKGKSI-RLIKAVGIANQRETTVVWDKTTGIPLYNAIVWSDTRTTETVY  116

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKE  543
            +L+++      H  E CGLPISTYFSA+KL WLL+NV+ V++
Sbjct  117  QLKQKEYASEIH--EKCGLPISTYFSAVKLRWLLDNVKDVRD  156



>gb|EME45283.1| hypothetical protein DOTSEDRAFT_87671 [Dothistroma septosporum 
NZE10]
Length=541

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  58   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVK  237
            M+   +VFVGSIDQGTTS+RF+I+D++  PV  HQ EF+Q YP  GW EHDP EI++SV+
Sbjct  1    MASSGEVFVGSIDQGTTSSRFLIFDKAGEPVAVHQEEFSQIYPNPGWHEHDPDEIVQSVQ  60

Query  238  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  417
             C+  A+     DG +    +KAIGITNQRETTV W   +G PLYNAIVW D RT ++ R
Sbjct  61   NCIEGALRIFEKDGRSKDS-IKAIGITNQRETTVCWDNETGEPLYNAIVWTDTRTAALAR  119

Query  418  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +L+      +    + CGLPISTY S  KLLWLL+N E VK+A
Sbjct  120  ELKARPDSDK--LTDVCGLPISTYPSVTKLLWLLKNSEKVKKA  160



>ref|XP_002837355.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81546.1| unnamed protein product [Tuber melanosporum]
Length=560

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 3/166 (2%)
 Frame = +1

Query  52   RKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILES  231
            R  + E + F  +IDQGTTS+RF+I+D S  P   HQ+EF Q YP +GWVEHDP EIL S
Sbjct  41   RLKNGEREAFTAAIDQGTTSSRFLIFDGSGTPRAGHQVEFEQLYPHSGWVEHDPYEILNS  100

Query  232  VKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSI  411
            V  C+  A       G+ VG  +KA+GITNQRETTVVW   +G PLYNAIVW D RT+ +
Sbjct  101  VNECIENATKMFFDQGYGVGD-IKALGITNQRETTVVWDTETGKPLYNAIVWPDTRTSKL  159

Query  412  CRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
              +L ++  GG     + CGLP+STY S++KL+W+L +V AV+ A+
Sbjct  160  VHELRRK--GGSEKLQQLCGLPLSTYPSSVKLMWMLRHVPAVQSAL  203



>gb|KIE03648.1| Carbohydrate kinase, FGGY, partial [Metarhizium majus ARSEF 297]
Length=527

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +1

Query  55   KMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESV  234
            +    E+ FVGSIDQGTTSTRF+I++ +  PV  HQ+ F   +P++GW EHDP E+L++V
Sbjct  11   RTGDAEETFVGSIDQGTTSTRFVIFNANGEPVALHQMGFGNVHPESGWHEHDPHELLQTV  70

Query  235  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  414
            + C+ +A  K T  G ++ + + AIG+TNQRETTVVW K++G PLYNAIVW D RT ++ 
Sbjct  71   ETCIQQATKKFTDKGFDIAK-IHAIGVTNQRETTVVWDKNTGEPLYNAIVWPDTRTKALV  129

Query  415  RKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            R+L+ +   G    +  CGLP+STY S++KLLWLL N +AVK A
Sbjct  130  RELKAKQ--GSDKLLGLCGLPLSTYPSSVKLLWLLRNNDAVKAA  171



>ref|XP_001267955.1| glycerol kinase, putative [Aspergillus clavatus NRRL 1]
 gb|EAW06529.1| glycerol kinase, putative [Aspergillus clavatus NRRL 1]
Length=596

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 114/157 (73%), Gaps = 3/157 (2%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            +FVGSIDQGTTS+RF+I++R   PV SHQ+EFTQ YP  GW EHDP+E++ SV+ C+ +A
Sbjct  6    IFVGSIDQGTTSSRFLIFNRDGEPVASHQVEFTQIYPNPGWHEHDPLELVSSVETCIEEA  65

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            V +  + G++    +K IGITNQRETTVVW   +G PLYNAIVW D R+ +I  +L+++ 
Sbjct  66   VKQFESTGYSQ-YSIKGIGITNQRETTVVWDHETGEPLYNAIVWTDTRSQTIVHELKQKW  124

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
                +   + CGLP+STY S+ KLLW+L NV  VK+A
Sbjct  125  EA--SQLQQICGLPLSTYSSSSKLLWMLSNVPKVKDA  159



