BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014H08

Length=271
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008445090.1|  PREDICTED: COP9 signalosome complex subunit ...    104   2e-24   Cucumis melo [Oriental melon]
ref|XP_004138765.1|  PREDICTED: COP9 signalosome complex subunit ...    104   2e-24   Cucumis sativus [cucumbers]
ref|XP_002283561.1|  PREDICTED: COP9 signalosome complex subunit ...    102   8e-24   Vitis vinifera
ref|XP_010111938.1|  COP9 signalosome complex subunit 5b                100   3e-23   
gb|KDP33444.1|  hypothetical protein JCGZ_07015                         100   4e-23   Jatropha curcas
ref|XP_006351153.1|  PREDICTED: COP9 signalosome complex subunit ...  99.8    7e-23   Solanum tuberosum [potatoes]
ref|XP_006450163.1|  hypothetical protein CICLE_v10008736mg           99.4    1e-22   
ref|XP_002527960.1|  jun activation domain binding protein, putative  99.0    1e-22   Ricinus communis
ref|XP_006450165.1|  hypothetical protein CICLE_v10008736mg           99.0    1e-22   Citrus clementina [clementine]
ref|XP_006450164.1|  hypothetical protein CICLE_v10008736mg           99.0    1e-22   Citrus clementina [clementine]
gb|KDO67280.1|  hypothetical protein CISIN_1g018085mg                 99.0    1e-22   Citrus sinensis [apfelsine]
gb|KDO67279.1|  hypothetical protein CISIN_1g018085mg                 99.0    1e-22   Citrus sinensis [apfelsine]
ref|XP_007221779.1|  hypothetical protein PRUPE_ppa007500mg           98.2    3e-22   Prunus persica
ref|XP_009617619.1|  PREDICTED: COP9 signalosome complex subunit ...  97.8    3e-22   Nicotiana tomentosiformis
ref|XP_004291259.1|  PREDICTED: COP9 signalosome complex subunit ...  97.8    3e-22   Fragaria vesca subsp. vesca
ref|XP_011459046.1|  PREDICTED: COP9 signalosome complex subunit ...  97.8    3e-22   Fragaria vesca subsp. vesca
ref|XP_009786152.1|  PREDICTED: COP9 signalosome complex subunit ...  97.8    4e-22   Nicotiana sylvestris
emb|CBL87025.1|  CSN5 protein                                         97.1    6e-22   Solanum lycopersicum
ref|NP_001234331.1|  JAB                                              97.1    6e-22   
ref|XP_008378244.1|  PREDICTED: COP9 signalosome complex subunit ...  96.7    9e-22   Malus domestica [apple tree]
ref|XP_004241422.1|  PREDICTED: COP9 signalosome complex subunit 5b   96.7    9e-22   Solanum lycopersicum
ref|XP_006347307.1|  PREDICTED: COP9 signalosome complex subunit ...  96.7    1e-21   Solanum tuberosum [potatoes]
gb|KFK41544.1|  hypothetical protein AALP_AA2G143000                  96.3    1e-21   Arabis alpina [alpine rockcress]
ref|XP_010259860.1|  PREDICTED: COP9 signalosome complex subunit ...  96.3    1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_007137114.1|  hypothetical protein PHAVU_009G100700g           95.9    2e-21   Phaseolus vulgaris [French bean]
ref|XP_008393958.1|  PREDICTED: COP9 signalosome complex subunit ...  95.5    2e-21   
ref|XP_003522659.1|  PREDICTED: COP9 signalosome complex subunit 5a   95.1    3e-21   Glycine max [soybeans]
ref|XP_010669282.1|  PREDICTED: COP9 signalosome complex subunit ...  95.1    4e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003526451.1|  PREDICTED: COP9 signalosome complex subunit 5a   94.4    7e-21   Glycine max [soybeans]
ref|XP_002887356.1|  hypothetical protein ARALYDRAFT_894961           94.0    9e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_006302454.1|  hypothetical protein CARUB_v10020540mg           93.6    1e-20   Capsella rubella
ref|XP_009338826.1|  PREDICTED: COP9 signalosome complex subunit ...  93.6    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_010427950.1|  PREDICTED: COP9 signalosome complex subunit ...  93.2    2e-20   Camelina sativa [gold-of-pleasure]
gb|KJB55195.1|  hypothetical protein B456_009G068200                  92.8    2e-20   Gossypium raimondii
gb|KJB55192.1|  hypothetical protein B456_009G068200                  92.8    2e-20   Gossypium raimondii
gb|KHG19604.1|  COP9 signalosome complex subunit 5b -like protein     92.8    2e-20   Gossypium arboreum [tree cotton]
ref|XP_010471135.1|  PREDICTED: COP9 signalosome complex subunit ...  92.8    2e-20   Camelina sativa [gold-of-pleasure]
gb|KJB55196.1|  hypothetical protein B456_009G068200                  92.4    2e-20   Gossypium raimondii
gb|KJB55194.1|  hypothetical protein B456_009G068200                  92.4    2e-20   Gossypium raimondii
gb|AAC36343.1|  AJH2                                                  92.8    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177279.1|  COP9 signalosome complex subunit 5b                 92.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KJB55193.1|  hypothetical protein B456_009G068200                  92.4    3e-20   Gossypium raimondii
ref|XP_007011590.1|  COP9-signalosome 5B                              91.3    6e-20   
ref|XP_010415831.1|  PREDICTED: COP9 signalosome complex subunit ...  90.9    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010551182.1|  PREDICTED: COP9 signalosome complex subunit 5b   90.9    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_011076561.1|  PREDICTED: COP9 signalosome complex subunit ...  89.7    3e-19   Sesamum indicum [beniseed]
ref|XP_011031359.1|  PREDICTED: COP9 signalosome complex subunit ...  89.7    3e-19   Populus euphratica
ref|XP_004501247.1|  PREDICTED: COP9 signalosome complex subunit ...  88.6    7e-19   Cicer arietinum [garbanzo]
ref|XP_006390791.1|  hypothetical protein EUTSA_v10018788mg           88.2    1e-18   Eutrema salsugineum [saltwater cress]
dbj|BAJ34223.1|  unnamed protein product                              87.4    1e-18   Eutrema halophilum
ref|XP_002324396.1|  COP9 complex family protein                      87.8    1e-18   
ref|XP_011082082.1|  PREDICTED: COP9 signalosome complex subunit ...  87.8    1e-18   Sesamum indicum [beniseed]
gb|EYU29154.1|  hypothetical protein MIMGU_mgv1a0088022mg             84.7    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_011082083.1|  PREDICTED: COP9 signalosome complex subunit ...  87.0    2e-18   Sesamum indicum [beniseed]
ref|XP_001775449.1|  predicted protein                                85.5    1e-17   
ref|XP_010048447.1|  PREDICTED: COP9 signalosome complex subunit ...  84.3    3e-17   Eucalyptus grandis [rose gum]
gb|KFK44380.1|  hypothetical protein AALP_AA1G249900                  84.0    4e-17   Arabis alpina [alpine rockcress]
ref|XP_006416142.1|  hypothetical protein EUTSA_v10008042mg           84.0    4e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009115580.1|  PREDICTED: COP9 signalosome complex subunit 5b   83.2    7e-17   Brassica rapa
ref|XP_003603531.1|  COP9 signalosome complex subunit 5b              83.2    7e-17   
gb|AAC26484.1|  putative JUN kinase activation domain binding pro...  83.2    7e-17   Medicago sativa [alfalfa]
ref|XP_011045010.1|  PREDICTED: COP9 signalosome complex subunit ...  83.2    9e-17   Populus euphratica
ref|XP_006305189.1|  hypothetical protein CARUB_v10009554mg           82.8    9e-17   Capsella rubella
ref|XP_010914180.1|  PREDICTED: COP9 signalosome complex subunit ...  82.0    2e-16   Elaeis guineensis
gb|EPS57884.1|  hypothetical protein M569_16932                       80.9    2e-16   Genlisea aurea
ref|XP_010929274.1|  PREDICTED: COP9 signalosome complex subunit ...  81.6    3e-16   Elaeis guineensis
ref|XP_010498782.1|  PREDICTED: COP9 signalosome complex subunit ...  81.3    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008810007.1|  PREDICTED: COP9 signalosome complex subunit ...  81.3    3e-16   Phoenix dactylifera
gb|ACJ84456.1|  unknown                                               81.3    3e-16   Medicago truncatula
ref|XP_010929275.1|  PREDICTED: COP9 signalosome complex subunit ...  80.9    4e-16   
ref|XP_002893252.1|  hypothetical protein ARALYDRAFT_472541           80.9    4e-16   
gb|ABK24758.1|  unknown                                               81.3    4e-16   Picea sitchensis
ref|XP_010460061.1|  PREDICTED: COP9 signalosome complex subunit ...  80.9    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006845674.1|  hypothetical protein AMTR_s00019p00231450        80.9    6e-16   Amborella trichopoda
ref|XP_010477567.1|  PREDICTED: COP9 signalosome complex subunit 5b   79.7    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009420301.1|  PREDICTED: COP9 signalosome complex subunit ...  79.7    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001752249.1|  predicted protein                                79.3    2e-15   
gb|AAM65053.1|  putative JUN kinase activator protein                 78.2    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAC36344.1|  AJH1                                                  78.2    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973890.1|  COP9 signalosome complex subunit 5a                 77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173705.1|  COP9 signalosome complex subunit 5a                 77.8    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652935.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    8e-15   Oryza brachyantha
gb|KJB65954.1|  hypothetical protein B456_010G123100                  76.3    1e-14   Gossypium raimondii
gb|KHG22386.1|  COP9 signalosome complex subunit 5a -like protein     77.0    1e-14   Gossypium arboreum [tree cotton]
gb|KJB65952.1|  hypothetical protein B456_010G123100                  76.6    1e-14   Gossypium raimondii
gb|KJB65950.1|  hypothetical protein B456_010G123100                  76.3    1e-14   Gossypium raimondii
gb|KJB65951.1|  hypothetical protein B456_010G123100                  76.6    1e-14   Gossypium raimondii
ref|XP_006382165.1|  COP9 complex family protein                      77.0    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004960128.1|  PREDICTED: COP9 signalosome complex subunit ...  76.6    2e-14   Setaria italica
ref|NP_001054112.1|  Os04g0654700                                     76.3    3e-14   
gb|EEC78160.1|  hypothetical protein OsI_17724                        76.3    4e-14   Oryza sativa Indica Group [Indian rice]
tpg|DAA35639.1|  TPA: hypothetical protein ZEAMMB73_882531            74.3    5e-14   
ref|NP_001149650.1|  COP9 signalosome complex subunit 5b              75.1    8e-14   Zea mays [maize]
ref|XP_002967006.1|  hypothetical protein SELMODRAFT_168868           73.2    3e-13   
ref|XP_002961002.1|  hypothetical protein SELMODRAFT_73440            73.2    4e-13   
ref|XP_009103210.1|  PREDICTED: COP9 signalosome complex subunit ...  71.2    2e-12   Brassica rapa
emb|CDY25761.1|  BnaA07g10210D                                        71.2    2e-12   Brassica napus [oilseed rape]
emb|CDY12502.1|  BnaC07g13420D                                        69.7    7e-12   Brassica napus [oilseed rape]
dbj|BAJ93853.1|  predicted protein                                    68.9    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT09486.1|  hypothetical protein F775_29820                       68.9    1e-11   
ref|XP_010240543.1|  PREDICTED: COP9 signalosome complex subunit ...  68.6    2e-11   Brachypodium distachyon [annual false brome]
emb|CAE03401.3|  OSJNBa0071I13.2                                      68.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ADG37923.1|  AT1G22920-like protein                                62.4    1e-10   Capsella grandiflora
gb|ADG37922.1|  AT1G22920-like protein                                62.0    1e-10   Capsella grandiflora
dbj|BAH71669.1|  ACYPI006786                                          61.6    1e-09   Acyrthosiphon pisum
ref|XP_008217730.1|  PREDICTED: COP9 signalosome complex subunit ...  63.2    2e-09   Nasonia vitripennis
ref|XP_008217721.1|  PREDICTED: COP9 signalosome complex subunit ...  63.2    2e-09   
gb|AAR10246.1|  similar to Drosophila melanogaster CSN5               61.2    2e-09   Drosophila yakuba
gb|EIE80444.1|  hypothetical protein RO3G_05149                       62.8    2e-09   Rhizopus delemar RA 99-880
ref|XP_003424702.2|  PREDICTED: COP9 signalosome complex subunit ...  63.2    2e-09   Nasonia vitripennis
ref|XP_006956806.1|  hypothetical protein WALSEDRAFT_59607            62.4    2e-09   Wallemia mellicola CBS 633.66
ref|XP_001990340.1|  GH19288                                          62.0    3e-09   Drosophila grimshawi
ref|XP_001636625.1|  predicted protein                                62.0    3e-09   Nematostella vectensis
gb|EPB91337.1|  COP9 signalosome complex subunit 5a                   61.6    4e-09   Mucor circinelloides f. circinelloides 1006PhL
ref|NP_500841.1|  Protein CSN-5                                       62.0    4e-09   Caenorhabditis elegans [roundworm]
ref|XP_009267304.1|  COP9 signalosome complex subunit 5               61.6    5e-09   Wallemia ichthyophaga EXF-994
ref|XP_003101399.1|  CRE-CSN-5 protein                                61.6    5e-09   Caenorhabditis remanei
gb|AAD27862.2|AF132563_1  LD14392p                                    61.6    5e-09   Drosophila melanogaster
ref|XP_011267966.1|  PREDICTED: COP9 signalosome complex subunit 5    61.6    5e-09   Camponotus floridanus
ref|XP_638491.1|  Mov34/MPN/PAD-1 family protein                      61.2    6e-09   Dictyostelium discoideum AX4
ref|XP_006675144.1|  hypothetical protein BATDEDRAFT_15731            61.2    6e-09   Batrachochytrium dendrobatidis JAM81
ref|XP_006565324.1|  PREDICTED: COP9 signalosome complex subunit ...  61.2    6e-09   Apis mellifera [bee]
ref|XP_001954897.1|  GF18500                                          61.2    6e-09   
ref|XP_002633848.1|  C. briggsae CBR-CSN-5 protein                    61.2    6e-09   Caenorhabditis briggsae
dbj|GAN00834.1|  COP9-signalosome 5B                                  61.2    7e-09   Mucor ambiguus
ref|XP_002103175.1|  GD19103                                          60.8    9e-09   
ref|XP_001980192.1|  GG17007                                          60.8    9e-09   Drosophila erecta
ref|XP_002074130.1|  GK14483                                          60.8    9e-09   Drosophila willistoni
ref|NP_477442.1|  COP9 complex homolog subunit 5, isoform A           60.8    9e-09   Drosophila melanogaster
ref|XP_001359383.1|  GA13321                                          60.8    9e-09   Drosophila pseudoobscura pseudoobscura
ref|NP_001262639.1|  COP9 complex homolog subunit 5, isoform B        60.5    9e-09   Drosophila melanogaster
gb|AAD28608.1|AF129083_1  COP9 signalosome subunit 5 CSN5             60.5    9e-09   Drosophila melanogaster
ref|XP_008185322.1|  PREDICTED: COP9 complex homolog subunit 5 is...  60.8    1e-08   Acyrthosiphon pisum
ref|NP_001156462.1|  COP9 complex homolog subunit 5                   60.8    1e-08   Acyrthosiphon pisum
ref|XP_002422812.1|  COP9 signalosome complex subunit, putative       60.1    1e-08   Pediculus humanus corporis [human body lice]
ref|XP_002129245.1|  PREDICTED: COP9 signalosome complex subunit ...  60.5    1e-08   Ciona intestinalis [sea vase]
ref|XP_003700698.1|  PREDICTED: COP9 signalosome complex subunit ...  60.1    1e-08   Megachile rotundata
gb|KDR11248.1|  COP9 signalosome complex subunit 5                    60.1    2e-08   Zootermopsis nevadensis
ref|XP_011502813.1|  PREDICTED: COP9 signalosome complex subunit 5    60.1    2e-08   Ceratosolen solmsi marchali
ref|XP_002056387.1|  GJ10255                                          60.1    2e-08   Drosophila virilis
emb|CEP10016.1|  hypothetical protein                                 60.5    2e-08   Parasitella parasitica
ref|XP_008485715.1|  PREDICTED: COP9 signalosome complex subunit ...  60.1    2e-08   Diaphorina citri
ref|XP_008479869.1|  PREDICTED: COP9 signalosome complex subunit ...  60.1    2e-08   Diaphorina citri
ref|XP_011332242.1|  PREDICTED: COP9 signalosome complex subunit 5    60.1    2e-08   Ooceraea biroi
ref|XP_001862398.1|  COP9 signalosome complex subunit 5               60.5    2e-08   Culex quinquefasciatus
ref|XP_001649479.1|  AAEL014747-PA                                    59.7    2e-08   
ref|NP_001138802.1|  JAB-MPN domain protein                           59.7    2e-08   Bombyx mori [silk moth]
ref|XP_005648133.1|  Mov34-domain-containing protein                  59.7    3e-08   Coccomyxa subellipsoidea C-169
ref|XP_011147629.1|  PREDICTED: COP9 signalosome complex subunit ...  59.3    3e-08   Harpegnathos saltator
ref|XP_011147628.1|  PREDICTED: COP9 signalosome complex subunit ...  59.7    3e-08   
gb|EFN79117.1|  COP9 signalosome complex subunit 5                    59.7    3e-08   Harpegnathos saltator
gb|KFM80396.1|  COP9 signalosome complex subunit 5                    57.0    3e-08   Stegodyphus mimosarum
ref|XP_011147627.1|  PREDICTED: COP9 signalosome complex subunit ...  59.7    3e-08   Harpegnathos saltator
ref|XP_001998673.1|  GI23503                                          59.3    3e-08   Drosophila mojavensis
emb|CEJ02827.1|  Putative COP9 signalosome complex subunit 5a         57.4    3e-08   Rhizopus microsporus
ref|XP_008548790.1|  PREDICTED: COP9 signalosome complex subunit ...  59.3    3e-08   Microplitis demolitor
ref|XP_011209192.1|  PREDICTED: COP9 signalosome complex subunit 5    58.9    5e-08   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011182476.1|  PREDICTED: COP9 signalosome complex subunit 5    58.5    5e-08   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004205813.1|  PREDICTED: COP9 signalosome complex subunit ...  56.6    5e-08   
dbj|GAM27607.1|  hypothetical protein SAMD00019534_107830             58.5    6e-08   Acytostelium subglobosum LB1
gb|KID75045.1|  COP9 signalosome complex subunit 5                    58.2    7e-08   Metarhizium brunneum ARSEF 3297
ref|XP_007825082.1|  signaling protein                                58.2    8e-08   Metarhizium robertsii ARSEF 23
gb|KFG82749.1|  COP9 signalosome complex subunit 5                    58.2    8e-08   Metarhizium anisopliae
gb|KID87397.1|  COP9 signalosome complex subunit 5                    58.2    8e-08   Metarhizium guizhouense ARSEF 977
ref|XP_623836.1|  PREDICTED: COP9 signalosome complex subunit 5 i...  58.2    9e-08   Apis mellifera [bee]
ref|XP_003399828.1|  PREDICTED: COP9 signalosome complex subunit ...  58.2    9e-08   
ref|XP_007811766.1|  COP9 signalosome complex subunit 5               58.2    9e-08   Metarhizium acridum CQMa 102
ref|XP_003399827.1|  PREDICTED: COP9 signalosome complex subunit ...  58.2    9e-08   Bombus terrestris [large earth bumblebee]
ref|XP_003486847.1|  PREDICTED: COP9 signalosome complex subunit ...  58.2    9e-08   Bombus impatiens
ref|XP_011292660.1|  PREDICTED: COP9 signalosome complex subunit 5    57.8    1e-07   Musca domestica
dbj|BAE87894.1|  unnamed protein product                              55.5    1e-07   Macaca fascicularis [crab eating macaque]
ref|XP_011171452.1|  PREDICTED: COP9 signalosome complex subunit 5    57.8    1e-07   Solenopsis invicta [imported red fire ant]
ref|XP_005099578.1|  PREDICTED: COP9 signalosome complex subunit ...  57.4    1e-07   Aplysia californica
gb|KFB47242.1|  hypothetical protein ZHAS_00015265                    57.4    1e-07   Anopheles sinensis
emb|CEG64164.1|  Putative COP9 signalosome complex subunit 5a         57.0    2e-07   Rhizopus microsporus
emb|CCG82078.1|  putative COP9 signalosome subunit 5                  57.4    2e-07   Taphrina deformans PYCC 5710
emb|CEF98127.1|  JAB/MPN domain                                       57.0    2e-07   Ostreococcus tauri
ref|XP_011049626.1|  PREDICTED: COP9 signalosome complex subunit ...  57.0    2e-07   Acromyrmex echinatior
gb|EHL03671.1|  putative COP9 signalosome complex subunit 5           56.6    2e-07   Glarea lozoyensis 74030
ref|XP_011049625.1|  PREDICTED: COP9 signalosome complex subunit ...  57.0    2e-07   Acromyrmex echinatior
gb|AEE62710.1|  unknown                                               57.0    2e-07   Dendroctonus ponderosae
ref|XP_011049624.1|  PREDICTED: COP9 signalosome complex subunit ...  57.0    2e-07   Acromyrmex echinatior
ref|XP_312032.5|  AGAP002880-PA                                       56.6    2e-07   Anopheles gambiae str. PEST
ref|XP_007248979.1|  PREDICTED: COP9 signalosome complex subunit 5    56.6    2e-07   Astyanax mexicanus [blind cave fish]
gb|EGT56002.1|  hypothetical protein CAEBREN_15614                    57.0    2e-07   Caenorhabditis brenneri
gb|EGT48387.1|  hypothetical protein CAEBREN_22923                    57.0    2e-07   Caenorhabditis brenneri
ref|XP_003712833.1|  COP9 signalosome complex subunit 5               56.6    3e-07   Magnaporthe oryzae 70-15
ref|XP_003292126.1|  Mov34/MPN/PAD-1 family protein                   56.6    3e-07   Dictyostelium purpureum
ref|XP_002408598.1|  COP9 signalosome, subunit CSN5, putative         55.8    3e-07   Ixodes scapularis [blacklegged tick]
dbj|BAN21083.1|  jun activation domain binding protein                56.2    3e-07   Riptortus pedestris
ref|XP_001249856.5|  PREDICTED: COP9 signalosome complex subunit ...  55.1    3e-07   
gb|ETN63713.1|  jun activation domain binding protein                 56.2    4e-07   Anopheles darlingi [American malaria mosquito]
gb|ADP30958.1|  COP9 constitutive photomorphogenic-like protein s...  56.2    4e-07   Penaeus monodon [giant tiger prawn]
ref|XP_003408260.1|  PREDICTED: COP9 signalosome complex subunit 5    54.7    4e-07   Loxodonta africana [African bush elephant]
ref|XP_007914606.1|  putative cop9 signalosome complex subunit 5 ...  56.2    4e-07   Phaeoacremonium minimum UCRPA7
gb|ACN61634.1|  COP9 signalosome subunit 5                            53.9    4e-07   Megaderma lyra [greater false vampire bat]
ref|XP_007885051.1|  PREDICTED: COP9 signalosome complex subunit ...  55.8    4e-07   Callorhinchus milii [Australian ghost shark]
ref|XP_008083662.1|  JAB1/MPN                                         55.8    5e-07   Glarea lozoyensis ATCC 20868
ref|XP_005663091.1|  PREDICTED: COP9 signalosome complex subunit ...  55.8    5e-07   Sus scrofa [pigs]
ref|XP_972769.1|  PREDICTED: COP9 signalosome complex subunit 5       55.8    5e-07   
dbj|BAM18530.1|  COP9 complex homolog subunit 5                       55.8    5e-07   Papilio xuthus [Chinese swallowtail]
ref|XP_004354957.1|  Mov34/MPN/PAD-1 family protein                   55.8    5e-07   Cavenderia fasciculata
gb|KJB06586.1|  hypothetical protein B456_001G001700                  53.9    6e-07   Gossypium raimondii
emb|CDP99135.1|  Protein BM-CSN-5, isoform b                          55.8    6e-07   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001900779.1|  COP9 signalosome complex subunit 5               55.5    6e-07   Brugia malayi [agent of lymphatic filariasis]
emb|CDP99134.1|  Protein BM-CSN-5, isoform d                          55.8    6e-07   Brugia malayi [agent of lymphatic filariasis]
ref|XP_004588161.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    7e-07   Ochotona princeps [southern American pika]
ref|XP_004773046.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    7e-07   
ref|XP_006815652.1|  PREDICTED: COP9 signalosome complex subunit ...  55.1    7e-07   Saccoglossus kowalevskii