>gb|KEF57655.1| glycerol kinase [Exophiala aquamarina CBS 119918]
Length=537

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = +1

Query  73   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSK  252
            + F+GSID GTTS+RF+I+D +  PV  HQIEF Q+YP +GW EHDP E++ SV  C+ K
Sbjct  5    KTFIGSIDNGTTSSRFLIFDAAGNPVAQHQIEFKQYYPHSGWHEHDPFELVSSVSECIDK  64

Query  253  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  432
            AV++    GH++   ++A+GITNQRETT VW   +G PL+N+IVW D RT+SI  +L+  
Sbjct  65   AVEEFETQGHSISD-IQAVGITNQRETTCVWDTKTGEPLHNSIVWTDTRTSSIVHQLKAR  123

Query  433  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
               G     + CGLP+STY S  KLLWL++NV+ VK+A
Sbjct  124  --DGADELQDLCGLPLSTYPSCTKLLWLMKNVDKVKKA  159



>gb|EWZ32741.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32742.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32743.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32744.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32745.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32746.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32747.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32748.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ32749.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ85845.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85846.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85847.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85848.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85849.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85850.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85851.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85852.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ85853.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA35784.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35785.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35786.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35787.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35788.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35789.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35790.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35791.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35792.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35793.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35794.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35795.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35796.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35797.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35798.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA35799.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK84462.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84463.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84464.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84465.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84466.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84467.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84468.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84469.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84470.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84471.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84472.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84473.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84474.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84475.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84476.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK84477.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL45421.1| glycerol kinase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL45422.1| glycerol kinase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL45423.1| glycerol kinase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL99589.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99590.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99591.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99592.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99593.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99594.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99595.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99596.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99597.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99598.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXL99599.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM16754.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16755.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16756.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16757.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16758.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16759.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16760.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16761.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16762.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM16763.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=516

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>ref|XP_001819021.2| glycerol kinase [Aspergillus oryzae RIB40]
 gb|EIT73215.1| ribulose kinase [Aspergillus oryzae 3.042]
 gb|KDE82193.1| ribulose kinase [Aspergillus oryzae 100-8]
Length=591

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            +  ++FVGSIDQGTTSTRF+I++R   PV SHQ+EF Q YP++GW EH+P++++ SV+ C
Sbjct  2    QPSEIFVGSIDQGTTSTRFLIFNREGEPVASHQVEFPQIYPKSGWHEHNPLDLVSSVETC  61

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            V +AV +  + G++    +KA+GITNQRETTVVW   +G PL NAIVW D R+ +I + L
Sbjct  62   VEQAVKQFESTGYSRND-IKAVGITNQRETTVVWDYETGEPLCNAIVWTDTRSQAIVKDL  120

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             KE PG  +   + CGLP+STY S+ KLLW+L NV  VK+A
Sbjct  121  -KEKPGA-SRLQQICGLPLSTYSSSSKLLWMLTNVPRVKDA  159



>ref|XP_007582400.1| putative glycerol kinase protein [Neofusicoccum parvum UCRNP2]
 gb|EOD50145.1| putative glycerol kinase protein [Neofusicoccum parvum UCRNP2]
Length=564

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = +1

Query  49   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILE  228
            E++M   EQ F+GSIDQGTTS+RFII+D +  PV  HQIEFTQ YP++GW EHDP E+++
Sbjct  45   EKRM---EQFFIGSIDQGTTSSRFIIFDGTGTPVAMHQIEFTQKYPESGWHEHDPWELVQ  101

Query  229  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  408
            +VK C+ +A  K    GH V   +KA+GITNQRET +VW   +G PL+NAI W D RT  
Sbjct  102  TVKECIEEATKKFEQLGHKVSD-IKAVGITNQRETVLVWDAETGEPLHNAIAWPDTRTKG  160

Query  409  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            + R  + +   G     E CGLP+STY SA+KL+WL+ NV AVK+A
Sbjct  161  LVRDFKSKE--GSEVLKEICGLPLSTYPSAVKLVWLIRNVPAVKQA  204



>gb|EWG48859.1| glycerol kinase [Fusarium verticillioides 7600]
Length=516

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|EGU81741.1| hypothetical protein FOXB_07748 [Fusarium oxysporum Fo5176]
 gb|EXL75795.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75796.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75797.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75798.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75799.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75800.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75801.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75802.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75803.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75804.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75805.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75806.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75807.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75808.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75809.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXL75810.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
Length=516

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|EXK28275.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK28276.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK28277.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK28278.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK28279.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK28280.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK28281.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK28282.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
Length=516

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|EWY83399.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83400.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83401.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83402.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83403.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83404.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83405.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83406.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83407.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83408.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
 gb|EWY83409.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
Length=516