ref|XP_008106749.1|  PREDICTED: COP9 signalosome complex subunit 5    55.5    8e-07   Anolis carolinensis [Carolina anole]
gb|ELR58372.1|  COP9 signalosome complex subunit 5                    55.5    8e-07   Bos mutus
ref|XP_006150523.1|  PREDICTED: COP9 signalosome complex subunit ...  55.1    8e-07   
ref|NP_001179068.1|  COP9 signalosome complex subunit 5               55.1    8e-07   Bos taurus [bovine]
ref|XP_006860136.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    8e-07   Chrysochloris asiatica
gb|ACO14355.1|  COP9 signalosome complex subunit 5                    53.5    8e-07   Esox lucius
gb|AAB16847.1|  Jun activation domain binding protein                 55.1    8e-07   Homo sapiens [man]
ref|XP_007634273.1|  PREDICTED: COP9 signalosome complex subunit ...  55.5    8e-07   
ref|XP_005066755.1|  PREDICTED: COP9 signalosome complex subunit 5    55.5    8e-07   
ref|XP_006752490.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  55.1    8e-07   Leptonychotes weddellii
ref|NP_006828.2|  COP9 signalosome complex subunit 5                  55.1    8e-07   Homo sapiens [man]
ref|XP_008148613.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    8e-07   
gb|AAX37104.1|  COP9 constitutive photomorphogenic-like subunit 5     55.1    9e-07   synthetic construct
ref|XP_001494265.1|  PREDICTED: COP9 signalosome complex subunit ...  55.1    9e-07   
ref|XP_004602468.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    9e-07   Sorex araneus [Eurasian shrew]
ref|NP_038743.1|  COP9 signalosome complex subunit 5 isoform 1        55.1    9e-07   Mus musculus [mouse]
ref|XP_003831400.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    9e-07   Pan paniscus [bonobo]
ref|XP_535093.1|  PREDICTED: COP9 signalosome complex subunit 5 i...  55.1    9e-07   Canis lupus familiaris [dogs]
ref|XP_007651216.1|  PREDICTED: COP9 signalosome complex subunit ...  55.5    9e-07   
gb|AAP36860.1|  Homo sapiens COP9 constitutive photomorphogenic h...  55.1    9e-07   synthetic construct
ref|NP_001020866.1|  COP9 signalosome complex subunit 5               55.1    9e-07   Rattus norvegicus [brown rat]
ref|XP_002609973.1|  hypothetical protein BRAFLDRAFT_124393           53.1    1e-06   Branchiostoma floridae
ref|XP_008072512.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    1e-06   Carlito syrichta
ref|XP_006069586.1|  PREDICTED: COP9 signalosome complex subunit ...  55.5    1e-06   
ref|XP_004679877.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    1e-06   Condylura cristata
gb|KID97652.1|  COP9 signalosome complex subunit 5                    55.1    1e-06   Metarhizium majus ARSEF 297
gb|EJW89035.1|  JAB-MPN domain-containing protein                     55.1    1e-06   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_007527171.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    1e-06   Erinaceus europaeus [common hedgehog]
ref|XP_007429682.1|  PREDICTED: COP9 signalosome complex subunit 5    55.1    1e-06   Python bivittatus
ref|XP_006069587.1|  PREDICTED: COP9 signalosome complex subunit ...  54.7    1e-06   
gb|KFO20318.1|  COP9 signalosome complex subunit 5                    55.5    1e-06   Fukomys damarensis [Damara mole rat]
gb|AET43978.1|  COP9 signalosome subunit 5                            54.7    1e-06   Reishia clavigera
ref|XP_004638141.1|  PREDICTED: COP9 signalosome complex subunit ...  54.7    1e-06   Octodon degus
gb|EPY74001.1|  COP9 signalosome complex subunit 5 isoform 1          55.5    1e-06   Camelus ferus
gb|ESZ94555.1|  COP9 signalosome complex subunit 5                    54.7    1e-06   Sclerotinia borealis F-4128
ref|XP_005866406.1|  PREDICTED: COP9 signalosome complex subunit 5    54.7    1e-06   Myotis brandtii
ref|NP_001086291.1|  COP9 signalosome complex subunit 5               54.7    1e-06   Xenopus laevis [clawed frog]
ref|NP_989109.1|  COP9 signalosome complex subunit 5                  54.7    1e-06   Xenopus tropicalis [western clawed frog]
gb|ELW64697.1|  COP9 signalosome complex subunit 5                    55.1    1e-06   Tupaia chinensis
ref|XP_006131545.1|  PREDICTED: COP9 signalosome complex subunit ...  54.7    1e-06   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_011297758.1|  PREDICTED: COP9 signalosome complex subunit 5    54.7    1e-06   Fopius arisanus
gb|ETE60341.1|  COP9 signalosome complex subunit 5                    54.7    1e-06   Ophiophagus hannah
ref|XP_011448116.1|  PREDICTED: COP9 signalosome complex subunit ...  54.7    1e-06   Crassostrea gigas
ref|XP_002584116.1|  COP9 signalosome complex subunit 5               54.7    1e-06   Uncinocarpus reesii 1704
gb|EMS48301.1|  COP9 signalosome complex subunit 5b                   54.3    1e-06   Triticum urartu
ref|XP_011448117.1|  PREDICTED: COP9 signalosome complex subunit ...  54.7    2e-06   
ref|XP_001595259.1|  hypothetical protein SS1G_03348                  54.3    2e-06   Sclerotinia sclerotiorum 1980 UF-70
emb|CEG78022.1|  Putative COP9 signalosome complex subunit 5a         54.3    2e-06   Rhizopus microsporus
gb|ERE86124.1|  COP9 signalosome complex subunit 5                    55.1    2e-06   Cricetulus griseus [Chinese hamsters]
gb|KHN97596.1|  COP9 signalosome complex subunit 5                    54.3    2e-06   Metarhizium album ARSEF 1941
gb|EFA83038.1|  Mov34/MPN/PAD-1 family protein                        54.3    2e-06   Heterostelium album PN500
gb|EYC46046.1|  hypothetical protein Y032_0410g948                    54.3    2e-06   Ancylostoma ceylanicum
gb|EYC46045.1|  hypothetical protein Y032_0410g948                    54.3    2e-06   Ancylostoma ceylanicum
ref|XP_004842148.1|  PREDICTED: COP9 signalosome complex subunit ...  53.9    2e-06   
emb|CDJ96405.1|  Mov34 MPN PAD-1 domain containing protein            54.3    2e-06   Haemonchus contortus [red stomach worm]
ref|XP_005851620.1|  hypothetical protein CHLNCDRAFT_19207            53.9    2e-06   Chlorella variabilis
ref|XP_001368118.1|  PREDICTED: COP9 signalosome complex subunit 5    53.9    2e-06   Monodelphis domestica
gb|ERG87648.1|  cop9 signalosome complex subunit 5                    53.9    3e-06   
ref|NP_001098770.1|  COP9 signalosome complex subunit 5               53.9    3e-06   Sus scrofa [pigs]
ref|XP_003045242.1|  predicted protein                                53.9    3e-06   [Nectria] haematococca mpVI 77-13-4
ref|XP_004842149.1|  PREDICTED: COP9 signalosome complex subunit ...  53.1    3e-06   
ref|XP_003323591.1|  COP9 signalosome complex subunit 5               53.9    3e-06   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_009029035.1|  hypothetical protein HELRODRAFT_185158           53.5    3e-06   Helobdella robusta
emb|CDS11961.1|  Putative COP9 signalosome complex subunit 5a         53.5    3e-06   Lichtheimia ramosa
ref|WP_028836347.1|  hypothetical protein                             51.6    3e-06   
gb|EYE96574.1|  COP9 signalosome subunit CsnE                         53.5    3e-06   Aspergillus ruber CBS 135680
emb|CEF67816.1|  COP9 signalosome complex subunit 5                   53.5    3e-06   Strongyloides ratti
ref|XP_006006856.1|  PREDICTED: COP9 signalosome complex subunit ...  52.8    4e-06   Latimeria chalumnae
gb|EIT80237.1|  COP9 signalosome, subunit CSN5                        53.5    4e-06   Aspergillus oryzae 3.042
ref|XP_002678028.1|  jun kinase activation domain binding protein     53.1    4e-06   Naegleria gruberi strain NEG-M
ref|XP_011400031.1|  COP9 signalosome complex subunit 5b              52.4    4e-06   
ref|XP_003067409.1|  COP9 signalosome complex subunit 5, putative     53.1    4e-06   
gb|EFW19686.1|  COP9 signalosome complex subunit 5                    53.1    4e-06   
emb|CAG00664.1|  unnamed protein product                              53.1    4e-06   
ref|XP_007779451.1|  COP9 signalosome complex subunit 5               53.1    4e-06   
ref|XP_003967989.1|  PREDICTED: COP9 signalosome complex subunit ...  53.1    4e-06   
pdb|4F7O|A  Chain A, Crystal Structure Of Csn5                        52.4    4e-06   
ref|XP_010884175.1|  PREDICTED: COP9 signalosome complex subunit 5    53.1    5e-06   
ref|XP_001512862.1|  PREDICTED: COP9 signalosome complex subunit 5    53.1    5e-06   
ref|XP_009217063.1|  COP9 signalosome complex subunit 5               53.1    5e-06   
ref|XP_007410237.1|  hypothetical protein MELLADRAFT_116525           53.1    5e-06   
ref|XP_005311431.1|  PREDICTED: COP9 signalosome complex subunit ...  52.8    6e-06   
ref|XP_006006855.1|  PREDICTED: COP9 signalosome complex subunit ...  52.8    6e-06   
gb|KIW00274.1|  hypothetical protein PV09_08164                       52.8    6e-06   
gb|EKG20488.1|  Mov34/MPN/PAD-1                                       52.8    6e-06   
dbj|GAD91695.1|  COP9 signalosome complex subunit 5                   52.8    6e-06   
gb|ACO09632.1|  COP9 signalosome complex subunit 5                    52.8    6e-06   
ref|XP_006634059.1|  PREDICTED: COP9 signalosome complex subunit ...  52.8    6e-06   
ref|XP_004524029.1|  PREDICTED: COP9 signalosome complex subunit ...  52.4    7e-06   
gb|KFY66915.1|  hypothetical protein V496_01853                       52.8    7e-06   
ref|XP_004524030.1|  PREDICTED: COP9 signalosome complex subunit ...  52.4    7e-06   
ref|XP_005833249.1|  hypothetical protein GUITHDRAFT_107880           52.4    7e-06   
ref|XP_007839403.1|  COP9 signalosome complex subunit 5               52.8    7e-06   
dbj|GAK66062.1|  mov34-domain-containing protein                      52.8    7e-06   
ref|XP_008041270.1|  Mov34-domain-containing protein                  52.8    7e-06   
gb|EGW14995.1|  COP9 signalosome complex subunit 5                    52.4    8e-06   
emb|CDJ85538.1|  Mov34 MPN PAD-1 domain containing protein            52.4    8e-06   
gb|KHN85679.1|  COP9 signalosome complex subunit 5                    52.4    8e-06   
gb|KFZ02747.1|  hypothetical protein V502_11539                       52.4    8e-06   
ref|XP_001418095.1|  predicted protein                                52.4    9e-06   
ref|XP_006262064.1|  PREDICTED: COP9 signalosome complex subunit 5    52.4    9e-06   
ref|XP_005770092.1|  hypothetical protein EMIHUDRAFT_75732            52.4    9e-06   
gb|EPS32803.1|  hypothetical protein PDE_07763                        52.4    9e-06   
ref|XP_001822456.2|  COP9 signalosome complex subunit 5               52.0    1e-05   
ref|XP_009957065.1|  PREDICTED: COP9 signalosome complex subunit ...  52.0    1e-05   
gb|KFP96001.1|  COP9 signalosome complex subunit 5                    52.0    1e-05   
ref|XP_008597491.1|  Mov34/MPN/PAD-1 family protein                   52.0    1e-05   
gb|KIJ25292.1|  hypothetical protein M422DRAFT_785628                 52.0    1e-05   
gb|EDP55131.1|  COP9 signalosome subunit 5 (CsnE), putative           52.0    1e-05   
ref|XP_001397194.2|  COP9 signalosome complex subunit 5               52.0    1e-05   
gb|KEY80982.1|  COP9 signalosome subunit CsnE                         52.0    1e-05   
emb|CAK42618.1|  unnamed protein product                              52.0    1e-05   
ref|XP_755961.2|  COP9 signalosome subunit CsnE                       52.0    1e-05   
dbj|GAC74200.1|  COP9 signalosome, subunit CSN5                       52.0    1e-05   
dbj|GAA91502.1|  COP9 signalosome subunit CsnE                        52.0    1e-05   
ref|XP_007876876.1|  hypothetical protein PFL1_01182                  52.0    1e-05   
sp|Q5BBF1.2|CSN5_EMENI  RecName: Full=COP9 signalosome complex su...  52.0    1e-05   
emb|CDH56438.1|  cop9 signalosome complex subunit 5a-like             52.0    1e-05   
ref|XP_659733.1|  hypothetical protein AN2129.2                       52.0    1e-05   
ref|XP_001275909.1|  COP9 signalosome subunit CsnE                    52.0    1e-05   
gb|KFY87142.1|  hypothetical protein V500_07158                       52.0    1e-05   
gb|EMS21844.1|  COP9 signalosome complex subunit 5                    52.0    1e-05   
ref|XP_006965508.1|  signaling protein                                51.6    1e-05   
gb|EXX54839.1|  Rri1p                                                 51.2    1e-05   
gb|ACI68431.1|  COP9 signalosome complex subunit 5                    51.6    1e-05   
gb|EFO27045.2|  COP9 signalosome complex subunit 5                    51.6    1e-05   
gb|KDE08164.1|  COP9 signalosome complex subunit 5                    51.6    1e-05   
gb|KFY28089.1|  hypothetical protein V493_03095                       51.6    1e-05   
gb|KIJ37072.1|  hypothetical protein M422DRAFT_33926                  51.6    2e-05   
gb|KDN39096.1|  Mov34-domain-containing protein                       51.6    2e-05   
ref|XP_009045703.1|  hypothetical protein LOTGIDRAFT_224262           51.2    2e-05   
gb|ESA08506.1|  hypothetical protein GLOINDRAFT_349082                51.6    2e-05   
ref|XP_001551965.1|  hypothetical protein BC1G_09577                  51.2    2e-05   
ref|XP_010777475.1|  PREDICTED: COP9 signalosome complex subunit 5    50.1    2e-05   
ref|XP_004081080.1|  PREDICTED: COP9 signalosome complex subunit 5    51.2    2e-05   
ref|XP_001239887.1|  hypothetical protein CIMG_09508                  51.2    2e-05   
ref|XP_003089147.1|  hypothetical protein CRE_15192                   51.2    2e-05   
emb|CDO75755.1|  hypothetical protein BN946_scf184921.g31             51.2    2e-05   
ref|XP_002626520.1|  COP9 signalosome complex subunit 5               51.2    2e-05   
ref|XP_567446.1|  hypothetical protein                                51.2    2e-05   
ref|XP_002145543.1|  COP9 signalosome subunit CsnE                    51.2    2e-05   
ref|XP_003842050.1|  hypothetical protein LEMA_P078100.1              51.2    2e-05   
gb|KIH48665.1|  Mov34/MPN/PAD-1 family protein                        48.5    2e-05   
ref|XP_007554550.1|  PREDICTED: COP9 signalosome complex subunit 5    50.8    3e-05   
ref|XP_005797898.1|  PREDICTED: COP9 signalosome complex subunit ...  50.8    3e-05   
ref|XP_008394459.1|  PREDICTED: COP9 signalosome complex subunit 5    50.8    3e-05   
gb|EGU11163.1|  COP9 signalosome complex subunit 5                    51.2    3e-05   
ref|XP_010732391.1|  PREDICTED: COP9 signalosome complex subunit 5    50.8    3e-05   
gb|KIL95922.1|  hypothetical protein FAVG1_00660                      50.8    3e-05   
gb|KFY26627.1|  hypothetical protein V491_01230                       50.4    3e-05   
gb|KIL64761.1|  hypothetical protein M378DRAFT_77858                  50.4    4e-05   
gb|KEZ45359.1|  COP9 signalosome complex subunit 5                    50.4    4e-05   
gb|KIR85968.1|  COP9 signalosome complex subunit 5                    50.4    4e-05   
ref|XP_003196240.1|  COP9 signalosome complex subunit 5a              50.4    4e-05   
gb|KGB79807.1|  COP9 signalosome complex subunit 5                    50.4    4e-05   
gb|KIR60500.1|  COP9 signalosome complex subunit 5                    50.4    4e-05   
gb|KIR47282.1|  COP9 signalosome complex subunit 5                    50.4    4e-05   
ref|XP_002486987.1|  COP9 signalosome subunit CsnE                    50.4    4e-05   
emb|CCD78036.1|  Jab1/MPN domain metalloenzyme (M67 family)           50.4    4e-05   
gb|KIM42468.1|  hypothetical protein M413DRAFT_444883                 50.4    4e-05   
gb|EFX73885.1|  hypothetical protein DAPPUDRAFT_109433                50.1    4e-05   
gb|KIR33021.1|  COP9 signalosome complex subunit 5                    50.4    4e-05   
ref|NP_957019.1|  COP9 signalosome complex subunit 5                  50.4    4e-05   
ref|XP_003443502.1|  PREDICTED: COP9 signalosome complex subunit ...  50.4    4e-05   
ref|XP_010756604.1|  COP9 signalosome complex subunit 5               50.1    5e-05   
gb|ETS64168.1|  hypothetical protein PaG_01404                        50.4    5e-05   
gb|KGB40099.1|  COP9 signalosome complex subunit 5                    50.1    5e-05   
ref|XP_008305996.1|  PREDICTED: COP9 signalosome complex subunit 5    50.1    5e-05   
gb|KIR26311.1|  COP9 signalosome complex subunit 5                    50.4    5e-05   
ref|XP_007332426.1|  hypothetical protein AGABI1DRAFT_62649           50.1    5e-05   
ref|XP_006464013.1|  hypothetical protein AGABI2DRAFT_209023          50.1    5e-05   
gb|KDR72698.1|  hypothetical protein GALMADRAFT_252900                50.1    5e-05   
ref|XP_001211499.1|  COP9 signalosome complex subunit 5               50.1    5e-05   
ref|NP_001158520.1|  COP9 signalosome complex subunit 5               50.1    5e-05   
emb|CEJ93266.1|  Putative COP9 signalosome complex subunit 5          50.1    5e-05   
ref|XP_008989617.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  50.1    5e-05   
dbj|GAA27173.1|  COP9 signalosome complex subunit 5                   50.1    5e-05   
ref|NP_001232700.1|  putative JUN activation binding protein vari...  50.1    6e-05   
ref|NP_001034400.1|  COP9 signalosome complex subunit 5               50.1    6e-05   
ref|XP_009083861.1|  PREDICTED: COP9 signalosome complex subunit ...  50.1    6e-05   
ref|XP_005150843.1|  PREDICTED: COP9 signalosome complex subunit ...  50.1    6e-05   
ref|XP_010574204.1|  PREDICTED: COP9 signalosome complex subunit ...  50.1    6e-05   
emb|CBN81931.1|  COP9 signalosome complex subunit 5                   49.7    6e-05   
ref|XP_001882520.1|  predicted protein                                50.1    6e-05   
ref|XP_005517166.1|  PREDICTED: COP9 signalosome complex subunit ...  49.7    6e-05   
gb|KIJ90495.1|  hypothetical protein K443DRAFT_686728                 50.1    6e-05   
ref|XP_002952633.1|  hypothetical protein VOLCADRAFT_81927            49.7    7e-05   
ref|XP_004047172.1|  PREDICTED: COP9 signalosome complex subunit 5    50.1    7e-05   
ref|XP_005712040.1|  unnamed protein product                          49.7    7e-05   
ref|XP_007263567.1|  Mov34-domain-containing protein                  49.7    7e-05   
gb|AFR97407.1|  COP9 signalosome complex subunit 5                    49.7    8e-05   
gb|AII16527.1|  COP9 signalosome complex subunit 5                    49.3    9e-05   
ref|XP_007856350.1|  cop9 signalosome complex subunit 5               49.3    9e-05   
ref|XP_011318525.1|  COP9 signalosome complex subunit 5               49.3    1e-04   
ref|XP_009260100.1|  hypothetical protein FPSE_08707                  49.3    1e-04   
ref|XP_011120074.1|  hypothetical protein AOL_s00054g456              49.3    1e-04   
ref|XP_011109554.1|  hypothetical protein H072_3584                   49.3    1e-04   
ref|XP_001538829.1|  COP9 signalosome complex subunit 5               48.9    1e-04   
gb|KFZ06481.1|  hypothetical protein V501_07359                       48.9    1e-04   
gb|KFY77929.1|  hypothetical protein V499_02798                       48.9    1e-04   
ref|XP_007674494.1|  hypothetical protein BAUCODRAFT_32485            48.9    1e-04   
ref|XP_003301972.1|  hypothetical protein PTT_13630                   48.9    1e-04   
gb|EGD96904.1|  COP9 signalosome complex subunit 5                    48.9    1e-04   
gb|EEH04320.1|  COP9 signalosome complex subunit                      48.9    1e-04   
gb|KIK65834.1|  hypothetical protein GYMLUDRAFT_38312                 48.9    1e-04   
ref|XP_009162505.1|  hypothetical protein T265_00468                  49.7    1e-04   
ref|XP_007586662.1|  putative cop9 signalosome complex subunit 5 ...  48.9    1e-04   
ref|XP_003170580.1|  COP9 signalosome complex subunit 5               48.5    2e-04   
ref|XP_003234683.1|  COP9 signalosome complex subunit 5               48.5    2e-04   
ref|XP_007792821.1|  putative cop9 signalosome complex subunit 5 ...  48.5    2e-04   
emb|CEG04727.1|  unnamed protein product                              48.5    2e-04   
gb|EJT99231.1|  Mov34-domain-containing protein                       48.5    2e-04   
gb|EME47502.1|  hypothetical protein DOTSEDRAFT_69442                 48.5    2e-04   
gb|KIY32538.1|  COP9 signalosome complex subunit 5                    48.5    2e-04   
gb|KIO31911.1|  hypothetical protein M407DRAFT_14046                  48.5    2e-04   
ref|XP_002837843.1|  hypothetical protein                             48.5    2e-04   
gb|KIN05013.1|  hypothetical protein OIDMADRAFT_142793                48.1    2e-04   
ref|XP_002848322.1|  COP9 signalosome complex subunit 5               48.1    2e-04   
ref|XP_002791463.1|  COP9 signalosome complex subunit 5               48.1    2e-04   
gb|KFY38702.1|  hypothetical protein V494_04244                       48.1    2e-04   
gb|KFY07234.1|  hypothetical protein V492_07331                       48.1    2e-04   
gb|KFH67419.1|  COP9 signalosome complex subunit 5                    48.1    2e-04   
gb|KIP09733.1|  hypothetical protein PHLGIDRAFT_18515                 48.1    2e-04   
emb|CCO32282.1|  COP9 signalosome complex subunit 5                   48.9    2e-04   
gb|EWC48220.1|  COP9 signalosome complex subunit 5                    48.1    3e-04   
ref|XP_007066265.1|  PREDICTED: COP9 signalosome complex subunit 5    47.8    3e-04   
ref|XP_003029105.1|  hypothetical protein SCHCODRAFT_70193            47.8    3e-04   
gb|KFM00893.1|  COP9 signalosome complex subunit 5                    47.8    3e-04   
emb|CEL63357.1|  COP9 signalosome complex subunit 5                   47.8    3e-04   
ref|XP_007923897.1|  CSN5 cop9 signalosome subunit 5                  47.8    3e-04   
gb|KIZ06923.1|  COP9 signalosome complex subunit 5                    47.8    3e-04   
pdb|4D18|E  Chain E, Crystal Structure Of The Cop9 Signalosome        47.4    4e-04   
ref|XP_001694818.1|  COP signalosome subunit 5                        47.4    4e-04   
ref|XP_002507203.1|  predicted protein                                47.4    4e-04   
ref|XP_001261089.1|  COP9 signalosome subunit 5 (CsnE), putative      47.4    4e-04   
gb|EPS97388.1|  hypothetical protein FOMPIDRAFT_1025013               47.4    4e-04   
gb|EHK17806.1|  hypothetical protein TRIVIDRAFT_43384                 47.4    4e-04   
gb|KFX90480.1|  hypothetical protein V490_06441                       47.4    5e-04   
ref|XP_007394451.1|  hypothetical protein PHACADRAFT_253814           47.4    5e-04   
ref|XP_007363558.1|  Mov34-domain-containing protein                  47.4    5e-04   
gb|KHJ34882.1|  putative cop9 signalosome complex subunit 5           47.0    5e-04   
gb|ELR02314.1|  COP9 signalosome complex subunit 5                    47.0    6e-04   
gb|KIY62389.1|  Mov34-domain-containing protein                       47.0    6e-04   
ref|XP_003137030.1|  COP9 signalosome complex subunit 5               46.6    7e-04   
ref|XP_007760657.1|  COP9 signalosome complex subunit 5               46.6    7e-04   
gb|EWZ38250.1|  COP9 signalosome complex subunit 5                    46.6    7e-04   
gb|EPZ33258.1|  JAB1/Mov34/MPN/PAD-1 domain-containing protein        46.6    8e-04   
gb|EMD90731.1|  hypothetical protein COCHEDRAFT_1022509               46.6    8e-04   
ref|XP_002567243.1|  Pc21g01770                                       46.2    9e-04   
gb|KIW64077.1|  hypothetical protein PV04_09035                       46.6    0.001   
ref|XP_006667797.1|  COP9 signalosome complex subunit 5               46.2    0.001   



>ref|XP_008445090.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Cucumis 
melo]
Length=365

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            M+ F SS+ IAQKTWE+ENN+ ++D PPT++ ++ +++ +  IFYYDE AQ KFQQEKPW
Sbjct  1    MEPFPSSSQIAQKTWELENNIISVDTPPTTSKASDSASDA--IFYYDEAAQAKFQQEKPW  58

Query  221  TNDPHYFKRVKISALAL  271
             NDPHYFKRVKISALAL
Sbjct  59   QNDPHYFKRVKISALAL  75



>ref|XP_004138765.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 ref|XP_004160845.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 gb|KGN62874.1| hypothetical protein Csa_2G378560 [Cucumis sativus]
Length=365

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            M+ F SS+ IAQKTWE+ENN+ ++D PPT++ ++ +++ +  IFYYDE AQ KFQQEKPW
Sbjct  1    MEPFPSSSQIAQKTWELENNIISVDTPPTTSKASDSASDA--IFYYDEAAQAKFQQEKPW  58

Query  221  TNDPHYFKRVKISALAL  271
             NDPHYFKRVKISALAL
Sbjct  59   QNDPHYFKRVKISALAL  75



>ref|XP_002283561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Vitis vinifera]
Length=360

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 9/75 (12%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            SFTSSA+IAQKTWE+ENN+ +MD P         SA SD+IF+YD+ AQ KFQQEKPW N
Sbjct  5    SFTSSASIAQKTWELENNIASMDAP---------SADSDSIFFYDDAAQAKFQQEKPWAN  55

Query  227  DPHYFKRVKISALAL  271
            DPHYFKRVKISALAL
Sbjct  56   DPHYFKRVKISALAL  70



>ref|XP_010111938.1| COP9 signalosome complex subunit 5b [Morus notabilis]
 gb|EXC32056.1| COP9 signalosome complex subunit 5b [Morus notabilis]
Length=368

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLP-PTsadsaaasassdaIFYYDETAQTKFQQEKP  217
            M++F SS+ IAQ+TWE+ENN+  M+ P P +   ++   SSDA+FYYDE AQ KFQQEKP
Sbjct  1    MEAFPSSSQIAQQTWELENNIIPMETPTPPATAKSSGGDSSDAVFYYDEAAQAKFQQEKP  60

Query  218  WTNDPHYFKRVKISALAL  271
            W+NDPHYFKRVKISALAL
Sbjct  61   WSNDPHYFKRVKISALAL  78



>gb|KDP33444.1| hypothetical protein JCGZ_07015 [Jatropha curcas]
Length=366

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = +2

Query  41   MDSF-TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  217
            MD + +SSA IAQKTWE+ENN+ T+D  PT+  +A AS+ +  IFYYDETAQ KFQQ+KP
Sbjct  1    MDPYPSSSALIAQKTWELENNIITVDTSPTTNSTADASSDA--IFYYDETAQAKFQQDKP  58

Query  218  WTNDPHYFKRVKISALAL  271
            W NDPHYF+RVKISALAL
Sbjct  59   WANDPHYFRRVKISALAL  76



>ref|XP_006351153.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 67/77 (87%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  221  TNDPHYFKRVKISALAL  271
            T+DPHYFKRVKISALAL
Sbjct  61   TSDPHYFKRVKISALAL  77



>ref|XP_006450163.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 gb|ESR63403.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=337

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  61   KRVKISALAL  70



>ref|XP_002527960.1| jun activation domain binding protein, putative [Ricinus communis]
 gb|EEF34372.1| jun activation domain binding protein, putative [Ricinus communis]
Length=367

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            +SS+ IAQKTWE+ENN+ T+D PPT+  +A  S+ +  IFYYDE AQ KFQQ++PW+NDP
Sbjct  7    SSSSVIAQKTWELENNIITVDTPPTTNSTADPSSDA--IFYYDEPAQVKFQQDRPWSNDP  64

Query  233  HYFKRVKISALAL  271
            HYF+RVKISALAL
Sbjct  65   HYFRRVKISALAL  77



>ref|XP_006450165.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483570.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Citrus sinensis]
 gb|ESR63405.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=360

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  61   KRVKISALAL  70



>ref|XP_006450164.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483569.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Citrus sinensis]
 gb|ESR63404.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=361

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  61   KRVKISALAL  70



>gb|KDO67280.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=360

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  61   KRVKISALAL  70



>gb|KDO67279.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=361

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            ++IAQKTWE+ENN+ +M+ PPT++ +  +++ +  IF+YDE AQTKFQQEKPW NDPHYF
Sbjct  3    SSIAQKTWELENNIVSMETPPTNSTADTSASDA--IFFYDEGAQTKFQQEKPWVNDPHYF  60

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  61   KRVKISALAL  70



>ref|XP_007221779.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
 ref|XP_008219932.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Prunus mume]
 gb|EMJ22978.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
Length=366

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A IAQ+TWE+ENN+  MD PP+ A S A  ++   IFYYDE AQ KFQQEKPWTNDPHYF
Sbjct  3    AQIAQQTWELENNIIPMDTPPSVAKSKADPSADA-IFYYDEAAQAKFQQEKPWTNDPHYF  61

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  62   KRVKISALAL  71



>ref|XP_009617619.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
tomentosiformis]
Length=367

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + S   +++SDAIF+YDE AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSTPENSASDAIFHYDEAAQTKFQREKPW  60

Query  221  TNDPHYFKRVKISALAL  271
             +DPH+FKRVKISALAL
Sbjct  61   ASDPHFFKRVKISALAL  77



>ref|XP_004291259.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=359

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A IAQKTWE+ENN+  MD PP  + +  ++ +   IFYYDE AQTKFQQEKPW NDPH+F
Sbjct  3    AEIAQKTWELENNIVPMDTPPAMSKTDPSADA---IFYYDEAAQTKFQQEKPWVNDPHFF  59

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  60   KRVKISALAL  69



>ref|XP_011459046.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=360

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A IAQKTWE+ENN+  MD PP  + +  ++ +   IFYYDE AQTKFQQEKPW NDPH+F
Sbjct  3    AEIAQKTWELENNIVPMDTPPAMSKTDPSADA---IFYYDEAAQTKFQQEKPWVNDPHFF  59

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  60   KRVKISALAL  69



>ref|XP_009786152.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
sylvestris]
Length=367