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPDVKDA  164



>ref|XP_007915417.1| putative glycerol kinase protein [Togninia minima UCRPA7]
 gb|EON99756.1| putative glycerol kinase protein [Togninia minima UCRPA7]
Length=559

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E  FVGSIDQGTTSTRF+I++     VVSHQIEF   YP++GW EH+P+E+L SV+ C+ 
Sbjct  45   EHWFVGSIDQGTTSTRFLIFNGEGDVVVSHQIEFENLYPESGWHEHEPLELLTSVEDCME  104

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
             A+ K    G +    ++AIGITNQRETTVVW K +G PL+NA+VW D RTT++ R+L+ 
Sbjct  105  GAMAKFAELGRSAAD-IRAIGITNQRETTVVWDKHTGEPLHNAVVWPDTRTTNLVRELKT  163

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
                G     + CGLP+STY S++KLLWLLENV+AVK+A
Sbjct  164  R--DGADELQQLCGLPLSTYPSSVKLLWLLENVDAVKKA  200



>gb|KIL87347.1| glycerol kinase [Fusarium avenaceum]
Length=516

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KPNPTFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQYYPHPGWHEHDPEELVSSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+   + GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFESQGHSREQ-IKAVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELIARCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>ref|XP_001257963.1| glycerol kinase, putative [Neosartorya fischeri NRRL 181]
 gb|EAW16066.1| glycerol kinase, putative [Neosartorya fischeri NRRL 181]
Length=593

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            +  ++FVGSIDQGTTS+RF+I++R   PV SHQ+EFTQ YP  GW EHDP E++ SV+ C
Sbjct  2    QPSEIFVGSIDQGTTSSRFLIFNRDGEPVASHQVEFTQIYPNPGWHEHDPFELVSSVETC  61

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + +AV +  ++G++    +KAIGITNQRETTVVW   +G PLYNAIVW D R  +I  +L
Sbjct  62   IEEAVKQFESEGYSR-YSVKAIGITNQRETTVVWDHETGEPLYNAIVWTDTRPQAIVHEL  120

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +++    +   +  CGLP++TY SA KLLW++E+V  VK+A
Sbjct  121  KQKREASQLQPI--CGLPLTTYSSATKLLWMIEHVPKVKDA  159



>gb|EPE03807.1| glycerol kinase [Ophiostoma piceae UAMH 11346]
Length=514

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = +1

Query  70   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVS  249
            E  FVG+IDQGTTS+RF+I++     V +HQIEF+Q YP  GW EHDP E++ SV+ C+ 
Sbjct  8    ETAFVGAIDQGTTSSRFLIFNSEGSVVATHQIEFSQIYPHPGWHEHDPEELITSVETCID  67

Query  250  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  429
             A+++    GH+  + +K +GITNQRETTVVW  ++G  L+NAIVW D R   + RKL+ 
Sbjct  68   GAIEQFEKQGHSRNQ-VKTVGITNQRETTVVWDTTTGKALHNAIVWTDTRAQELVRKLKD  126

Query  430  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             L  G    +  CGLP+STY SA KLLWLLENV+AVK+A
Sbjct  127  RL--GSKELMSLCGLPLSTYPSASKLLWLLENVDAVKDA  163



>dbj|BAB25518.1| unnamed protein product [Mus musculus]
Length=168

 Score =   169 bits (429),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
             VG++DQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  C+ K 
Sbjct  12   LVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILQSVYECIEKT  71

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
             +K      ++  + KAIG++NQRETTVVW K +G PLYNA+VW+D RT S    L K +
Sbjct  72   CEKLGQLNIDISNI-KAIGVSNQRETTVVWDKVTGEPLYNAVVWLDLRTQSTVENLSKRI  130

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAV  549
            PG         GLP+STYFSA+KL WLL+NV+ V+EAV
Sbjct  131  PGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAV  168



>gb|KEY65705.1| hypothetical protein S7711_07532 [Stachybotrys chartarum IBT 
7711]
 gb|KFA54185.1| hypothetical protein S40293_06305 [Stachybotrys chartarum IBT 
40293]
Length=515

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+G+IDQGTTS+RF+I+++S   V  HQ EF Q YPQ GW EHDP E++ SV++C+ +AV
Sbjct  12   FIGAIDQGTTSSRFLIFNKSGEVVALHQTEFKQIYPQPGWHEHDPEELVSSVELCIDEAV  71

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
                  GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D RT  + R+L+  L 
Sbjct  72   KAFEVQGHSRSQ-IKAVGITNQRETTVVWDKTTGKALHNAIVWTDTRTQELVRRLKNRL-  129

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G       CGLP+STY SA KL+WLLENV  VK+A
Sbjct  130  -GSGELTSRCGLPLSTYPSASKLMWLLENVPQVKDA  164



>gb|KFA65845.1| hypothetical protein S40285_04646 [Stachybotrys chlorohalonata 
IBT 40285]
Length=515

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+G+IDQGTTS+RF+I+++S   V  HQ EF Q YPQ GW EHDP E++ SV++C+ +AV
Sbjct  12   FIGAIDQGTTSSRFLIFNKSGEVVALHQTEFKQIYPQPGWHEHDPEELVSSVELCIDEAV  71

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
                  GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D RT  + R+L+  L 
Sbjct  72   KAFEVQGHSRSQ-IKAVGITNQRETTVVWDKTTGKALHNAIVWTDTRTQELVRRLKNRL-  129

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G       CGLP+STY SA KL+WLLENV  VK+A
Sbjct  130  -GSGELTSRCGLPLSTYPSASKLMWLLENVPQVKDA  164



>gb|KID78011.1| Glycerol kinase, partial [Metarhizium brunneum ARSEF 3297]
Length=527

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +1

Query  55   KMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESV  234
            +    E+ FVGSIDQGTTSTRF+I++ +  PV  HQ+ F   +P++GW EHDP E+L++V
Sbjct  11   RTGDAEETFVGSIDQGTTSTRFVIFNANGEPVALHQMGFGNIHPESGWHEHDPHELLQTV  70

Query  235  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  414
            + C+ +A  K T  G ++ + + AIG+TNQRETTV+W K++G PLYNAIVW D RT ++ 
Sbjct  71   ETCIQQATKKFTDKGFDIAK-VHAIGVTNQRETTVLWDKNTGEPLYNAIVWPDTRTKALV  129

Query  415  RKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            R+L+ +   G    +  CGLP+STY S++KLLWLL N +AVK A
Sbjct  130  RELKAKQ--GSDKLLGLCGLPLSTYPSSVKLLWLLRNNDAVKAA  171



>gb|KFA72479.1| hypothetical protein S40288_08601 [Stachybotrys chartarum IBT 
40288]
Length=515

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+G+IDQGTTS+RF+I+++S   V  HQ EF Q YPQ GW EHDP E++ SV++C+ +AV
Sbjct  12   FIGAIDQGTTSSRFLIFNKSGEVVALHQTEFKQIYPQPGWHEHDPEELVSSVELCIDEAV  71

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
                  GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D RT  + R+L+  L 
Sbjct  72   KAFEVQGHSRSQ-IKAVGITNQRETTVVWDKTTGKALHNAIVWTDTRTQELVRRLKNRL-  129

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G       CGLP+STY SA KL+WLLENV  VK+A
Sbjct  130  -GSGELTSRCGLPLSTYPSASKLMWLLENVPQVKDA  164



>gb|KIV98076.1| glycerol kinase [Exophiala mesophila]
 gb|KIV98077.1| glycerol kinase, variant [Exophiala mesophila]
Length=547

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            FVGSID GTTS+RF+I+D S  PV  HQIEF Q YP +GW EHDP E++ SV  C+ KAV
Sbjct  17   FVGSIDNGTTSSRFLIFDPSGNPVAQHQIEFKQIYPHSGWHEHDPNELVSSVSECIDKAV  76

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
                + GH++ + +KA+GITNQRETT VW   +G PLYN+IVW D RT +I R+L+    
Sbjct  77   ADFESQGHSISQ-IKAVGITNQRETTCVWDIDTGEPLYNSIVWTDTRTANIVRELKSR--  133

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G     E CGLP+STY S+ KLLWLL++ + VK+A
Sbjct  134  EGADGLQELCGLPLSTYPSSTKLLWLLKHSDKVKKA  169



>ref|XP_011322504.1| hypothetical protein FGSG_03247 [Fusarium graminearum PH-1]
 gb|ESU10005.1| hypothetical protein FGSG_03247 [Fusarium graminearum PH-1]
 gb|EYB32503.1| hypothetical protein FG05_03247 [Fusarium graminearum]
 emb|CEF78011.1| unnamed protein product [Fusarium graminearum]
Length=516

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQIEF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KANTAFIGAIDQGTTSSRFLIFDPSGDVVATHQIEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+   + GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVETFESQGHSREQ-IKAVGITNQRETTVVWDKTTGKALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLL+N+  VK+A
Sbjct  126  KRRL--GSSELIGRCGIPLSTYPSVSKLLWLLDNIPEVKDA  164



>gb|KFZ18912.1| hypothetical protein V502_03900 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=513