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            ++S+ SSAA+AQ+TWE+ENN+ TMD P   + S   + +SDAIF+YDE AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTMDAP---SGSTPENLASDAIFHYDEAAQTKFQREKPW  60

Query  221  TNDPHYFKRVKISALAL  271
             +DPH+FKRVKISALAL
Sbjct  61   ASDPHFFKRVKISALAL  77



>emb|CBL87025.1| CSN5 protein [Solanum lycopersicum]
Length=367

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            ++S+ SSAA+AQ+TWE+ENN+ T D P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTTDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  221  TNDPHYFKRVKISALAL  271
            T+DPHYFKRVKISALAL
Sbjct  61   TSDPHYFKRVKISALAL  77



>ref|NP_001234331.1| JAB [Solanum lycopersicum]
 gb|AAG43411.1| JAB [Solanum lycopersicum]
Length=367

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            ++S+ SSAA+AQ+TWE+ENN+ T D P   + SA  +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTTDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW  60

Query  221  TNDPHYFKRVKISALAL  271
            T+DPHYFKRVKISALAL
Sbjct  61   TSDPHYFKRVKISALAL  77



>ref|XP_008378244.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=367

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A IAQ+TWE+ENNV  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    AQIAQQTWELENNVIPMDTPPSVAKPKADPTADA-IFYYDEAAQVKFQQEKPWANDPHYF  61

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  62   KRVKISALAL  71



>ref|XP_004241422.1| PREDICTED: COP9 signalosome complex subunit 5b [Solanum lycopersicum]
Length=367

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            ++S+ SSAA+AQ+TWE+ENN+ T+D P   + S   +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTIDAP---SGSKPENSASDAIFHYDDAAQTKFQREKPW  60

Query  221  TNDPHYFKRVKISALAL  271
             +DPHYFKRVKISALAL
Sbjct  61   ASDPHYFKRVKISALAL  77



>ref|XP_006347307.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            ++S+ SSAA+AQ+TWE+ENN+ T+D P   + S   +++SDAIF+YD+ AQTKFQ+EKPW
Sbjct  4    LNSYASSAAMAQQTWELENNIVTIDAP---SGSTPENSASDAIFHYDDAAQTKFQREKPW  60

Query  221  TNDPHYFKRVKISALAL  271
             +DPHYFKRVKISALAL
Sbjct  61   ASDPHYFKRVKISALAL  77



>gb|KFK41544.1| hypothetical protein AALP_AA2G143000 [Arabis alpina]
Length=357

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+ IA+KTWE+ENN+ T+D P +++DS         IFYYD+TAQ+KFQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENNILTVDQPNSASDS---------IFYYDDTAQSKFQQEKPWANDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>ref|XP_010259860.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nelumbo 
nucifera]
Length=363

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 60/79 (76%), Gaps = 11/79 (14%)
 Frame = +2

Query  41   MDSFT--SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEK  214
            MDSF+  SSAA+AQ+TWE+ENN+  M+ P          A SDAI++YDE AQ KFQQEK
Sbjct  1    MDSFSVSSSAAMAQQTWELENNIVNMEGP---------LADSDAIYFYDEAAQAKFQQEK  51

Query  215  PWTNDPHYFKRVKISALAL  271
            PW NDPHYFKRVKISALAL
Sbjct  52   PWANDPHYFKRVKISALAL  70



>ref|XP_007137114.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
 gb|ESW09108.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
Length=374

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassd--aIFYYDETAQTKFQQEK  214
            M+  TSS+AIAQKTWE+ENN+  MD P  ++ S+ A+A++   +IFYYDE  Q +FQ++K
Sbjct  6    MEGLTSSSAIAQKTWELENNIIPMDTPGAASSSSTATATNADDSIFYYDEAGQNEFQRDK  65

Query  215  PWTNDPHYFKRVKISALAL  271
            PW NDPHYFKRVKISALAL
Sbjct  66   PWANDPHYFKRVKISALAL  84



>ref|XP_008393958.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=376

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A +AQ+TWE+ENN+  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    AQLAQQTWELENNIXPMDTPPSVAKPKADPKADA-IFYYDEAAQAKFQQEKPWANDPHYF  61

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  62   KRVKISALAL  71



>ref|XP_003522659.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=374

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassd--aIFYYDETAQTKFQQEK  214
            M+  +SS+AIAQKTWE+ENN+  MD P  +A S+  + +S   +IFYYDE  Q +FQ++K
Sbjct  6    MEGLSSSSAIAQKTWELENNIIPMDTPGGAAISSTTTTTSADDSIFYYDEAGQNEFQRDK  65

Query  215  PWTNDPHYFKRVKISALAL  271
            PW NDPHYFKRVKISALAL
Sbjct  66   PWANDPHYFKRVKISALAL  84



>ref|XP_010669282.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 6/81 (7%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMD------LPPTsadsaaasassdaIFYYDETAQTKFQQ  208
            + +SSAA+A++TWE+ENN+ET+D         T+  +  +S +SDAIF+YDE+AQTKFQQ
Sbjct  5    ALSSSAAMAKQTWELENNIETIDPTTTTTTTTTTTTTTTSSDASDAIFFYDESAQTKFQQ  64

Query  209  EKPWTNDPHYFKRVKISALAL  271
            EKPW NDPHYFKRVKISALAL
Sbjct  65   EKPWANDPHYFKRVKISALAL  85



>ref|XP_003526451.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=375

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 3/80 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPP---TsadsaaasassdaIFYYDETAQTKFQQE  211
            M+  +SS+AIAQKTWE+ENN+  MD P    TS+ +   + + D+IFYYDE  Q +FQ++
Sbjct  6    MEGLSSSSAIAQKTWELENNIIPMDTPGGAATSSTATTTTNADDSIFYYDEAGQNEFQRD  65

Query  212  KPWTNDPHYFKRVKISALAL  271
            KPW NDPHYFKRVKISALAL
Sbjct  66   KPWANDPHYFKRVKISALAL  85



>ref|XP_002887356.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63615.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+ IA+KTWE+ENN+ T+D P +++D+         IFYYD+T+Q++FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENNILTVDSPDSTSDN---------IFYYDDTSQSRFQQEKPWENDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>ref|XP_006302454.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
 gb|EOA35352.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
Length=358

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS  IA+KTWE+ENN+ T+D P +++D+         IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTTIARKTWELENNILTVDPPDSTSDN---------IFYYDDTAQSRFQQEKPWENDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>ref|XP_009338826.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Pyrus x 
bretschneideri]
Length=367

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A IAQ+TWE+ENN+  MD PP+ A   A   +   IFYYDE AQ KFQQEKPW +DPHYF
Sbjct  3    AQIAQQTWELENNIIPMDTPPSVAKPKADPTADA-IFYYDEAAQAKFQQEKPWASDPHYF  61

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  62   KRVKISALAL  71



>ref|XP_010427950.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=357

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 10/72 (14%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS  +A+KTWE+ENN+ T+D P ++            IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNIITVDQPDSNDT----------IFYYDDTAQSRFQQEKPWANDPH  53

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  54   YFKRVKISALAL  65



>gb|KJB55195.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=346

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|KJB55192.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=350

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|KHG19604.1| COP9 signalosome complex subunit 5b -like protein [Gossypium 
arboreum]
 gb|KJB55191.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=352

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>ref|XP_010471135.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X1 [Camelina 
sativa]
 ref|XP_010471136.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X2 [Camelina 
sativa]
Length=358

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS  +A+KTWE+ENN+ T+D P +++D+         +FYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNIITVDQPDSTSDT---------VFYYDDTAQSRFQQEKPWANDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>gb|KJB55196.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=324

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|KJB55194.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=333

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|AAC36343.1| AJH2 [Arabidopsis thaliana]
Length=358

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+ IA+KTWE+EN++ T+D P +++D+         IFYYD+T+QT+FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>ref|NP_177279.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
 sp|Q9FVU9.1|CSN5A_ARATH RecName: Full=COP9 signalosome complex subunit 5a; Short=Signalosome 
subunit 5a; AltName: Full=Jun activation domain-binding 
homolog 2 [Arabidopsis thaliana]
 gb|AAG51882.1|AC016162_3 c-Jun coactivator-like protein (AJH2); 90304-88609 [Arabidopsis 
thaliana]
 gb|AAL06468.1|AF411778_1 At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AAL58104.1|AF395061_1 CSN complex subunit 5A [Arabidopsis thaliana]
 gb|AAM70525.1| At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AEE35176.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
Length=358

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+ IA+KTWE+EN++ T+D P +++D+         IFYYD+T+QT+FQQEKPW NDPH
Sbjct  4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>gb|KJB55193.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=318

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+ T++ P           SSD+IFYYDE AQ KFQQEKPW NDPHYF
Sbjct  3    SAIAQKTWELENNILTVETP---------DPSSDSIFYYDEAAQAKFQQEKPWANDPHYF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>ref|XP_007011590.1| COP9-signalosome 5B [Theobroma cacao]
 gb|EOY29209.1| COP9-signalosome 5B [Theobroma cacao]
Length=351

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 53/70 (76%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQK WE+ENN+ T+D P           SSD+IFYYD  AQTKFQQEKPW NDPHYF
Sbjct  3    SAIAQKRWELENNILTVDTP---------DPSSDSIFYYDGPAQTKFQQEKPWANDPHYF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>ref|XP_010415831.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=358

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS  +A+KTWE+ENN+ T+D            ++SD IFYYD+TAQ++FQQEKPW NDPH
Sbjct  4    SSTMMARKTWELENNITTVD---------QLDSTSDTIFYYDDTAQSRFQQEKPWANDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>ref|XP_010551182.1| PREDICTED: COP9 signalosome complex subunit 5b [Tarenaya hassleriana]
Length=357

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 8/72 (11%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
             S+ IA+KTWE+ENN+ TM+  P  A           IFYYD+ AQ KFQQEKPW NDPH
Sbjct  3    GSSEIARKTWELENNILTMEPTPDPASDG--------IFYYDDVAQAKFQQEKPWANDPH  54

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  55   YFKRVKISALAL  66



>ref|XP_011076561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Sesamum 
indicum]
Length=361

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MD F SSAAIA++TWE+ENN+ +         S +++A+SDAIFYYDE AQ KFQQEKPW
Sbjct  1    MDPF-SSAAIARQTWELENNIVS-----AGDASDSSAAASDAIFYYDEAAQAKFQQEKPW  54

Query  221  TNDPHYFKRVKISALAL  271
             NDPHYFKRVKISALAL
Sbjct  55   ANDPHYFKRVKISALAL  71



>ref|XP_011031359.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=365

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MD + SS+ IAQKTWE+ENN+  +D    +     + +S DAIFYYDE AQ KFQ+EKPW
Sbjct  1    MDPYPSSS-IAQKTWELENNIIPIDTATPTTKDTPSCSSLDAIFYYDEAAQAKFQKEKPW  59

Query  221  TNDPHYFKRVKISALAL  271
            +NDP+YF+RVKISALAL
Sbjct  60   SNDPNYFRRVKISALAL  76



>ref|XP_004501247.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cicer arietinum]
Length=356

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 11/73 (15%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            +SS+AIAQ+TWE+ENN+  MD P           + D+IF+YDE  Q +FQ++KPW NDP
Sbjct  4    SSSSAIAQQTWELENNIIPMDTP-----------ADDSIFHYDEAGQNEFQRDKPWANDP  52

Query  233  HYFKRVKISALAL  271
            HYFKRVKISALAL
Sbjct  53   HYFKRVKISALAL  65



>ref|XP_006390791.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
 gb|ESQ28077.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
Length=352

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
             S+ IA++TWE+ENN+     PP S+           IFYYD+TAQ+KFQQEKPW NDPH
Sbjct  3    GSSTIARRTWELENNI-----PPDSSSDC--------IFYYDDTAQSKFQQEKPWANDPH  49

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  50   YFKRVKISALAL  61



>dbj|BAJ34223.1| unnamed protein product [Thellungiella halophila]
Length=262

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
             S+ IA++TWE+ENN+     PP S+           IFYYD+TAQ+KFQQEKPW NDPH
Sbjct  3    GSSTIARRTWELENNI-----PPDSSSDC--------IFYYDDTAQSKFQQEKPWANDPH  49

Query  236  YFKRVKISALAL  271
            YFKRVKISALAL
Sbjct  50   YFKRVKISALAL  61



>ref|XP_002324396.1| COP9 complex family protein [Populus trichocarpa]
 gb|EEF02961.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = +2

Query  41   MDSF-TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  217
            MD + +SS++IAQKTWE+ENN++T+D   T   +   S  SDAIF+YD+ AQ KF QEKP
Sbjct  1    MDPYPSSSSSIAQKTWELENNIKTIDTS-TPTIATGTSFLSDAIFHYDDAAQAKFLQEKP  59

Query  218  WTNDPHYFKRVKISALAL  271
            W+NDP+YF+RV+ISALAL
Sbjct  60   WSNDPNYFRRVRISALAL  77



>ref|XP_011082082.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Sesamum indicum]
Length=357

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            +SSAAIA++TWE+ENN+           + ++SA+SD+IF+YDE AQ KFQQEKPW NDP
Sbjct  4    SSSAAIARQTWELENNI---------VATDSSSAASDSIFFYDEAAQAKFQQEKPWANDP  54

Query  233  HYFKRVKISALAL  271
            HYFKRVKISALAL
Sbjct  55   HYFKRVKISALAL  67



>gb|EYU29154.1| hypothetical protein MIMGU_mgv1a0088022mg, partial [Erythranthe 
guttata]
 gb|EYU29173.1| hypothetical protein MIMGU_mgv1a0183041mg, partial [Erythranthe 
guttata]
Length=136

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 5/77 (6%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MD F+SS  IA++TWE+ENN+ T      +  + ++SA+SDAIFYYDE AQ KFQQEKPW
Sbjct  1    MDLFSSST-IARQTWELENNIVT----TAADAADSSSAASDAIFYYDEAAQVKFQQEKPW  55

Query  221  TNDPHYFKRVKISALAL  271
            + DPH+FKRVKISALAL
Sbjct  56   SIDPHFFKRVKISALAL  72



>ref|XP_011082083.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Sesamum indicum]
Length=318

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            +SSAAIA++TWE+ENN+           + ++SA+SD+IF+YDE AQ KFQQEKPW NDP
Sbjct  4    SSSAAIARQTWELENNI---------VATDSSSAASDSIFFYDEAAQAKFQQEKPWANDP  54

Query  233  HYFKRVKISALAL  271
            HYFKRVKISALAL
Sbjct  55   HYFKRVKISALAL  67



>ref|XP_001775449.1| predicted protein [Physcomitrella patens]
 gb|EDQ59778.1| predicted protein [Physcomitrella patens]
Length=372

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 7/77 (9%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            M++ TSSA IA++TWEIENN+   D P       AA++ SDAIF YDE AQ+  QQ+KPW
Sbjct  1    MEASTSSAMIARQTWEIENNIVATDSP-------AATSDSDAIFEYDEAAQSSIQQQKPW  53

Query  221  TNDPHYFKRVKISALAL  271
            T DPHYFK VKISALAL
Sbjct  54   TRDPHYFKNVKISALAL  70



>ref|XP_010048447.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Eucalyptus 
grandis]
 gb|KCW80696.1| hypothetical protein EUGRSUZ_C02093 [Eucalyptus grandis]
Length=375

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNV--------ETMDLPPTsadsaaasassdaIFYYDETAQT  196
            MD+  S AAIAQKTWE+ENN+         +           +    SD+IF+YDE  Q 
Sbjct  1    MDALASQAAIAQKTWELENNILSTTAAGSGSGSGAGAGPADPSKHDQSDSIFFYDEAGQV  60

Query  197  KFQQEKPWTNDPHYFKRVKISALAL  271
            +FQQEKPW+++PHYFKRVKISALAL
Sbjct  61   RFQQEKPWSHEPHYFKRVKISALAL  85



>gb|KFK44380.1| hypothetical protein AALP_AA1G249900 [Arabis alpina]
Length=353

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
             S++IA+KTWE+ENN+ T++ P +S+D          IFYYD++AQ K QQEKPWT DP+
Sbjct  3    GSSSIARKTWELENNILTVEPPDSSSDG---------IFYYDDSAQAKVQQEKPWTTDPN  53

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  54   YFKRVQISALAL  65



>ref|XP_006416142.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
 dbj|BAJ34114.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34495.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
Length=355

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
             S+ IA+KTWE+ENN+ T+D P +S+D          IFYYD+TAQ K QQ+KPW +DP+
Sbjct  3    GSSTIARKTWELENNILTVDPPDSSSDG---------IFYYDDTAQAKVQQDKPWASDPN  53

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  54   YFKRVQISALAL  65



>ref|XP_009115580.1| PREDICTED: COP9 signalosome complex subunit 5b [Brassica rapa]
 emb|CDY21400.1| BnaA09g30270D [Brassica napus]
 emb|CDY04768.1| BnaC05g18210D [Brassica napus]
Length=356

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 8/71 (11%)
 Frame = +2

Query  59   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  238
            S+ IA+KTWE+ENN+ T++ P +S+           IFYYDE +QTK QQEKPW  DP+Y
Sbjct  4    SSTIARKTWELENNILTVEQPDSSSSDG--------IFYYDEASQTKVQQEKPWATDPNY  55

Query  239  FKRVKISALAL  271
            FKRV+ISALAL
Sbjct  56   FKRVQISALAL  66



>ref|XP_003603531.1| COP9 signalosome complex subunit 5b [Medicago truncatula]
 gb|AES73782.1| COP9 signalosome complex subunit 5 [Medicago truncatula]
Length=357

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 11/69 (16%)
 Frame = +2

Query  65   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  244
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  245  RVKISALAL  271
            RVKISALAL
Sbjct  59   RVKISALAL  67



>gb|AAC26484.1| putative JUN kinase activation domain binding protein [Medicago 
sativa]
Length=357

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 11/69 (16%)
 Frame = +2

Query  65   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  244
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  245  RVKISALAL  271
            RVKISALAL
Sbjct  59   RVKISALAL  67



>ref|XP_011045010.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=366

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = +2

Query  41   MDSF-TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  217
            MD + +SS++IAQKTWE+ENN++ +D P T   +   S  SDAIF+YD+  Q KFQQEKP
Sbjct  1    MDPYPSSSSSIAQKTWELENNIKAIDTP-TPTTATDTSFLSDAIFHYDDATQAKFQQEKP  59

Query  218  WTNDPHYFKRVKISALAL  271
            W+NDP+YF+RVKISALAL
Sbjct  60   WSNDPNYFRRVKISALAL  77



>ref|XP_006305189.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
 gb|EOA38087.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
Length=357

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ AQ K QQEKPW +DP+
Sbjct  4    SSSAIAKKTWELENNILTVEPPDSASDG---------IFHYDDAAQAKIQQEKPWASDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  55   YFKRVQISALAL  66



>ref|XP_010914180.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Elaeis guineensis]
Length=360

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 11/77 (14%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MDS   SAAIA++TWE+ENN+  M+         A +A +DAI+YYDE  Q KFQQEKPW
Sbjct  1    MDSM--SAAIARQTWELENNIVAME---------AGAADADAIYYYDEAVQAKFQQEKPW  49

Query  221  TNDPHYFKRVKISALAL  271
             +DP++F+RVKISALAL
Sbjct  50   AHDPNFFRRVKISALAL  66



>gb|EPS57884.1| hypothetical protein M569_16932, partial [Genlisea aurea]
Length=239

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNV--ETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEK  214
            MD F+SSA IA++TWE+EN++  E       ++  ++A+A+SD+IF+YDE AQ K QQ+K
Sbjct  1    MDPFSSSA-IARQTWELENSIIAEGGVDETGASGQSSAAAASDSIFFYDEVAQAKVQQDK  59

Query  215  PWTNDPHYFKRVKISALAL  271
            PW NDPHYFKRVKISALAL
Sbjct  60   PWVNDPHYFKRVKISALAL  78



>ref|XP_010929274.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Elaeis guineensis]
Length=360

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MDS   SA++A++TWE+ENN+  M+         A +A +DAI+YYDE AQ KFQQEKPW
Sbjct  1    MDSM--SASMARQTWELENNIVAME---------AGTAEADAIYYYDEAAQAKFQQEKPW  49

Query  221  TNDPHYFKRVKISALAL  271
             +DP++F+RVKISALAL
Sbjct  50   AHDPNFFRRVKISALAL  66



>ref|XP_010498782.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Camelina 
sativa]
Length=360

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW +DP+
Sbjct  6    SSSAIARKTWELENNIFTVEPPDSASDG---------IFHYDDASQAKIQQEKPWASDPN  56

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  57   YFKRVQISALAL  68



>ref|XP_008810007.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Phoenix 
dactylifera]
Length=360

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MDS   SAA+A++TWE+ENNV  M+         A +A +DAI+YYDE AQ KFQQE+PW
Sbjct  1    MDSM--SAAMARQTWELENNVVAME---------AGTAEADAIYYYDEAAQGKFQQERPW  49

Query  221  TNDPHYFKRVKISALAL  271
             +DP++F+RV+ISALAL
Sbjct  50   AHDPNFFRRVRISALAL  66



>gb|ACJ84456.1| unknown [Medicago truncatula]
Length=357

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 11/69 (16%)
 Frame = +2

Query  65   AIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFK  244
            AIAQ+TWE+ENN+  M+ P           S D+IF+YDE  Q +FQ++KPW NDPHYFK
Sbjct  10   AIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWANDPHYFK  58

Query  245  RVKISALAL  271
            RVKISAL L
Sbjct  59   RVKISALTL  67



>ref|XP_010929275.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Elaeis guineensis]
Length=339

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MDS   SA++A++TWE+ENN+  M+         A +A +DAI+YYDE AQ KFQQEKPW
Sbjct  1    MDSM--SASMARQTWELENNIVAME---------AGTAEADAIYYYDEAAQAKFQQEKPW  49

Query  221  TNDPHYFKRVKISALAL  271
             +DP++F+RVKISALAL
Sbjct  50   AHDPNFFRRVKISALAL  66



>ref|XP_002893252.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69511.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+AIA+KTWE+ENN+ T++  PT + S +       IF+YD+ AQ K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNILTVE--PTDSASDS-------IFHYDDAAQAKIQQEKPWASDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  55   YFKRVQISALAL  66



>gb|ABK24758.1| unknown [Picea sitchensis]
Length=363

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 9/68 (13%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQ+TWE+ENN+  MD P         SA SD+I+YYDE  Q K QQ+KPW  DPHYFK+
Sbjct  12   IAQQTWELENNIVNMDGP---------SAESDSIYYYDEVTQKKIQQDKPWARDPHYFKK  62

Query  248  VKISALAL  271
            VKISALAL
Sbjct  63   VKISALAL  70



>ref|XP_010460061.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Camelina sativa]
 ref|XP_010460063.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Camelina sativa]
Length=358

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            +S+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    TSSAIARKTWELENNILTVEPPDSASDG---------IFHYDDASQAKIQQEKPWASDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  55   YFKRVQISALAL  66



>ref|XP_006845674.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
 gb|ERN07349.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
Length=364

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S ++SA +AQ+TWE+ENN+  M+ P         +  SD+I++YD+ A TK QQEKPW +
Sbjct  5    SSSNSARMAQQTWELENNIVNMESP--------GANDSDSIYFYDDAALTKIQQEKPWQS  56

Query  227  DPHYFKRVKISALAL  271
            DPHYFK+VKISALAL
Sbjct  57   DPHYFKKVKISALAL  71



>ref|XP_010477567.1| PREDICTED: COP9 signalosome complex subunit 5b [Camelina sativa]
Length=358

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            +S+AIA+KTWE+ENN+ T++ P +++D          IF+YD+ +Q K QQEKPW  DP+
Sbjct  4    TSSAIARKTWELENNILTVEPPDSASDG---------IFHYDDASQAKIQQEKPWAADPN  54

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  55   YFKRVQISALAL  66



>ref|XP_009420301.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Musa acuminata 
subsp. malaccensis]
Length=368

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            MDS  SSA +A++TWE+ENN+ ++D    S  + +  + +DAI+YYDE    KFQQEKPW
Sbjct  1    MDSSLSSA-LARQTWELENNIVSVDG--GSGGNGSGGSDADAIYYYDEAVLAKFQQEKPW  57

Query  221  TNDPHYFKRVKISALAL  271
            T DP+YF+RVKISALAL
Sbjct  58   TQDPNYFRRVKISALAL  74



>ref|XP_001752249.1| predicted protein [Physcomitrella patens]
 gb|EDQ82982.1| predicted protein [Physcomitrella patens]
Length=372

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 7/77 (9%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            M++ TSSA +A++TWEIENN+  M+ P       AA++ SDAIF YDE +Q+  QQ KPW
Sbjct  1    MEASTSSAMVARQTWEIENNIVAMESP-------AAASDSDAIFEYDEASQSSIQQLKPW  53

Query  221  TNDPHYFKRVKISALAL  271
              DPH+FK VKISALAL
Sbjct  54   NRDPHFFKNVKISALAL  70



>gb|AAM65053.1| putative JUN kinase activator protein [Arabidopsis thaliana]
Length=357

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LRVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV ISALAL
Sbjct  55   YFKRVHISALAL  66



>gb|AAC36344.1| AJH1 [Arabidopsis thaliana]
Length=357

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV ISALAL
Sbjct  55   YFKRVHISALAL  66



>ref|NP_973890.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 gb|AEE30310.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=351

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV ISALAL
Sbjct  55   YFKRVHISALAL  66



>ref|NP_173705.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 sp|Q8LAZ7.2|CSN5B_ARATH RecName: Full=COP9 signalosome complex subunit 5b; Short=Signalosome 
subunit 5b; AltName: Full=Jun activation domain-binding 
homolog 1 [Arabidopsis thaliana]
 gb|AAL58105.1|AF395062_1 CSN complex subunit 5B [Arabidopsis thaliana]
 gb|AAB72159.1| unknown [Arabidopsis thaliana]
 gb|AAB96974.1| JAB1 [Arabidopsis thaliana]
 gb|ABL66743.1| At1g22920 [Arabidopsis thaliana]
 gb|AEE30309.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=357

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+AIA+KTWE+ENN+  + + PT + S +       IF+YD+ +Q K QQEKPW +DP+
Sbjct  4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV ISALAL
Sbjct  55   YFKRVHISALAL  66



>ref|XP_006652935.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Oryza brachyantha]
Length=362

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 7/73 (10%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSSAA+A++TWE+ENN+ +         +AA + + DAI+ YDE AQ + QQEKPWTNDP
Sbjct  4    TSSAAMARQTWELENNIPSA-------AAAADTDALDAIYRYDEAAQARVQQEKPWTNDP  56

Query  233  HYFKRVKISALAL  271
            H+F+R +ISALAL
Sbjct  57   HHFRRARISALAL  69



>gb|KJB65954.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
 gb|KJB65955.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=277

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|KHG22386.1| COP9 signalosome complex subunit 5a -like protein [Gossypium 
arboreum]
Length=335

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+  ++ P  S+D          IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAPDPSSDF---------IFYYDEVAQAMSLKAKPWANDPHFF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|KJB65952.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
 gb|KJB65953.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=314

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|KJB65950.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=303

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+  ++ P           SSD IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAP---------DPSSDFIFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>gb|KJB65951.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=335

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 9/70 (13%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +AIAQKTWE+ENN+  ++ P  S+D          IFYYDE AQ    + KPW NDPH+F
Sbjct  3    SAIAQKTWELENNILAVEAPDPSSDF---------IFYYDEVAQAMSLKAKPWGNDPHFF  53

Query  242  KRVKISALAL  271
            KRVKISALAL
Sbjct  54   KRVKISALAL  63



>ref|XP_006382165.1| COP9 complex family protein [Populus trichocarpa]
 gb|ERP59962.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNV-ETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  217
            MD + SS+ IA+KTWE+ENN+       PT+ D++++S+SSDAIFY+DE AQ KFQ+EKP
Sbjct  1    MDPYPSSS-IAKKTWELENNIIPIDTATPTTTDTSSSSSSSDAIFYFDEAAQAKFQKEKP  59

Query  218  WTNDPHYFKRVKISALAL  271
            W+NDP+YF+RVKISALAL
Sbjct  60   WSNDPNYFRRVKISALAL  77



>ref|XP_004960128.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Setaria 
italica]
Length=361

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ AQ + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAATDPDAMDA---------IYRYDDAAQARAQQEKPWANDP  54

Query  233  HYFKRVKISALAL  271
            H+F+R KISALAL
Sbjct  55   HHFRRAKISALAL  67



>ref|NP_001054112.1| Os04g0654700 [Oryza sativa Japonica Group]
 gb|AAC33765.1| jab1 protein [Oryza sativa Indica Group]
 dbj|BAB72093.1| JUN-activation-domain-binding protein homolog [Oryza sativa]
 dbj|BAC22747.1| JUN-activation-domain-binding protein 1 [Oryza sativa Japonica 
Group]
 emb|CAE01552.2| OSJNBb0022F16.7 [Oryza sativa Japonica Group]
 dbj|BAF16026.1| Os04g0654700 [Oryza sativa Japonica Group]
 emb|CAH66701.1| OSIGBa0147J19.5 [Oryza sativa Indica Group]
Length=360

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSSAA+A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDP
Sbjct  4    TSSAAMARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDP  54

Query  233  HYFKRVKISALAL  271
            H F+R KISALAL
Sbjct  55   HPFRRAKISALAL  67



>gb|EEC78160.1| hypothetical protein OsI_17724 [Oryza sativa Indica Group]
Length=385

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSSAA+A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDP
Sbjct  4    TSSAAMARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDP  54

Query  233  HYFKRVKISALAL  271
            H F+R KISALAL
Sbjct  55   HPFRRAKISALAL  67



>tpg|DAA35639.1| TPA: hypothetical protein ZEAMMB73_882531 [Zea mays]
Length=239

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ +Q + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAASDPDAMDA---------IYRYDDASQARAQQEKPWANDP  54

Query  233  HYFKRVKISALAL  271
            H+F+R KISALAL
Sbjct  55   HHFRRTKISALAL  67



>ref|NP_001149650.1| COP9 signalosome complex subunit 5b [Zea mays]
 gb|ACF85802.1| unknown [Zea mays]
 gb|ACG36237.1| COP9 signalosome complex subunit 5b [Zea mays]
 tpg|DAA35638.1| TPA: COP9 signalosome complex subunit 5b [Zea mays]
Length=362

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSSA+IA++TWE+ENN+      P + D+         I+ YD+ +Q + QQEKPW NDP
Sbjct  4    TSSASIARQTWELENNIPAAASDPDAMDA---------IYRYDDASQARAQQEKPWANDP  54

Query  233  HYFKRVKISALAL  271
            H+F+R KISALAL
Sbjct  55   HHFRRTKISALAL  67



>ref|XP_002967006.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
 gb|EFJ31605.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
Length=373

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 9/72 (13%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            +S++IA+++WE+ENN+  M+          A++  D+I+ YDE AQ+  QQ+KPWT DPH
Sbjct  3    ASSSIARQSWELENNIVPME---------HAASGCDSIYAYDEAAQSAIQQQKPWTRDPH  53

Query  236  YFKRVKISALAL  271
            YFK VKISALAL
Sbjct  54   YFKNVKISALAL  65



>ref|XP_002961002.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
 gb|EFJ38541.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
Length=361

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 11/72 (15%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            +S++IA+++WE+ENN+  M+            A+ D+I+ YDE AQ+  QQ+KPWT DPH
Sbjct  3    ASSSIARQSWELENNIVPME-----------HAACDSIYAYDEAAQSAIQQQKPWTRDPH  51

Query  236  YFKRVKISALAL  271
            YFK VKISALAL
Sbjct  52   YFKNVKISALAL  63



>ref|XP_009103210.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brassica 
rapa]
Length=356

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 8/72 (11%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+ IA+KTWE+ENN+ T+  PP  + S         IF+YD  A  K  +EKPW  DP+
Sbjct  3    SSSTIARKTWELENNILTVK-PPADSSSDN-------IFHYDGAAHAKVLKEKPWATDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  55   YFKRVQISALAL  66



>emb|CDY25761.1| BnaA07g10210D [Brassica napus]
Length=356

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 8/72 (11%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+ IA+KTWE+ENN+ T+  PP  + S         IF+YD  A  K  +EKPW  DP+
Sbjct  3    SSSTIARKTWELENNILTVK-PPADSSSDN-------IFHYDGAAHAKVLKEKPWATDPN  54

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  55   YFKRVQISALAL  66



>emb|CDY12502.1| BnaC07g13420D [Brassica napus]
Length=353

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 8/72 (11%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+ IA+KTWE+ENN+ T+ LP  S+           IF+YD  A  K  +EK W  +P+
Sbjct  3    SSSTIARKTWELENNILTVKLPADSSSDN--------IFHYDGAAHAKVLKEKTWATNPN  54

Query  236  YFKRVKISALAL  271
            YFKRV+ISALAL
Sbjct  55   YFKRVQISALAL  66



>dbj|BAJ93853.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99562.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSS+A+A++TWE+ENN+      P + D+         I+ YDE A  +  QEKPW  DP
Sbjct  4    TSSSAVARQTWELENNIPAAASDPDAMDA---------IYRYDEAANARAHQEKPWATDP  54

Query  233  HYFKRVKISALAL  271
            H+F+R +ISALAL
Sbjct  55   HHFRRARISALAL  67



>gb|EMT09486.1| hypothetical protein F775_29820 [Aegilops tauschii]
Length=364

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSS+A+A++TWE+ENN+      P + D+         I+ YDE A  +  QEKPW  DP
Sbjct  4    TSSSAVARQTWELENNIPAAASDPDAMDA---------IYRYDEAANARAHQEKPWATDP  54

Query  233  HYFKRVKISALAL  271
            H+F+R +ISALAL
Sbjct  55   HHFRRARISALAL  67



>ref|XP_010240543.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brachypodium 
distachyon]
Length=360

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 9/73 (12%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TSS+A+A++TWE+ENN+    + P          + D ++ +DE A  +  Q+KPW NDP
Sbjct  4    TSSSAMAKQTWELENNIPAKVIDP---------EAMDEVYRFDEVANARALQQKPWANDP  54

Query  233  HYFKRVKISALAL  271
            H+++RV+ISALAL
Sbjct  55   HHYRRVRISALAL  67



>emb|CAE03401.3| OSJNBa0071I13.2 [Oryza sativa Japonica Group]
Length=377

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 9/68 (13%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            +A++TWE+ENN+      P + D+         I+ YDE AQ + QQEKPW NDPH F+R
Sbjct  1    MARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDPHPFRR  51

Query  248  VKISALAL  271
             KISALAL
Sbjct  52   AKISALAL  59



>gb|ADG37923.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37925.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37928.1| AT1G22920-like protein, partial [Neslia paniculata]
Length=53

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  167  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALAL  271
            IF+YD+ AQ K QQEKPW +DP+YFKRV+ISALAL
Sbjct  8    IFHYDDAAQAKIQQEKPWASDPNYFKRVQISALAL  42



>gb|ADG37922.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37924.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37926.1| AT1G22920-like protein, partial [Capsella grandiflora]
 gb|ADG37927.1| AT1G22920-like protein, partial [Capsella grandiflora]
Length=53

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  167  IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALAL  271
            IF+YD+ AQ K QQEKPW +DP+YFKRV+ISALAL
Sbjct  8    IFHYDDAAQAKIQQEKPWASDPNYFKRVQISALAL  42



>dbj|BAH71669.1| ACYPI006786 [Acyrthosiphon pisum]
Length=142

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 13/75 (17%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S  S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  
Sbjct  5    SRDSQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEK  51

Query  227  DPHYFKRVKISALAL  271
            DPHYFK +KISALAL
Sbjct  52   DPHYFKDIKISALAL  66



>ref|XP_008217730.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Nasonia 
vitripennis]
 ref|XP_008217737.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Nasonia 
vitripennis]
Length=358

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + IAQKTWE+ENNVET+             ++ D I+ YD   Q      KPW  DPH
Sbjct  15   SQSNIAQKTWEMENNVETI-------------STIDEIYRYDRKEQQDILAAKPWEKDPH  61

Query  236  YFKRVKISALAL  271
            +FK +KISALAL
Sbjct  62   FFKDIKISALAL  73



>ref|XP_008217721.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Nasonia 
vitripennis]
Length=366

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + IAQKTWE+ENNVET+             ++ D I+ YD   Q      KPW  DPH
Sbjct  23   SQSNIAQKTWEMENNVETI-------------STIDEIYRYDRKEQQDILAAKPWEKDPH  69

Query  236  YFKRVKISALAL  271
            +FK +KISALAL
Sbjct  70   FFKDIKISALAL  81



>gb|AAR10246.1| similar to Drosophila melanogaster CSN5, partial [Drosophila 
yakuba]
Length=185

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>gb|EIE80444.1| hypothetical protein RO3G_05149 [Rhizopus delemar RA 99-880]
Length=319

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (59%), Gaps = 12/70 (17%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A+IA K WE+ENN+ T+D               D I++YD     +   EKPW NDPH+F
Sbjct  3    ASIALKNWELENNITTVD------------PEEDKIYFYDSEQDKQNVAEKPWKNDPHHF  50

Query  242  KRVKISALAL  271
            KRVKISA AL
Sbjct  51   KRVKISATAL  60



>ref|XP_003424702.2| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nasonia 
vitripennis]
 ref|XP_008217716.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nasonia 
vitripennis]
Length=390

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + IAQKTWE+ENNVET+             ++ D I+ YD   Q      KPW  DPH
Sbjct  47   SQSNIAQKTWEMENNVETI-------------STIDEIYRYDRKEQQDILAAKPWEKDPH  93