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 113/157 (72%), Gaps = 3/157 (2%)
 Frame = +1

Query  76   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKA  255
            +F+GSIDQGTTS+RF+I++ +  PV SHQIEF Q YPQ GW EHDP+EI+ SV+ C+  A
Sbjct  10   LFIGSIDQGTTSSRFLIFNEAGDPVASHQIEFKQIYPQPGWHEHDPLEIVSSVEKCIDSA  69

Query  256  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  435
            V   T  GH + + +KAIGITNQRET VVW++ +G  LYNAIVW D RT ++ R L++ L
Sbjct  70   VTAFTKQGHFLDQ-IKAIGITNQRETIVVWNQETGEALYNAIVWTDTRTQALVRGLKERL  128

Query  436  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
              G    +E  G+P+STY S  KLLWLLEN   V++A
Sbjct  129  --GADKILERVGVPLSTYPSIGKLLWLLENEPKVQDA  163



>gb|KEQ90708.1| hypothetical protein AUEXF2481DRAFT_9264 [Aureobasidium subglaciale 
EXF-2481]
Length=514

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+GSIDQGTTS+RF+I++++  PV SHQ EF+Q YPQ GW EHDP EI+ SV  C+  A+
Sbjct  4    FIGSIDQGTTSSRFLIFNKAGEPVASHQEEFSQIYPQPGWHEHDPEEIVSSVHNCIEGAI  63

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
            +    DG+++   +KAIGITNQRETTVVW   SG  LYNAIVW D R+ +I ++L+    
Sbjct  64   ETFKKDGNSIDS-IKAIGITNQRETTVVWDIESGEALYNAIVWTDTRSQAIVKELKSR--  120

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G    ++ CGLP+STY S  KLLWLL+N   VKEA
Sbjct  121  KGADELMQKCGLPLSTYPSVTKLLWLLKNEPKVKEA  156



>ref|XP_002382003.1| glycerol kinase, putative [Aspergillus flavus NRRL3357]
 gb|EED48587.1| glycerol kinase, putative [Aspergillus flavus NRRL3357]
Length=647

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            +  ++FVGSIDQGTTSTRF+I++R   PV SHQ+EF Q YP++GW EH+P++++ SV+ C
Sbjct  58   QPSEIFVGSIDQGTTSTRFLIFNREGEPVASHQVEFPQIYPKSGWHEHNPLDLVSSVETC  117

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            V +AV +  + G++    +KA+GITNQRETTVVW   +G PL NAIVW D R+ +I + L
Sbjct  118  VEQAVKQFESTGYSRND-IKAVGITNQRETTVVWDYETGEPLCNAIVWTDTRSQAIIKDL  176

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             KE PG  +   + CGLP+STY S+ KLLW+L NV  VK+A
Sbjct  177  -KEKPGA-SRLQQICGLPLSTYSSSSKLLWMLTNVPRVKDA  215



>gb|EMD93310.1| hypothetical protein COCHEDRAFT_1131471 [Bipolaris maydis C5]
 gb|ENI07241.1| hypothetical protein COCC4DRAFT_165060 [Bipolaris maydis ATCC 
48331]
Length=551

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
             K +Q F+GSIDQGTTSTRFII+D    PV  HQIEFTQ YPQ+GW EHDP EI+++V+ 
Sbjct  32   GKLKQFFIGSIDQGTTSTRFIIFDGLGEPVAQHQIEFTQKYPQSGWHEHDPWEIIDTVEQ  91

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C+ +A +    +GHN+   +KAIGITNQRETTVVW  ++GLP+ NAI W D RT  + R+
Sbjct  92   CIDRATNIFLDNGHNI-EDIKAIGITNQRETTVVWDTTNGLPICNAIAWPDTRTKGLVRE  150

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L+     G    +   GLP+STY S++KL WLL++ E V+ A
Sbjct  151  LKDR--KGADELLNLTGLPLSTYPSSVKLRWLLDHDEKVRSA  190



>ref|XP_007818344.1| glycerol kinase [Metarhizium robertsii ARSEF 23]
 gb|EFZ02573.1| glycerol kinase [Metarhizium robertsii ARSEF 23]
 gb|EXV05779.1| glycerol kinase [Metarhizium robertsii]
Length=527

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +1

Query  40   EEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVE  219
            E    +    E+ FVGSIDQGTTSTRF+I++ +  PV  HQ+ F   +P++GW EHDP E
Sbjct  6    EPKRSRTGDAEETFVGSIDQGTTSTRFVIFNANGEPVALHQMGFGNVHPESGWHEHDPHE  65