Query  236  YFKRVKISALAL  271
            +FK +KISALAL
Sbjct  94   FFKDIKISALAL  105



>ref|XP_006956806.1| hypothetical protein WALSEDRAFT_59607 [Wallemia sebi CBS 633.66]
 gb|EIM23431.1| hypothetical protein WALSEDRAFT_59607 [Wallemia sebi CBS 633.66]
Length=348

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 16/70 (23%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +++A KT+++EN+VE +DL                I+ YDE AQ     ++PW  DPHYF
Sbjct  3    SSVAMKTFDLENDVEEVDL----------------IYTYDEDAQRDINNKRPWKQDPHYF  46

Query  242  KRVKISALAL  271
            KRVKIS +AL
Sbjct  47   KRVKISTVAL  56



>ref|XP_001990340.1| GH19288 [Drosophila grimshawi]
 gb|EDV93402.1| GH19288 [Drosophila grimshawi]
Length=327

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYFK +
Sbjct  6    AQKTWELENNIQT--LPSCDD-----------IFRYDAEQQRQIIDAKPWEKDPHYFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>ref|XP_001636625.1| predicted protein [Nematostella vectensis]
 gb|EDO44562.1| predicted protein [Nematostella vectensis]
Length=333

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +A+A K+WE+ NN+E ++               D IF YD   Q +  Q KPW  DPHYF
Sbjct  3    SAMAMKSWELANNIENVN-------------GIDEIFKYDRQQQQEILQAKPWQKDPHYF  49

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  50   KNIKISALAL  59



>gb|EPB91337.1| COP9 signalosome complex subunit 5a [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=334

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 12/70 (17%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A+ +QK WE+ENN+ T+D  PT             +++YD     +   +KPW NDPHYF
Sbjct  3    ASTSQKNWELENNIITVD--PTQDQ----------VYFYDAAQDKENVAQKPWKNDPHYF  50

Query  242  KRVKISALAL  271
            K VKISA+AL
Sbjct  51   KHVKISAIAL  60



>ref|NP_500841.1| Protein CSN-5 [Caenorhabditis elegans]
 sp|P91001.1|CSN5_CAEEL RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5; AltName: Full=JAB1 homolog [Caenorhabditis 
elegans]
 emb|CCD62206.1| CSN-5 [Caenorhabditis elegans]
Length=368

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 16/77 (21%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            +D+   S+++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDNVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNKQQVEIRNAKPW  46

Query  221  TNDPHYFKRVKISALAL  271
              DPHYFK++KISA+AL
Sbjct  47   DKDPHYFKQIKISAIAL  63



>ref|XP_009267304.1| COP9 signalosome complex subunit 5 [Wallemia ichthyophaga EXF-994]
 gb|EOR01584.1| COP9 signalosome complex subunit 5 [Wallemia ichthyophaga EXF-994]
Length=350

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 16/70 (23%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            +++A KT+E+EN+VE +D                 I+ YD+ AQ +   ++PW  DPHYF
Sbjct  3    SSVAMKTFELENDVEEID----------------QIYSYDDNAQREINNKRPWRQDPHYF  46

Query  242  KRVKISALAL  271
            KRVKIS++AL
Sbjct  47   KRVKISSVAL  56



>ref|XP_003101399.1| CRE-CSN-5 protein [Caenorhabditis remanei]
 gb|EFP07253.1| CRE-CSN-5 protein [Caenorhabditis remanei]
Length=371

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 16/77 (21%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            +D+   S ++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDNVKPSGSVPQRNWEKENNVQNVD----------------SIFEYNNQQQVEIRNAKPW  46

Query  221  TNDPHYFKRVKISALAL  271
              DPHYFK++KISA+AL
Sbjct  47   DKDPHYFKQIKISAIAL  63



>gb|AAD27862.2|AF132563_1 LD14392p, partial [Drosophila melanogaster]
Length=345

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 42/77 (55%), Gaps = 13/77 (17%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            + + T  +  AQKTWE+ENN++T  LP               IF YD   Q +    KPW
Sbjct  14   ISTITMDSDAAQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPW  60

Query  221  TNDPHYFKRVKISALAL  271
              DPH+FK +KISALAL
Sbjct  61   EKDPHFFKDIKISALAL  77



>ref|XP_011267966.1| PREDICTED: COP9 signalosome complex subunit 5 [Camponotus floridanus]
 gb|EFN60285.1| COP9 signalosome complex subunit 5 [Camponotus floridanus]
Length=346

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 13/73 (18%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            T  + IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DP
Sbjct  6    TEQSGIAQKTWELSNNIETI-------------STMDEIYRYDRKEQHDILTAKPWEKDP  52

Query  233  HYFKRVKISALAL  271
            H+FK +KISALAL
Sbjct  53   HFFKDIKISALAL  65



>ref|XP_638491.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 sp|Q54PF3.1|CSN5_DICDI RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Dictyostelium discoideum]
 gb|EAL65137.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 gb|ABC46697.1| COP9 signalosome complex subunit 5 [Dictyostelium discoideum]
Length=332

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 14/72 (19%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            + AA A KT+E+ENN++T+D               D +F YD     +F Q KPW+ DPH
Sbjct  4    NGAADALKTFELENNIQTID--------------HDQLFKYDPQQYQQFLQSKPWSKDPH  49

Query  236  YFKRVKISALAL  271
            YFK VKISA+AL
Sbjct  50   YFKHVKISAIAL  61



>ref|XP_006675144.1| hypothetical protein BATDEDRAFT_15731 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83607.1| hypothetical protein BATDEDRAFT_15731 [Batrachochytrium dendrobatidis 
JAM81]
Length=333

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS+  A+K +E+ENN++ +D             S DAIFYYD   Q + Q  +PW  DPH
Sbjct  4    SSSLSARKRFELENNIKEVD-------------SRDAIFYYDSNQQKQIQNSRPWAKDPH  50

Query  236  YFKRVKISALAL  271
            +FK++KISA+AL
Sbjct  51   HFKKIKISAVAL  62



>ref|XP_006565324.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Apis 
mellifera]
Length=358

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 13/84 (15%)
 Frame = +2

Query  20   SPRALHLMDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTK  199
            S + L++  + +  + IA+KTWE+ NN+ET+             ++ D I+ YD   Q  
Sbjct  9    SKKLLNMASTSSDQSTIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQD  55

Query  200  FQQEKPWTNDPHYFKRVKISALAL  271
                KPW  DPH+FK +KISALAL
Sbjct  56   ILAAKPWEKDPHFFKDIKISALAL  79



>ref|XP_001954897.1| GF18500 [Drosophila ananassae]
 gb|EDV43458.1| GF18500 [Drosophila ananassae]
Length=320

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A  AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+F
Sbjct  3    ADTAQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFF  49

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  50   KDIKISALAL  59



>ref|XP_002633848.1| C. briggsae CBR-CSN-5 protein [Caenorhabditis briggsae]
 emb|CAP37056.1| Protein CBR-CSN-5 [Caenorhabditis briggsae]
Length=367

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 16/77 (21%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            +D+   S ++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    IDNVKPSGSVPQRNWEKENNVQNVD----------------SIFEYNNQQQLEIRNAKPW  46

Query  221  TNDPHYFKRVKISALAL  271
              DPHYFK++KISA+AL
Sbjct  47   DKDPHYFKQIKISAIAL  63



>dbj|GAN00834.1| COP9-signalosome 5B [Mucor ambiguus]
Length=396

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 12/70 (17%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A+ +QK WE+ENN+ T+D             + D +++YD     +   +KPW NDPHYF
Sbjct  3    ASTSQKNWELENNITTVD------------PAQDQVYFYDAAQDKENVAQKPWKNDPHYF  50

Query  242  KRVKISALAL  271
            K VKISA+AL
Sbjct  51   KHVKISAIAL  60



>ref|XP_002103175.1| GD19103 [Drosophila simulans]
 gb|EDX12678.1| GD19103 [Drosophila simulans]
Length=321

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>ref|XP_001980192.1| GG17007 [Drosophila erecta]
 ref|XP_002097599.1| CSN5 [Drosophila yakuba]
 gb|EDV49150.1| GG17007 [Drosophila erecta]
 gb|EDW97311.1| CSN5 [Drosophila yakuba]
Length=327

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>ref|XP_002074130.1| GK14483 [Drosophila willistoni]
 gb|EDW85116.1| GK14483 [Drosophila willistoni]
Length=327

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>ref|NP_477442.1| COP9 complex homolog subunit 5, isoform A [Drosophila melanogaster]
 ref|XP_002041210.1| GM15160 [Drosophila sechellia]
 sp|Q9XZ58.1|CSN5_DROME RecName: Full=COP9 signalosome complex subunit 5; Short=Dch5; 
Short=Signalosome subunit 5; AltName: Full=JAB1 homolog [Drosophila 
melanogaster]
 gb|AAF55321.1| COP9 complex homolog subunit 5, isoform A [Drosophila melanogaster]
 gb|EDW44858.1| GM15160 [Drosophila sechellia]
Length=327

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>ref|XP_001359383.1| GA13321 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002017203.1| GL22178 [Drosophila persimilis]
 gb|EAL28529.1| GA13321 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW34303.1| GL22178 [Drosophila persimilis]
Length=327

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>ref|NP_001262639.1| COP9 complex homolog subunit 5, isoform B [Drosophila melanogaster]
 gb|AGB96019.1| COP9 complex homolog subunit 5, isoform B [Drosophila melanogaster]
Length=325

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>gb|AAD28608.1|AF129083_1 COP9 signalosome subunit 5 CSN5 [Drosophila melanogaster]
Length=327

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ENN++T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKTWELENNIQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>ref|XP_008185322.1| PREDICTED: COP9 complex homolog subunit 5 isoform X1 [Acyrthosiphon 
pisum]
Length=339

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  DPH
Sbjct  8    SQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEKDPH  54

Query  236  YFKRVKISALAL  271
            YFK +KISALAL
Sbjct  55   YFKDIKISALAL  66



>ref|NP_001156462.1| COP9 complex homolog subunit 5 [Acyrthosiphon pisum]
 dbj|BAH72641.1| ACYPI006786 [Acyrthosiphon pisum]
Length=339

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S   IA+KTWE+EN+V+T++             + D IF YD+  Q      KPW  DPH
Sbjct  8    SQEIIAKKTWELENSVQTVN-------------TVDDIFKYDKQQQQDILTAKPWEKDPH  54

Query  236  YFKRVKISALAL  271
            YFK +KISALAL
Sbjct  55   YFKDIKISALAL  66



>ref|XP_002422812.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
 gb|EEB10074.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
Length=332

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S  +IAQKTWE  NN+ET+             +  D I+ YD+  Q      KPW  DPH
Sbjct  9    SQCSIAQKTWEFANNIETI-------------SPIDEIYRYDKKQQQDILAAKPWDKDPH  55

Query  236  YFKRVKISALAL  271
            +FK +KISALAL
Sbjct  56   FFKDIKISALAL  67



>ref|XP_002129245.1| PREDICTED: COP9 signalosome complex subunit 5-like [Ciona intestinalis]
Length=386

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 13/74 (18%)
 Frame = +2

Query  50   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  229
             +  +++A KTWE++NN+ET+             ++ D I+ YD   Q      KPW  D
Sbjct  48   MSQGSSMAMKTWEMQNNIETV-------------SAVDEIYKYDYQGQQDMLAAKPWVKD  94

Query  230  PHYFKRVKISALAL  271
            PHYFK VKISALAL
Sbjct  95   PHYFKNVKISALAL  108



>ref|XP_003700698.1| PREDICTED: COP9 signalosome complex subunit 5-like [Megachile 
rotundata]
Length=345

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + IAQKTWE+ NNVET+             ++ D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAQKTWEMSNNVETI-------------STVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  56   KDIKISALAL  65



>gb|KDR11248.1| COP9 signalosome complex subunit 5 [Zootermopsis nevadensis]
Length=343

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ NN+ET+ +              D I+ YD   Q      KPW  DPH+FK 
Sbjct  13   IAQKTWEMANNIETISI-------------IDEIYRYDRKQQQDILAAKPWEKDPHFFKD  59

Query  248  VKISALAL  271
            +KISALAL
Sbjct  60   IKISALAL  67



>ref|XP_011502813.1| PREDICTED: COP9 signalosome complex subunit 5 [Ceratosolen solmsi 
marchali]
Length=342

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +2

Query  41   MDSFTSS-AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKP  217
            M  F+   ++IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KP
Sbjct  1    MAGFSGEQSSIAQKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKP  47

Query  218  WTNDPHYFKRVKISALAL  271
            W  DPH+FK +KISALAL
Sbjct  48   WEKDPHFFKDIKISALAL  65



>ref|XP_002056387.1| GJ10255 [Drosophila virilis]
 gb|EDW59499.1| GJ10255 [Drosophila virilis]
Length=327

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQK WE+ENN++T  LP               IF YD   Q +    KPW  DPHYFK +
Sbjct  6    AQKKWELENNIQT--LPSCDD-----------IFRYDAEQQRQIIDAKPWEKDPHYFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>emb|CEP10016.1| hypothetical protein [Parasitella parasitica]
Length=432

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 12/70 (17%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A+I+QK WE+EN++ T+D             + D +++YD     +   +KPW NDPHYF
Sbjct  130  ASISQKNWELENDIITVD------------PAQDQVYFYDAAHDKENVAQKPWKNDPHYF  177

Query  242  KRVKISALAL  271
            K VKISA+AL
Sbjct  178  KNVKISAIAL  187



>ref|XP_008485715.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
 ref|XP_008485716.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
Length=359

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 13/74 (18%)
 Frame = +2

Query  50   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  229
             +  + IAQKTW +ENN+ET+             +++D IF YD   Q      KPW  D
Sbjct  20   MSEDSQIAQKTWIMENNIETL-------------SATDEIFKYDRKRQQDMIAAKPWEKD  66

Query  230  PHYFKRVKISALAL  271
            PH+FK +KISALAL
Sbjct  67   PHFFKDIKISALAL  80



>ref|XP_008479869.1| PREDICTED: COP9 signalosome complex subunit 5-like [Diaphorina 
citri]
Length=359

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 13/74 (18%)
 Frame = +2

Query  50   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  229
             +  + IAQKTW +ENN+ET+             +++D IF YD   Q      KPW  D
Sbjct  20   MSEDSQIAQKTWIMENNIETL-------------SATDEIFKYDRKRQQDMIAAKPWEKD  66

Query  230  PHYFKRVKISALAL  271
            PH+FK +KISALAL
Sbjct  67   PHFFKDIKISALAL  80



>ref|XP_011332242.1| PREDICTED: COP9 signalosome complex subunit 5 [Cerapachys biroi]
 gb|EZA58237.1| COP9 signalosome complex subunit [Cerapachys biroi]
Length=351

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 39/76 (51%), Gaps = 19/76 (25%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVE---TMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWT  223
            T  + IAQKTWE+ NN+E   TMD                 I+ YD   Q      KPW 
Sbjct  6    TDQSTIAQKTWELSNNIEAISTMD----------------EIYRYDRKEQQDILTAKPWE  49

Query  224  NDPHYFKRVKISALAL  271
             DPH+FK +KISALAL
Sbjct  50   KDPHFFKDIKISALAL  65



>ref|XP_001862398.1| COP9 signalosome complex subunit 5 [Culex quinquefasciatus]
 gb|EDS37003.1| COP9 signalosome complex subunit 5 [Culex quinquefasciatus]
Length=426

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            + A +A+K WE+ENN+ET  LP +             IF YD   Q +    +PW  DPH
Sbjct  93   ADAEMARKNWELENNIET--LPASDE-----------IFRYDAEQQQRILAARPWEKDPH  139

Query  236  YFKRVKISALAL  271
            +FK +KISALAL
Sbjct  140  FFKDIKISALAL  151



>ref|XP_001649479.1| AAEL014747-PA [Aedes aegypti]
 ref|XP_001657987.1| AAEL001058-PA [Aedes aegypti]
 gb|EAT33001.1| AAEL014747-PA [Aedes aegypti]
 gb|EAT47818.1| AAEL001058-PA [Aedes aegypti]
Length=336

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            + + +A+K WE+ENN+ET  LP +             IF YD   Q +    +PW  DPH
Sbjct  2    ADSELARKNWELENNIET--LPASDE-----------IFRYDAEQQQRILAARPWDKDPH  48

Query  236  YFKRVKISALAL  271
            +FK +KISALAL
Sbjct  49   FFKDIKISALAL  60



>ref|NP_001138802.1| JAB-MPN domain protein [Bombyx mori]
 gb|ACM24339.1| JAB-MPN domain protein [Bombyx mori]
Length=348

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 13/75 (17%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S  S A+IAQKTW + NN+ET+             ++ D I+ YD+  Q      KPW  
Sbjct  5    SADSQASIAQKTWVMANNIETV-------------SNVDDIYRYDKKQQQDILAAKPWEK  51

Query  227  DPHYFKRVKISALAL  271
            DPH+FK +KISALAL
Sbjct  52   DPHFFKDIKISALAL  66



>ref|XP_005648133.1| Mov34-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23589.1| Mov34-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=349

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQK WE+EN+++ ++              SDA + YD   Q   Q +KPWT DPHYFK V
Sbjct  7    AQKRWELENSIQNIE-------------GSDAYYVYDGAEQQALQHQKPWTKDPHYFKHV  53

Query  251  KISALAL  271
            +ISALAL
Sbjct  54   RISALAL  60



>ref|XP_011147629.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Harpegnathos 
saltator]
Length=344

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  57

Query  248  VKISALAL  271
            +KISALAL
Sbjct  58   IKISALAL  65



>ref|XP_011147628.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Harpegnathos 
saltator]
Length=351

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  18   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  64

Query  248  VKISALAL  271
            +KISALAL
Sbjct  65   IKISALAL  72



>gb|EFN79117.1| COP9 signalosome complex subunit 5 [Harpegnathos saltator]
Length=378

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  45   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  91

Query  248  VKISALAL  271
            +KISALAL
Sbjct  92   IKISALAL  99



>gb|KFM80396.1| COP9 signalosome complex subunit 5, partial [Stegodyphus mimosarum]
Length=108

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + +AQ+TWE+ NN+E +              S D I+ YD+  Q      KPW  DPH+F
Sbjct  3    SVMAQRTWELSNNIENV-------------HSVDDIYCYDKKTQQDILTAKPWERDPHFF  49

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  50   KDIKISALAL  59



>ref|XP_011147627.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Harpegnathos 
saltator]
Length=398

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  65   IAQKTWELANNIETI-------------STIDEIYRYDRKEQQDILTAKPWEKDPHFFKD  111

Query  248  VKISALAL  271
            +KISALAL
Sbjct  112  IKISALAL  119



>ref|XP_001998673.1| GI23503 [Drosophila mojavensis]
 gb|EDW14134.1| GI23503 [Drosophila mojavensis]
Length=327

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQK WE+ENNV+T  LP               IF YD   Q +    KPW  DPH+FK +
Sbjct  6    AQKKWELENNVQT--LPSCDE-----------IFRYDAEQQRQIIDAKPWEKDPHFFKDI  52