Query  220  ILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDAR  399
            +L++V+ C+ +A  K T  G ++ + + AIG+TNQRETTV+W K++G PLYNAIVW D R
Sbjct  66   LLQTVETCIQQATKKFTDKGFDIAK-VHAIGVTNQRETTVLWDKNTGEPLYNAIVWPDTR  124

Query  400  TTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            T ++ R+L+ +   G    +  CGLP+STY S++KLLWLL N +AVK A
Sbjct  125  TKALVRELKAKQ--GSDKLLGLCGLPLSTYPSSVKLLWLLRNNDAVKAA  171



>gb|KID92964.1| Carbohydrate kinase, FGGY [Metarhizium guizhouense ARSEF 977]
Length=527

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +1

Query  55   KMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESV  234
            +    E+ FVGSIDQGTTSTRF+I++ +  PV  HQ+ F   +P++GW EHDP E+L++V
Sbjct  11   RTGDAEETFVGSIDQGTTSTRFVIFNANGEPVALHQMGFGNVHPESGWHEHDPHELLQTV  70

Query  235  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  414
            + C+ +A  K T  G ++ + + AIG+TNQRETTV+W K++G PLYNAIVW D RT ++ 
Sbjct  71   ETCIQQATKKFTDKGFDIAK-VHAIGVTNQRETTVLWDKNTGEPLYNAIVWPDTRTKALV  129

Query  415  RKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            R+L+ +   G    +  CGLP+STY S++KLLWLL N +AVK A
Sbjct  130  RELKAKQ--GSDKLLGLCGLPLSTYPSSVKLLWLLRNNDAVKAA  171



>ref|XP_003300497.1| hypothetical protein PTT_11744 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91424.1| hypothetical protein PTT_11744 [Pyrenophora teres f. teres 0-1]
Length=551

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 116/173 (67%), Gaps = 3/173 (2%)
 Frame = +1

Query  28   IHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEH  207
            I     G     K  Q F+GSIDQGTTSTRFII+D    PV  HQIEFTQ YPQ+GW EH
Sbjct  21   IQDEPTGHLDEGKLRQFFIGSIDQGTTSTRFIIFDGLGEPVAQHQIEFTQKYPQSGWHEH  80

Query  208  DPVEILESVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVW  387
            DP EI+ SV+ C+ +A +    +GH++   +KAIGITNQRETTV+W  ++G PL NAI W
Sbjct  81   DPKEIITSVEQCIDRATNIFLDNGHDI-EDIKAIGITNQRETTVLWDTNTGEPLCNAIAW  139

Query  388  MDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             D RT  + R+L K  PG     +  CGLP+STY S++KL W+L++ E V++A
Sbjct  140  PDTRTKGLVREL-KGRPGA-DELLNICGLPLSTYPSSVKLRWMLDHDENVRKA  190



>ref|XP_002146657.1| glycerol kinase, putative [Talaromyces marneffei ATCC 18224]
 gb|EEA26110.1| glycerol kinase, putative [Talaromyces marneffei ATCC 18224]
Length=576

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+GSIDQGTTSTRF+I++R   PV SHQ+EF Q YP++GW EH+P+E++ SV+ C+ +AV
Sbjct  8    FIGSIDQGTTSTRFLIFNREGEPVASHQVEFEQIYPKSGWHEHNPLELVSSVETCIEEAV  67

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
             K    G++  +L+ AIGITNQRETTV+W   +G PL+NA+VW D R+ +I R+L+    
Sbjct  68   KKFEELGYSR-QLINAIGITNQRETTVLWDSVTGEPLHNAVVWTDTRSQAIVRELKSR--  124

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G     E CGLP+STY S+ KLLW+++NV  VK+A
Sbjct  125  KGAEDLQEICGLPLSTYPSSTKLLWMIQNVPKVKDA  160



>ref|XP_007687604.1| hypothetical protein COCMIDRAFT_4982 [Bipolaris oryzae ATCC 44560]
 gb|EUC45847.1| hypothetical protein COCMIDRAFT_4982 [Bipolaris oryzae ATCC 44560]
Length=551

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
             K +Q F+GSIDQGTTSTRFII+D    PV  HQIEFTQ YPQ+GW EHDP EI+++V+ 
Sbjct  32   GKLKQFFIGSIDQGTTSTRFIIFDGLGEPVAQHQIEFTQKYPQSGWHEHDPWEIIDTVEQ  91

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C+ +A +    +GHN+   +KAIGITNQRETTVVW  ++GLP+ NAI W D RT  + R+
Sbjct  92   CIDRATNIFLDNGHNI-EDIKAIGITNQRETTVVWDTTTGLPICNAIAWPDTRTKGLVRE  150

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L+     G    +   GLP+STY S++KL WLL++ E V+ A
Sbjct  151  LKDR--KGADELLNLTGLPLSTYPSSVKLRWLLDHDENVRSA  190



>emb|CCT74864.1| probable GUT1-glycerol kinase [Fusarium fujikuroi IMI 58289]
Length=516

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K+   F+G+IDQGTTS+RF+I+D S   V +HQ+EF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KQNPTFIGAIDQGTTSSRFLIFDTSGDVVATHQLEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+     GH+  + +K +GITNQRETTVVW K++G  L+NAIVW D R+  + R+L
Sbjct  67   IDGAVEAFEGQGHSREQ-IKVVGITNQRETTVVWDKTTGNALHNAIVWTDTRSKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLLEN+  VK+A
Sbjct  126  KRRL--GASELISRCGIPLSTYPSVSKLLWLLENIPEVKDA  164



>gb|KIW63436.1| glycerol kinase [Capronia semiimmersa]
Length=561

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 112/161 (70%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    FVG+ID GTTS+RF+I+DR   PV  HQIEF Q YP +GW EHDP +++ SV  C
Sbjct  27   KSNGTFVGAIDNGTTSSRFLIFDRKGNPVAEHQIEFKQHYPHSGWHEHDPNDLISSVSTC  86

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            + +A  K T+ G+++   +KA+GITNQRETT+VW   +G PLYNAIVW D R+  I R+L
Sbjct  87   IDEACAKFTSQGYSLSS-IKAVGITNQRETTMVWDVKTGEPLYNAIVWTDTRSAHIVREL  145

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            +++   G    +  CGLP+STY S+ KLLW+L +V+ VK A
Sbjct  146  KQK--SGADELMGLCGLPLSTYPSSTKLLWMLSHVDKVKNA  184



>ref|XP_007708185.1| hypothetical protein COCCADRAFT_85322 [Bipolaris zeicola 26-R-13]
 gb|EUC37509.1| hypothetical protein COCCADRAFT_85322 [Bipolaris zeicola 26-R-13]
 gb|EUN31416.1| hypothetical protein COCVIDRAFT_87676 [Bipolaris victoriae FI3]
Length=551

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  61   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKV  240
             K +Q F+GSIDQGTTSTRFII+D    PV  HQIEFTQ YPQ+GW EHDP EI+++V+ 
Sbjct  32   GKLKQFFIGSIDQGTTSTRFIIFDGLGEPVAQHQIEFTQKYPQSGWHEHDPWEIIDTVEQ  91

Query  241  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  420
            C+ +A +    +GHN+   +KAIGITNQRETTVVW  ++GLP+ NAI W D RT  + R+
Sbjct  92   CIDRATNIFLDNGHNI-EDIKAIGITNQRETTVVWDTTTGLPICNAIAWPDTRTKGLVRE  150

Query  421  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            L+     G    +   GLP+STY S++KL WLL++ E V+ A
Sbjct  151  LKDR--KGADELLNLTGLPLSTYPSSVKLRWLLDHDENVRSA  190



>ref|XP_009259021.1| hypothetical protein FPSE_07628 [Fusarium pseudograminearum CS3096]
 gb|EKJ72204.1| hypothetical protein FPSE_07628 [Fusarium pseudograminearum CS3096]
Length=516

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVC  243
            K    F+G+IDQGTTS+RF+I+D S   V +HQIEF Q+YP  GW EHDP E++ SV+ C
Sbjct  7    KANTAFIGAIDQGTTSSRFLIFDPSGDVVATHQIEFKQYYPHPGWHEHDPEELISSVEQC  66

Query  244  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  423
            +  AV+   + GH+  + +KA+GITNQRETTVVW K++G  L+NAIVW D R   + R+L
Sbjct  67   IDGAVETFESQGHSREQ-IKAVGITNQRETTVVWDKTTGKALHNAIVWTDTRAKDLVRRL  125

Query  424  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            ++ L  G +  +  CG+P+STY S  KLLWLL+N+  VK+A
Sbjct  126  KRRL--GSSELIGRCGIPLSTYPSVSKLLWLLDNIPEVKDA  164



>ref|XP_002565259.1| Pc22g13330 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP98621.1| Pc22g13330 [Penicillium rubens Wisconsin 54-1255]
Length=624

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            FVGSIDQGTTSTRF+I++R   PV SHQ+EF+Q YP  GW EHDP+EI+ SV+ C+ +AV
Sbjct  7    FVGSIDQGTTSTRFLIFNRDGDPVASHQVEFSQIYPNPGWHEHDPLEIVTSVETCIEEAV  66