Query  251  KISALAL  271
            KISALAL
Sbjct  53   KISALAL  59



>emb|CEJ02827.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=169

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 12/70 (17%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            AA A+K WE+ENNV T+D               D I++YD     +   +K W NDPHYF
Sbjct  3    AATARKNWELENNVTTVD------------PEQDRIYFYDAELDKQNVAQKLWKNDPHYF  50

Query  242  KRVKISALAL  271
            K VKISA+AL
Sbjct  51   KYVKISAVAL  60



>ref|XP_008548790.1| PREDICTED: COP9 signalosome complex subunit 5-like [Microplitis 
demolitor]
Length=342

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 38/73 (52%), Gaps = 19/73 (26%)
 Frame = +2

Query  62   AAIAQKTWEIENNVE---TMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            + IAQKTWE+ NNVE   TMD                 I+ YD   Q      KPW  DP
Sbjct  9    STIAQKTWEMSNNVEMISTMD----------------EIYRYDRQEQQDILAAKPWEKDP  52

Query  233  HYFKRVKISALAL  271
            H+FK +KISALAL
Sbjct  53   HFFKDIKISALAL  65



>ref|XP_011209192.1| PREDICTED: COP9 signalosome complex subunit 5 [Bactrocera dorsalis]
Length=333

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 39/70 (56%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A  ++KTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    AETSRKTWELENNIKT--LPACDE-----------IFRYDAEQQRQILDAKPWEKDPHYF  49

Query  242  KRVKISALAL  271
            K +KISAL+L
Sbjct  50   KDIKISALSL  59



>ref|XP_011182476.1| PREDICTED: COP9 signalosome complex subunit 5 [Bactrocera cucurbitae]
Length=333

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 39/70 (56%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A  ++KTWE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    AETSRKTWELENNIKT--LPACDE-----------IFRYDAEQQRQILDAKPWEKDPHYF  49

Query  242  KRVKISALAL  271
            K +KISAL+L
Sbjct  50   KDIKISALSL  59



>ref|XP_004205813.1| PREDICTED: COP9 signalosome complex subunit 5-like, partial [Hydra 
vulgaris]
Length=182

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + IAQ+T+E++N++E+++             S D I+ Y    Q +   +KPWT DPHYF
Sbjct  3    SQIAQRTFELQNSIESVN-------------SVDEIYKYSHQQQQEILNKKPWTKDPHYF  49

Query  242  KRVKISALAL  271
            K VKISALAL
Sbjct  50   KHVKISALAL  59



>dbj|GAM27607.1| hypothetical protein SAMD00019534_107830 [Acytostelium subglobosum 
LB1]
Length=341

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 14/67 (21%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A K +EIENN++++D               D+IF YD+T    F + KPW  DPHYFK V
Sbjct  10   ALKRFEIENNIQSVD--------------RDSIFKYDQTQYNDFLKSKPWAKDPHYFKTV  55

Query  251  KISALAL  271
            KISA+AL
Sbjct  56   KISAIAL  62



>gb|KID75045.1| COP9 signalosome complex subunit 5, partial [Metarhizium brunneum 
ARSEF 3297]
Length=335

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>ref|XP_007825082.1| signaling protein [Metarhizium robertsii ARSEF 23]
 gb|EFY95597.1| signaling protein [Metarhizium robertsii ARSEF 23]
 gb|EXU97339.1| JAB1/Mov34/MPN/PAD-1 ubiquitin protease domain protein [Metarhizium 
robertsii]
Length=335

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>gb|KFG82749.1| COP9 signalosome complex subunit 5 [Metarhizium anisopliae]
 gb|KID64982.1| COP9 signalosome complex subunit 5, partial [Metarhizium anisopliae 
ARSEF 549]
Length=335

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>gb|KID87397.1| COP9 signalosome complex subunit 5 [Metarhizium guizhouense ARSEF 
977]
Length=335

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>ref|XP_623836.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX2 [Apis 
mellifera]
 ref|XP_003695180.1| PREDICTED: COP9 signalosome complex subunit 5-like [Apis florea]
 ref|XP_006565325.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X4 [Apis 
mellifera]
 ref|XP_006612066.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X1 
[Apis dorsata]
 ref|XP_006612067.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X2 
[Apis dorsata]
Length=344

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  56   KDIKISALAL  65



>ref|XP_003399828.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform 2 
[Bombus terrestris]
Length=345

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  56   KDIKISALAL  65



>ref|XP_007811766.1| COP9 signalosome complex subunit 5 [Metarhizium acridum CQMa 
102]
 gb|EFY88532.1| COP9 signalosome complex subunit 5 [Metarhizium acridum CQMa 
102]
Length=335

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A K+WE++NN+E +D               DA++ YD   Q    QEKPW  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKPWARDPNHFKRV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>ref|XP_003399827.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform 1 
[Bombus terrestris]
Length=344

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  56   KDIKISALAL  65



>ref|XP_003486847.1| PREDICTED: COP9 signalosome complex subunit 5-like [Bombus impatiens]
Length=344

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + IA+KTWE+ NN+ET+             ++ D I+ YD   Q      KPW  DPH+F
Sbjct  9    STIAKKTWEMSNNIETI-------------STVDEIYRYDRKEQQDILAAKPWEKDPHFF  55

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  56   KDIKISALAL  65



>ref|XP_011292660.1| PREDICTED: COP9 signalosome complex subunit 5 [Musca domestica]
Length=334

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 39/70 (56%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A  A+++WE+ENN++T  LP               IF YD   Q +    KPW  DPHYF
Sbjct  3    ADAARRSWELENNIKT--LPACDE-----------IFRYDADQQRQILDAKPWEKDPHYF  49

Query  242  KRVKISALAL  271
            K +KISAL+L
Sbjct  50   KDIKISALSL  59



>dbj|BAE87894.1| unnamed protein product [Macaca fascicularis]
Length=136

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_011171452.1| PREDICTED: COP9 signalosome complex subunit 5 [Solenopsis invicta]
 ref|XP_011171453.1| PREDICTED: COP9 signalosome complex subunit 5 [Solenopsis invicta]
Length=346

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            ++IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+F
Sbjct  9    SSIAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFF  55

Query  242  KRVKISALAL  271
            K +KISALAL
Sbjct  56   KDIKISALAL  65



>ref|XP_005099578.1| PREDICTED: COP9 signalosome complex subunit 5-like [Aplysia californica]
Length=334

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + +A+KTWE+ NNVE++             +S D I+ YD   Q      KPW  DPHYF
Sbjct  3    SKVARKTWELTNNVESV-------------SSVDEIYRYDSKQQQDILTAKPWEKDPHYF  49

Query  242  KRVKISALAL  271
            K +K+SALAL
Sbjct  50   KHIKVSALAL  59



>gb|KFB47242.1| hypothetical protein ZHAS_00015265 [Anopheles sinensis]
Length=338

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A+KTWE+ENN+ T  LP +             IF YD   Q +    +PW  DPH+FK +
Sbjct  4    ARKTWEMENNIVT--LPASDE-----------IFRYDAEQQQRILTARPWEKDPHFFKDI  50

Query  251  KISALAL  271
            KISALAL
Sbjct  51   KISALAL  57



>emb|CEG64164.1| Putative COP9 signalosome complex subunit 5a [Rhizopus microsporus]
Length=331

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 12/70 (17%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            AA A+K WE+ENNV T+D               D I++YD         +K W NDPHYF
Sbjct  3    AATARKNWELENNVTTVD------------PEQDRIYFYDAELDKLNVAQKLWKNDPHYF  50

Query  242  KRVKISALAL  271
            K VKISA+AL
Sbjct  51   KHVKISAVAL  60



>emb|CCG82078.1| putative COP9 signalosome subunit 5 [Taphrina deformans PYCC 
5710]
Length=359

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            I Q+T+E+ENNV+ +D             ++D IF YD   Q   + + PWT DPH+F+R
Sbjct  3    IPQQTFELENNVQLLD-------------NNDRIFEYDVAEQKAIRNDAPWTRDPHFFRR  49

Query  248  VKISALAL  271
             +ISA+AL
Sbjct  50   ARISAIAL  57



>emb|CEF98127.1| JAB/MPN domain [Ostreococcus tauri]
Length=340

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  110  MDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKISALAL  271
            MD P     + A +++SD +F +D+TAQ    ++KPWT DPHYFK+VKISALAL
Sbjct  1    MDPPGPDDPATARASASDELFVFDDTAQRLVAEQKPWTRDPHYFKKVKISALAL  54



>ref|XP_011049626.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049627.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049628.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049629.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049630.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 ref|XP_011049631.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Acromyrmex 
echinatior]
 gb|EGI68489.1| COP9 signalosome complex subunit 5 [Acromyrmex echinatior]
Length=345

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  57

Query  248  VKISALAL  271
            +KISALAL
Sbjct  58   IKISALAL  65



>gb|EHL03671.1| putative COP9 signalosome complex subunit 5 [Glarea lozoyensis 
74030]
Length=291

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A KTWE++NNV+ +D               DA++ YD   Q K   +KPW +DPH+FK V
Sbjct  4    AYKTWELDNNVKLVD------------PQRDALYTYDVAEQKKINDDKPWKSDPHHFKNV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>ref|XP_011049625.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Acromyrmex 
echinatior]
Length=351

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  17   IAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  63

Query  248  VKISALAL  271
            +KISALAL
Sbjct  64   IKISALAL  71



>gb|AEE62710.1| unknown [Dendroctonus ponderosae]
 gb|ENN70355.1| hypothetical protein YQE_12863, partial [Dendroctonus ponderosae]
 gb|ERL94202.1| hypothetical protein D910_11483 [Dendroctonus ponderosae]
Length=351

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQKTWE+ NN+ET+             +S D I+ YD   Q      KPW  DPH+FK +
Sbjct  16   AQKTWELSNNMETI-------------SSVDEIYKYDRKQQQDILTAKPWDKDPHFFKDI  62

Query  251  KISALAL  271
            KISALAL
Sbjct  63   KISALAL  69



>ref|XP_011049624.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Acromyrmex 
echinatior]
Length=384

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ N +ET+             ++ D I+ YD   Q      KPW  DPH+FK 
Sbjct  50   IAQKTWELSNCIETI-------------STMDEIYRYDRKEQQDILTAKPWEKDPHFFKD  96

Query  248  VKISALAL  271
            +KISALAL
Sbjct  97   IKISALAL  104



>ref|XP_312032.5| AGAP002880-PA [Anopheles gambiae str. PEST]
 gb|EAA08009.5| AGAP002880-PA [Anopheles gambiae str. PEST]
Length=340

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            +A+KTWE+ENN+  + LPP+             IF YD   Q +    +PW  DP++FK 
Sbjct  3    MARKTWEMENNI--VVLPPSDE-----------IFRYDAEQQQRILTARPWEKDPNFFKD  49

Query  248  VKISALAL  271
            +KISALAL
Sbjct  50   IKISALAL  57



>ref|XP_007248979.1| PREDICTED: COP9 signalosome complex subunit 5 [Astyanax mexicanus]
Length=336

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            SS++IAQKTWE+ N+++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  4    SSSSIAQKTWELSNSIQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|EGT56002.1| hypothetical protein CAEBREN_15614 [Caenorhabditis brenneri]
Length=369

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 16/77 (21%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            +DS   S+++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDSVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNQQQMEIRNAKPW  46

Query  221  TNDPHYFKRVKISALAL  271
              DP+YF  +KISA+AL
Sbjct  47   DKDPNYFTNIKISAIAL  63



>gb|EGT48387.1| hypothetical protein CAEBREN_22923 [Caenorhabditis brenneri]
Length=369

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 16/77 (21%)
 Frame = +2

Query  41   MDSFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPW  220
            +DS   S+++ Q+ WE ENNV+ +D                +IF Y+   Q + +  KPW
Sbjct  3    VDSVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNQQQMEIRNAKPW  46

Query  221  TNDPHYFKRVKISALAL  271
              DP+YF  +KISA+AL
Sbjct  47   DKDPNYFTNIKISAIAL  63



>ref|XP_003712833.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae 70-15]
 gb|EHA53026.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae 70-15]
 gb|ELQ43145.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae Y34]
 gb|ELQ68262.1| COP9 signalosome complex subunit 5 [Magnaporthe oryzae P131]
Length=344

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 12/68 (18%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            +A K+WE++NNV+ +D  P+             ++ YD  +Q    Q++PW  DP+YFK 
Sbjct  3    VAMKSWELDNNVKLVD--PSRDA----------LYNYDAESQKAINQQRPWAKDPNYFKS  50

Query  248  VKISALAL  271
            V+ISA+AL
Sbjct  51   VRISAIAL  58



>ref|XP_003292126.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
 gb|EGC31350.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
Length=332

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 14/74 (19%)
 Frame = +2

Query  50   FTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTND  229
             +  +A A K +E+ENNV+T+D               D++F YD     +F   KPW  D
Sbjct  1    MSKGSADALKRFELENNVQTID--------------HDSLFKYDAQQYQQFLSSKPWAKD  46

Query  230  PHYFKRVKISALAL  271
            PHYFK VKISA+AL
Sbjct  47   PHYFKHVKISAIAL  60



>ref|XP_002408598.1| COP9 signalosome, subunit CSN5, putative [Ixodes scapularis]
 gb|EEC10694.1| COP9 signalosome, subunit CSN5, putative [Ixodes scapularis]
Length=257

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            +AQKTWE+ NNVET+              S D ++ Y++  Q      KPW  DPHYFK 
Sbjct  5    MAQKTWELSNNVETIQ-------------SVDDLYKYNKKQQQDILTAKPWEKDPHYFKD  51

Query  248  VKISALAL  271
            +K+SALAL
Sbjct  52   MKVSALAL  59



>dbj|BAN21083.1| jun activation domain binding protein [Riptortus pedestris]
Length=342

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            + A++AQ+TWE+ NN+ET+             +  D I+ YD   Q      KPW  DPH
Sbjct  8    TQASMAQQTWEMSNNIETI-------------SPIDEIYRYDRKQQQDILNAKPWEKDPH  54

Query  236  YFKRVKISALAL  271
            +F  +KISALAL
Sbjct  55   FFTDIKISALAL  66



>ref|XP_001249856.5| PREDICTED: COP9 signalosome complex subunit 5-like [Bos taurus]
Length=220

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSVDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|ETN63713.1| jun activation domain binding protein [Anopheles darlingi]
Length=338

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            +A+K WE+ENN+ T  LP +             IF YD   Q +    +PW  DPH+FK 
Sbjct  3    MARKNWELENNIVT--LPASDE-----------IFRYDAEQQQRILTARPWEKDPHFFKD  49

Query  248  VKISALAL  271
            +KISALAL
Sbjct  50   IKISALAL  57



>gb|ADP30958.1| COP9 constitutive photomorphogenic-like protein subunit 5 [Penaeus 
monodon]
Length=351

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 13/75 (17%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S  + + IAQ+ WE+ NN+E  +             ++D I+ YD   Q    Q KPW  
Sbjct  11   SKMNQSQIAQRMWEMANNMEYYN-------------AADEIYQYDRKQQQDILQAKPWEK  57

Query  227  DPHYFKRVKISALAL  271
            DPH+FK++KISALAL
Sbjct  58   DPHFFKQIKISALAL  72



>ref|XP_003408260.1| PREDICTED: COP9 signalosome complex subunit 5 [Loxodonta africana]
 dbj|BAE21497.1| unnamed protein product [Mus musculus]
Length=220

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_007914606.1| putative cop9 signalosome complex subunit 5 protein [Togninia 
minima UCRPA7]
 gb|EOO00631.1| putative cop9 signalosome complex subunit 5 protein [Togninia 
minima UCRPA7]
Length=349

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQK+WE+ENNV+ +D  PT             ++ YD  +Q   + +KPW  DP+YF+ V
Sbjct  5    AQKSWELENNVKLVD--PTRDS----------LYGYDPESQKDIRAKKPWRTDPNYFRTV  52

Query  251  KISALAL  271
            +ISA+AL
Sbjct  53   RISAVAL  59



>gb|ACN61634.1| COP9 signalosome subunit 5 [Megaderma lyra]
Length=116

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 39/70 (56%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D HYF
Sbjct  1    SGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHHYF  47

Query  242  KRVKISALAL  271
            K  KISALAL
Sbjct  48   KYCKISALAL  57



>ref|XP_007885051.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callorhinchus 
milii]
Length=336

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            +S  IAQKTWE+ NN++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  4    ASGNIAQKTWELANNMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_008083662.1| JAB1/MPN [Glarea lozoyensis ATCC 20868]
 gb|EPE29553.1| JAB1/MPN [Glarea lozoyensis ATCC 20868]
Length=345

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A KTWE++NNV+ +D               DA++ YD   Q K   +KPW +DPH+FK V
Sbjct  4    AYKTWELDNNVKLVD------------PQRDALYTYDVAEQKKINDDKPWKSDPHHFKNV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>ref|XP_005663091.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Sus 
scrofa]
Length=358

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  93   SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  139

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  140  YFKYCKISALAL  151



>ref|XP_972769.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198243.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198244.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 gb|EFA09688.1| hypothetical protein TcasGA2_TC011816 [Tribolium castaneum]
Length=344

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQKTWE+ N VE ++             S D I+ YD+  Q      KPW  DPH+FK 
Sbjct  13   IAQKTWEMANKVELVN-------------SVDDIYRYDKKQQQDILAAKPWEKDPHFFKD  59

Query  248  VKISALAL  271
            +KISALAL
Sbjct  60   IKISALAL  67



>dbj|BAM18530.1| COP9 complex homolog subunit 5 [Papilio xuthus]
Length=348

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 13/75 (17%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S  S +  AQKTW + NN+ET+             +S D I+ YD+  Q      KPW  
Sbjct  5    SADSQSTTAQKTWVMANNIETV-------------SSVDEIYRYDKKQQQDILAAKPWEK  51

Query  227  DPHYFKRVKISALAL  271
            DPH+FK +KISALAL
Sbjct  52   DPHFFKDIKISALAL  66



>ref|XP_004354957.1| Mov34/MPN/PAD-1 family protein [Dictyostelium fasciculatum]
 gb|EGG16557.1| Mov34/MPN/PAD-1 family protein [Dictyostelium fasciculatum]
Length=372

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 14/72 (19%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            ++AA A K +E+ENN++ +D               D++F Y+E    +F   KPW  DPH
Sbjct  2    ANAADALKRFEVENNIQQVD--------------HDSLFKYNEVQYKQFLDAKPWAKDPH  47

Query  236  YFKRVKISALAL  271
            YFK VKISA+AL
Sbjct  48   YFKHVKISAIAL  59



>gb|KJB06586.1| hypothetical protein B456_001G001700 [Gossypium raimondii]
Length=182

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  176  YDETAQTKFQQEKPWTNDPHYFKRVKISALAL  271
            YDETA  KFQQ KP  ND HYFKRVKI ALAL
Sbjct  21   YDETALAKFQQGKPSANDHHYFKRVKIFALAL  52