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
                  GH     ++++GITNQRETT+VW   +G PLYNAIVW D R+ +I  +L K+ P
Sbjct  67   RNFETQGHTRSS-IQSVGITNQRETTIVWDHETGEPLYNAIVWTDTRSQAIVAEL-KQKP  124

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            G        CGLP+STY SA KLLW+L +V  VK+A
Sbjct  125  GA-AQLQTLCGLPLSTYSSATKLLWMLAHVPRVKDA  159



>gb|KEQ66791.1| glycerol kinase [Aureobasidium melanogenum CBS 110374]
Length=514

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            F+GSIDQGTTS+RF+I++++  PV SHQ EF+Q YPQ GW EHDP EI+ SV  C+  AV
Sbjct  4    FIGSIDQGTTSSRFLIFNKAGEPVASHQEEFSQIYPQPGWHEHDPEEIVSSVHNCIEGAV  63

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
            +    DG++V   +KAIGITNQRETTVVW   SG  LYNAIVW D R+  I ++L+    
Sbjct  64   EAFKKDGNSVDS-IKAIGITNQRETTVVWDIESGEALYNAIVWTDTRSQHIVKELKSR--  120

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G     + CGLP+STY S  KLLWLL+N   VKEA
Sbjct  121  KGADELTQKCGLPLSTYPSVTKLLWLLKNEPRVKEA  156



>gb|KGO43785.1| Carbohydrate kinase, FGGY, N-terminal [Penicillium expansum]
 gb|KGO65477.1| Carbohydrate kinase, FGGY, N-terminal [Penicillium expansum]
Length=617

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            FVGSIDQGTTSTRF+I++R   PV SHQ+EFTQ YP  GW EHD +EI+ SVK C+ +AV
Sbjct  7    FVGSIDQGTTSTRFLIFNREGEPVASHQVEFTQIYPNPGWHEHDALEIITSVKTCIEEAV  66

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
             K  A G+     +++IGITNQRETT+VW   +G PLYNAIVW D R+ +I  +L K+ P
Sbjct  67   LKFEAHGYTRSS-IQSIGITNQRETTIVWDHETGEPLYNAIVWTDTRSQAIVAEL-KQKP  124

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            G        CGLP+STY SA KLLW+L +V  VK+A
Sbjct  125  GA-AQLQTLCGLPLSTYSSATKLLWMLVHVPRVKDA  159



>gb|KFG85089.1| putative glycerol kinase [Metarhizium anisopliae]
 gb|KID67546.1| Carbohydrate kinase, FGGY, partial [Metarhizium anisopliae ARSEF 
549]
Length=527

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +1

Query  55   KMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESV  234
            +    E  FVGSIDQGTTSTRF+I++ +  PV  HQ+ F   +P++GW EHDP E+L++V
Sbjct  11   RTGDAEDTFVGSIDQGTTSTRFVIFNANGEPVALHQMGFGNVHPESGWHEHDPHELLQTV  70

Query  235  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  414
            + C+ +A  K T  G ++ + + AIG+TNQRETTV+W K++G PLYNAIVW D RT ++ 
Sbjct  71   ETCIEQATKKFTDKGFDIAK-VHAIGVTNQRETTVLWDKNTGEPLYNAIVWPDTRTKALV  129

Query  415  RKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
            R+L+ +   G    +  CGLP+STY S++KLLWLL N +AVK A
Sbjct  130  RELKAKQ--GSDKLLGLCGLPLSTYPSSVKLLWLLRNNDAVKAA  171



>emb|CCF44486.1| glycerol kinase [Colletotrichum higginsianum]
 gb|AFJ52908.1| glycerol kinase [Colletotrichum higginsianum]
Length=519

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  79   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILESVKVCVSKAV  258
            FVG+IDQGTTSTRF+I++     + +HQ+EF Q YPQ GW EHDP E++ SV+ C+  AV
Sbjct  16   FVGAIDQGTTSTRFLIFNPQGEVIATHQLEFKQIYPQPGWHEHDPEELVSSVEKCIDGAV  75

Query  259  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  438
                  GH+  + +KA+GITNQRETTV+W +++G  LYNAIVW D RT  + R+L++ L 
Sbjct  76   QTFETQGHSRDQ-IKAVGITNQRETTVLWDRTTGKALYNAIVWTDTRTKDLVRRLKQRL-  133

Query  439  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEA  546
             G +   + CGLP+STY S  KLLWLLENV  VK+A
Sbjct  134  -GASELTQRCGLPLSTYPSVGKLLWLLENVPEVKDA  168



Lambda      K        H        a         alpha
   0.317    0.131    0.391    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720