>emb|CDP99135.1| Protein BM-CSN-5, isoform b [Brugia malayi]
Length=355

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 16/75 (21%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  227  DPHYFKRVKISALAL  271
            DPHYF+ +KI+ALAL
Sbjct  57   DPHYFREIKIAALAL  71



>ref|XP_001900779.1| COP9 signalosome complex subunit 5 [Brugia malayi]
Length=331

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 16/75 (21%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  227  DPHYFKRVKISALAL  271
            DPHYF+ +KI+ALAL
Sbjct  57   DPHYFREIKIAALAL  71



>emb|CDP99134.1| Protein BM-CSN-5, isoform d [Brugia malayi]
Length=357

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 16/75 (21%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S +++ +IA + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  13   SMSTATSIAFRNWQMSNNIESLE----------------TIYRYDSAEQQAIRAVKPWEK  56

Query  227  DPHYFKRVKISALAL  271
            DPHYF+ +KI+ALAL
Sbjct  57   DPHYFREIKIAALAL  71



>ref|XP_004588161.1| PREDICTED: COP9 signalosome complex subunit 5 [Ochotona princeps]
Length=299

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------ETQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_004773046.1| PREDICTED: COP9 signalosome complex subunit 5 [Mustela putorius 
furo]
Length=302

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_006815652.1| PREDICTED: COP9 signalosome complex subunit 5-like, partial [Saccoglossus 
kowalevskii]
Length=284

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 13/71 (18%)
 Frame = +2

Query  59   SAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHY  238
            ++ +A KTWE+ NN+ET+              S D I+ YD+  Q +    KPWT D HY
Sbjct  2    ASKMAAKTWELSNNMETVQ-------------SVDEIYKYDKKQQQEILAAKPWTKDNHY  48

Query  239  FKRVKISALAL  271
            FK  KISALAL
Sbjct  49   FKYCKISALAL  59



>ref|XP_008106749.1| PREDICTED: COP9 signalosome complex subunit 5 [Anolis carolinensis]
Length=343

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 40/73 (55%), Gaps = 13/73 (18%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            + S+ +AQKTWE+ NN++              + S D I+ YD   Q +    KPWT D 
Sbjct  12   SGSSGMAQKTWELANNMQ-------------EAQSIDEIYKYDRKQQQEILAAKPWTKDH  58

Query  233  HYFKRVKISALAL  271
            HYFK  KISALAL
Sbjct  59   HYFKYCKISALAL  71



>gb|ELR58372.1| COP9 signalosome complex subunit 5, partial [Bos mutus]
Length=337

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  7    SGSGMAQKTWELANNMQ-------------EAQSVDEIYKYDKKQQQEILAAKPWTKDHH  53

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  54   YFKYCKISALAL  65



>ref|XP_006150523.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Tupaia 
chinensis]
Length=320

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|NP_001179068.1| COP9 signalosome complex subunit 5 [Bos taurus]
 ref|XP_004011770.1| PREDICTED: COP9 signalosome complex subunit 5 [Ovis aries]
 ref|XP_005689095.1| PREDICTED: COP9 signalosome complex subunit 5 [Capra hircus]
 ref|XP_005892993.1| PREDICTED: COP9 signalosome complex subunit 5 [Bos mutus]
 ref|XP_005977667.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_010846758.1| PREDICTED: COP9 signalosome complex subunit 5 [Bison bison bison]
 tpg|DAA22731.1| TPA: COP9 signalosome subunit 5-like [Bos taurus]
Length=334

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSVDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_006860136.1| PREDICTED: COP9 signalosome complex subunit 5 [Chrysochloris 
asiatica]
Length=307

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELTNNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|ACO14355.1| COP9 signalosome complex subunit 5 [Esox lucius]
Length=186

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            + +++AQKTWE++N+++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  2    AGSSMAQKTWELQNSMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  48

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  49   YFKYCKISALAL  60



>gb|AAB16847.1| Jun activation domain binding protein [Homo sapiens]
Length=334

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_007634273.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Cricetulus 
griseus]
Length=421

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  91   SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  137

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  138  YFKYCKISALAL  149



>ref|XP_005066755.1| PREDICTED: COP9 signalosome complex subunit 5 [Mesocricetus auratus]
Length=400

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_006752490.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome subunit 5 [Leptonychotes 
weddellii]
Length=334

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|NP_006828.2| COP9 signalosome complex subunit 5 [Homo sapiens]
 ref|NP_001247609.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 ref|XP_001162723.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pan 
troglodytes]
 ref|XP_002710500.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Oryctolagus 
cuniculus]
 ref|XP_002759014.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callithrix 
jacchus]
 ref|XP_002916425.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_003274847.1| PREDICTED: COP9 signalosome complex subunit 5 [Nomascus leucogenys]
 ref|XP_003480111.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Cavia 
porcellus]
 ref|XP_002819198.2| PREDICTED: COP9 signalosome complex subunit 5 [Pongo abelii]
 ref|XP_003797297.1| PREDICTED: COP9 signalosome complex subunit 5 [Otolemur garnettii]
 ref|XP_003942946.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_003999915.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Felis 
catus]
 ref|XP_004275000.1| PREDICTED: COP9 signalosome complex subunit 5 [Orcinus orca]
 ref|XP_004310611.1| PREDICTED: COP9 signalosome complex subunit 5 [Tursiops truncatus]
 ref|XP_004372600.1| PREDICTED: COP9 signalosome complex subunit 5 [Trichechus manatus 
latirostris]
 ref|XP_004402339.1| PREDICTED: COP9 signalosome complex subunit 5 [Odobenus rosmarus 
divergens]
 ref|XP_004436312.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004436313.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004481161.1| PREDICTED: COP9 signalosome complex subunit 5 [Dasypus novemcinctus]
 ref|XP_004814145.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Mustela 
putorius furo]
 ref|XP_005322997.1| PREDICTED: COP9 signalosome complex subunit 5 [Ictidomys tridecemlineatus]
 ref|XP_005392180.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005563538.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Macaca 
fascicularis]
 ref|XP_006193800.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus ferus]
 ref|XP_006204770.1| PREDICTED: COP9 signalosome complex subunit 5 [Vicugna pacos]
 ref|XP_006150522.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Tupaia 
chinensis]
 ref|XP_006880503.1| PREDICTED: COP9 signalosome complex subunit 5 [Elephantulus edwardii]
 ref|XP_006924076.1| PREDICTED: COP9 signalosome complex subunit 5 [Pteropus alecto]
 ref|XP_007080736.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007130932.1| PREDICTED: COP9 signalosome complex subunit 5 [Physeter catodon]
 ref|XP_007185082.1| PREDICTED: COP9 signalosome complex subunit 5 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007448551.1| PREDICTED: COP9 signalosome complex subunit 5 [Lipotes vexillifer]
 ref|XP_007998988.1| PREDICTED: COP9 signalosome complex subunit 5 [Chlorocebus sabaeus]
 ref|XP_008565068.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Galeopterus 
variegatus]
 ref|XP_008704972.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ursus 
maritimus]
 ref|XP_009211402.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_009211403.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_010369895.1| PREDICTED: COP9 signalosome complex subunit 5 [Rhinopithecus 
roxellana]
 ref|XP_010609774.1| PREDICTED: COP9 signalosome complex subunit 5 [Fukomys damarensis]
 ref|XP_010968931.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus bactrianus]
 ref|XP_010987306.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Camelus 
dromedarius]
 ref|XP_011362917.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pteropus 
vampyrus]
 sp|Q92905.4|CSN5_HUMAN RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1 [Homo sapiens]
 pdb|4D10|E Chain E, Crystal Structure Of The Cop9 Signalosome
 pdb|4D10|M Chain M, Crystal Structure Of The Cop9 Signalosome
 gb|AAH01187.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH01859.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH07272.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 emb|CAG46479.1| COPS5 [Homo sapiens]
 gb|EAW86928.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86929.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86931.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 dbj|BAG73052.1| COP9 constitutive photomorphogenic homolog subunit 5 [synthetic 
construct]
 gb|EFB14348.1| hypothetical protein PANDA_004498 [Ailuropoda melanoleuca]
 gb|ADZ15656.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[synthetic construct]
 gb|EHH28550.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 gb|EHH64214.1| COP9 signalosome complex subunit 5 [Macaca fascicularis]
 gb|AFV41219.1| c-Jun activation domain binding protein-1 [Sus scrofa]
 gb|ELK02355.1| COP9 signalosome complex subunit 5 [Pteropus alecto]
 gb|AIC50780.1| COPS5, partial [synthetic construct]
Length=334

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_008148613.1| PREDICTED: COP9 signalosome complex subunit 5 [Eptesicus fuscus]
Length=299

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSCMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|AAX37104.1| COP9 constitutive photomorphogenic-like subunit 5 [synthetic 
construct]
Length=335

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_001494265.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Equus 
caballus]
 ref|XP_008524909.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Equus 
przewalskii]
Length=334

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_004602468.1| PREDICTED: COP9 signalosome complex subunit 5 [Sorex araneus]
Length=334

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|NP_038743.1| COP9 signalosome complex subunit 5 isoform 1 [Mus musculus]
 ref|XP_005361944.1| PREDICTED: COP9 signalosome complex subunit 5 [Microtus ochrogaster]
 ref|XP_006974748.1| PREDICTED: COP9 signalosome complex subunit 5 [Peromyscus maniculatus 
bairdii]
 ref|XP_008852994.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nannospalax 
galili]
 sp|O35864.3|CSN5_MOUSE RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1; AltName: Full=Kip1 C-terminus-interacting 
protein 2 [Mus musculus]
 gb|AAF61318.1|AF068223_1 Kip1 C-terminus interacting protein-2 [Mus musculus]
 gb|AAD03470.1| 38 kDa Mov34 homolog [Mus musculus]
 gb|AAC17179.1| Jun coactivator Jab1 [Mus musculus]
 dbj|BAB28282.1| unnamed protein product [Mus musculus]
 gb|AAH46753.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Mus musculus]
 dbj|BAE30445.1| unnamed protein product [Mus musculus]
 dbj|BAE27030.1| unnamed protein product [Mus musculus]
 gb|EDL14298.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana), isoform CRA_a [Mus musculus]
Length=334

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_003831400.1| PREDICTED: COP9 signalosome complex subunit 5 [Pan paniscus]
Length=334

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_535093.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Canis 
lupus familiaris]
 ref|XP_004653361.1| PREDICTED: COP9 signalosome complex subunit 5 [Jaculus jaculus]
 ref|XP_005638087.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Canis 
lupus familiaris]
 ref|XP_007947907.1| PREDICTED: COP9 signalosome complex subunit 5 [Orycteropus afer 
afer]
Length=334

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_007651216.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Cricetulus 
griseus]
Length=389

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  59   SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  105

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  106  YFKYCKISALAL  117



>gb|AAP36860.1| Homo sapiens COP9 constitutive photomorphogenic homolog subunit 
5 (Arabidopsis) [synthetic construct]
 gb|AAX29363.1| COP9 constitutive photomorphogenic-like subunit 5, partial [synthetic 
construct]
Length=335

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|NP_001020866.1| COP9 signalosome complex subunit 5 [Rattus norvegicus]
 gb|AAH98736.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Rattus norvegicus]
 gb|EDM11550.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Rattus norvegicus]
Length=334

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_002609973.1| hypothetical protein BRAFLDRAFT_124393 [Branchiostoma floridae]
 gb|EEN65983.1| hypothetical protein BRAFLDRAFT_124393 [Branchiostoma floridae]
Length=168

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 13/70 (19%)
 Frame = +2

Query  62   AAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYF  241
            A +AQKTWE+ N +ET+              S D I+ YD+  Q +    KPWT D HYF
Sbjct  3    AKMAQKTWELANQMETVS-------------SVDEIYKYDKRQQQEILAAKPWTRDNHYF  49

Query  242  KRVKISALAL  271
            K  K SALAL
Sbjct  50   KYCKXSALAL  59



>ref|XP_008072512.1| PREDICTED: COP9 signalosome complex subunit 5 [Tarsius syrichta]
Length=390

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  60   SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  106

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  107  YFKYCKISALAL  118



>ref|XP_006069586.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Bubalus 
bubalis]
Length=404

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  74   SGSGMAQKTWELANNMQ-------------EAQSVDEIYKYDKKQQQEILAAKPWTKDHH  120

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  121  YFKYCKISALAL  132



>ref|XP_004679877.1| PREDICTED: COP9 signalosome complex subunit 5 [Condylura cristata]
Length=334

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD   Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDRKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|KID97652.1| COP9 signalosome complex subunit 5, partial [Metarhizium majus 
ARSEF 297]
Length=335

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 12/67 (18%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            A K+WE++NN+E +D               DA++ YD   Q    QEK W  DP++FKRV
Sbjct  4    ALKSWELDNNIELVD------------PKRDALYNYDAQGQKSINQEKSWARDPNHFKRV  51

Query  251  KISALAL  271
            +ISA+AL
Sbjct  52   RISAVAL  58



>gb|EJW89035.1| JAB-MPN domain-containing protein [Wuchereria bancrofti]
Length=322

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (55%), Gaps = 16/75 (21%)
 Frame = +2

Query  47   SFTSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTN  226
            S +++ ++A + W++ NN+E+++                 I+ YD   Q   +  KPW  
Sbjct  4    SMSTATSVAFRNWQMSNNIESLE----------------TIYQYDSAEQQAIRAVKPWEK  47

Query  227  DPHYFKRVKISALAL  271
            DPHYF+ +KI+ALAL
Sbjct  48   DPHYFREIKIAALAL  62



>ref|XP_007527171.1| PREDICTED: COP9 signalosome complex subunit 5 [Erinaceus europaeus]
Length=334

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S +++AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSSMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|XP_007429682.1| PREDICTED: COP9 signalosome complex subunit 5 [Python bivittatus]
Length=337

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD   Q +    KPWT D H
Sbjct  7    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDRKQQQEILAAKPWTKDHH  53

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  54   YFKYCKISALAL  65



>ref|XP_006069587.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Bubalus 
bubalis]
Length=328

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 40/73 (55%), Gaps = 13/73 (18%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
             S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D 
Sbjct  73   ASGSGMAQKTWELANNMQE-------------AQSVDEIYKYDKKQQQEILAAKPWTKDH  119

Query  233  HYFKRVKISALAL  271
            HYFK  KISALAL
Sbjct  120  HYFKYCKISALAL  132



>gb|KFO20318.1| COP9 signalosome complex subunit 5 [Fukomys damarensis]
Length=580

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|AET43978.1| COP9 signalosome subunit 5, partial [Reishia clavigera]
Length=334

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 38/67 (57%), Gaps = 13/67 (19%)
 Frame = +2

Query  71   AQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRV  250
            AQK+W + NNVE++             +S+D I+ YD   Q      KPW  DPHYFK +
Sbjct  3    AQKSWTLSNNVESV-------------SSADEIYRYDAKQQQDILLAKPWEKDPHYFKHI  49

Query  251  KISALAL  271
            KISALAL
Sbjct  50   KISALAL  56



>ref|XP_004638141.1| PREDICTED: COP9 signalosome complex subunit 5-like [Octodon degus]
Length=334

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 38/72 (53%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN +              + S   I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNTQ-------------EAQSIIEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|EPY74001.1| COP9 signalosome complex subunit 5 isoform 1 [Camelus ferus]
Length=523

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>gb|ESZ94555.1| COP9 signalosome complex subunit 5 [Sclerotinia borealis F-4157]
Length=347

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 12/65 (18%)
 Frame = +2

Query  77   KTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKRVKI  256
            KTWE++NNV+ +D            A+ DA++ YD   Q   Q  KPW  DPH+FK V+I
Sbjct  6    KTWELDNNVQLVD------------ANRDALYTYDPEEQKAIQDAKPWKTDPHHFKNVRI  53

Query  257  SALAL  271
            SA+AL
Sbjct  54   SAVAL  58



>ref|XP_005866406.1| PREDICTED: COP9 signalosome complex subunit 5 [Myotis brandtii]
 gb|EPQ07861.1| COP9 signalosome complex subunit 5 [Myotis brandtii]
Length=334

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  4    SGSGMAQKTWELVNNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  51   YFKYCKISALAL  62



>ref|NP_001086291.1| COP9 signalosome complex subunit 5 [Xenopus laevis]
 sp|Q6GLM9.1|CSN5_XENLA RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Xenopus laevis]
 gb|AAH74434.1| MGC84682 protein [Xenopus laevis]
Length=332

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            + +++AQKTWE+ NN++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  2    AGSSVAQKTWELSNNMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  48

Query  236  YFKRVKISALAL  271
            YFK  K+SALAL
Sbjct  49   YFKYCKVSALAL  60



>ref|NP_989109.1| COP9 signalosome complex subunit 5 [Xenopus (Silurana) tropicalis]
 sp|Q6P635.1|CSN5_XENTR RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Xenopus (Silurana) tropicalis]
 gb|AAH62499.1| COP9 signalosome subunit 5 [Xenopus (Silurana) tropicalis]
 emb|CAJ82897.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Xenopus (Silurana) tropicalis]
Length=334

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            + +++AQKTWE+ NN++ +              S D I+ YD+  Q +    KPWT D H
Sbjct  4    AGSSVAQKTWELSNNMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH  50

Query  236  YFKRVKISALAL  271
            YFK  K+SALAL
Sbjct  51   YFKYCKVSALAL  62



>gb|ELW64697.1| COP9 signalosome complex subunit 5 [Tupaia chinensis]
Length=477

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 13/72 (18%)
 Frame = +2

Query  56   SSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPH  235
            S + +AQKTWE+ NN++              + S D I+ YD+  Q +    KPWT D H
Sbjct  147  SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKDHH  193

Query  236  YFKRVKISALAL  271
            YFK  KISALAL
Sbjct  194  YFKYCKISALAL  205



>ref|XP_006131545.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pelodiscus 
sinensis]
Length=337

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 13/73 (18%)
 Frame = +2

Query  53   TSSAAIAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDP  232
            TS + +AQK+WE+ NN++              + S D I+ YD   Q +    KPWT D 
Sbjct  6    TSGSGMAQKSWELANNMQ-------------EAQSIDEIYKYDRKQQQEILAAKPWTKDN  52

Query  233  HYFKRVKISALAL  271
            HYF+  KISALAL
Sbjct  53   HYFRYCKISALAL  65



>ref|XP_011297758.1| PREDICTED: COP9 signalosome complex subunit 5 [Fopius arisanus]
Length=343

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 13/68 (19%)
 Frame = +2

Query  68   IAQKTWEIENNVETMDLPPTsadsaaasassdaIFYYDETAQTKFQQEKPWTNDPHYFKR  247
            IAQ+ WE+ N+VET+              S D I+ YD   Q      KPW  DPH+FK 
Sbjct  11   IAQRMWEMTNDVETIS-------------SVDEIYRYDHQEQQSILAAKPWEKDPHFFKD  57

Query  248  VKISALAL  271
            +KISALAL
Sbjct  58   IKISALAL  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563612653200