BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014F16

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         228   7e-69   Nicotiana tomentosiformis
ref|XP_009798650.1|  PREDICTED: serine carboxypeptidase-like 42 i...    224   9e-68   Nicotiana sylvestris
ref|XP_004237734.1|  PREDICTED: serine carboxypeptidase-like 42         222   9e-67   Solanum lycopersicum
ref|XP_007019399.1|  Serine carboxypeptidase-like 42 isoform 3          220   3e-66   
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2          220   3e-66   
ref|XP_006356286.1|  PREDICTED: serine carboxypeptidase-like 42-like    220   4e-66   Solanum tuberosum [potatoes]
ref|XP_006434390.1|  hypothetical protein CICLE_v10000998mg             216   5e-66   
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          220   6e-66   
gb|KDO83625.1|  hypothetical protein CISIN_1g0117641mg                  216   7e-66   Citrus sinensis [apfelsine]
gb|KDO83623.1|  hypothetical protein CISIN_1g0117641mg                  216   1e-65   Citrus sinensis [apfelsine]
gb|KDO83622.1|  hypothetical protein CISIN_1g0117641mg                  216   4e-65   Citrus sinensis [apfelsine]
gb|KDO83613.1|  hypothetical protein CISIN_1g0117641mg                  216   4e-65   Citrus sinensis [apfelsine]
ref|XP_006434389.1|  hypothetical protein CICLE_v10000998mg             216   8e-65   
gb|KDO83614.1|  hypothetical protein CISIN_1g0117641mg                  216   9e-65   Citrus sinensis [apfelsine]
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             216   2e-64   Citrus clementina [clementine]
ref|XP_004171434.1|  PREDICTED: serine carboxypeptidase-like 42-like    207   3e-64   
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    214   1e-63   Vitis vinifera
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    214   2e-63   
ref|XP_007161487.1|  hypothetical protein PHAVU_001G0732001g            203   1e-62   Phaseolus vulgaris [French bean]
ref|XP_007201403.1|  hypothetical protein PRUPE_ppa008027mg             207   2e-62   
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         209   6e-62   Sesamum indicum [beniseed]
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg             209   7e-62   Eutrema salsugineum [saltwater cress]
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         209   7e-62   Pyrus x bretschneideri [bai li]
gb|KHN05260.1|  Serine carboxypeptidase-like 42                         209   1e-61   Glycine soja [wild soybean]
ref|XP_003544740.2|  PREDICTED: serine carboxypeptidase-like 42-l...    209   1e-61   Glycine max [soybeans]
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         208   2e-61   Elaeis guineensis
emb|CDX80725.1|  BnaC08g05590D                                          208   2e-61   
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         208   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         208   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008237677.1|  PREDICTED: serine carboxypeptidase-like 42         207   3e-61   Prunus mume [ume]
gb|EYU17411.1|  hypothetical protein MIMGU_mgv1a005783mg                207   4e-61   Erythranthe guttata [common monkey flower]
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...    207   4e-61   Cucumis melo [Oriental melon]
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    207   4e-61   Nelumbo nucifera [Indian lotus]
gb|KGN44500.1|  hypothetical protein Csa_7G319000                       207   5e-61   Cucumis sativus [cucumbers]
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42         206   8e-61   Pyrus x bretschneideri [bai li]
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    207   8e-61   
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         206   1e-60   
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...    205   1e-60   
gb|KJB59374.1|  hypothetical protein B456_009G252300                    206   2e-60   Gossypium raimondii
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         206   2e-60   Gossypium arboreum [tree cotton]
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...    205   2e-60   Brassica rapa
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         205   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         205   3e-60   Pyrus x bretschneideri [bai li]
emb|CDP12019.1|  unnamed protein product                                205   3e-60   Coffea canephora [robusta coffee]
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000               205   3e-60   Arabis alpina [alpine rockcress]
emb|CDY48945.1|  BnaA08g04690D                                          205   3e-60   Brassica napus [oilseed rape]
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...    205   3e-60   Brassica rapa
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         205   3e-60   Nicotiana tomentosiformis
emb|CDY70042.1|  BnaCnng66490D                                          204   6e-60   Brassica napus [oilseed rape]
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42         204   7e-60   Fragaria vesca subsp. vesca
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         204   8e-60   Sesamum indicum [beniseed]
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         204   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010493597.1|  PREDICTED: serine carboxypeptidase-like 42         202   2e-59   Camelina sativa [gold-of-pleasure]
emb|CDX93108.1|  BnaA03g38300D                                          202   2e-59   
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44         203   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42         202   2e-59   
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    202   2e-59   Solanum tuberosum [potatoes]
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    202   3e-59   Glycine max [soybeans]
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         202   3e-59   
ref|XP_009767156.1|  PREDICTED: serine carboxypeptidase-like 42 i...    202   3e-59   Nicotiana sylvestris
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         202   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_010482006.1|  PREDICTED: serine carboxypeptidase-like 42         202   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         202   6e-59   Eucalyptus grandis [rose gum]
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    201   7e-59   Nicotiana sylvestris
ref|XP_010442147.1|  PREDICTED: serine carboxypeptidase-like 42         201   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_004502581.1|  PREDICTED: serine carboxypeptidase-like 42-like    201   8e-59   Cicer arietinum [garbanzo]
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg             201   1e-58   
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...    200   1e-58   Brassica rapa
ref|NP_175046.1|  serine carboxypeptidase-like 44                       201   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280410.1|  hypothetical protein CARUB_v10026343mg             201   1e-58   Capsella rubella
ref|XP_002268397.1|  PREDICTED: serine carboxypeptidase-like 42         201   1e-58   Vitis vinifera
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         200   2e-58   Brassica rapa
gb|KDP43043.1|  hypothetical protein JCGZ_25229                         201   2e-58   Jatropha curcas
ref|XP_002891272.1|  predicted protein                                  200   3e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like    199   3e-58   Cicer arietinum [garbanzo]
ref|NP_199039.1|  serine carboxypeptidase-like 42                       199   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42-like    199   6e-58   Cucumis sativus [cucumbers]
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42         199   6e-58   Tarenaya hassleriana [spider flower]
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         198   7e-58   Glycine soja [wild soybean]
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    199   7e-58   Cicer arietinum [garbanzo]
ref|XP_010315079.1|  PREDICTED: serine carboxypeptidase-like 42 i...    195   8e-58   
ref|XP_010315078.1|  PREDICTED: serine carboxypeptidase-like 42 i...    195   8e-58   
ref|XP_003602149.1|  Serine carboxypeptidase-like protein               198   9e-58   Medicago truncatula
ref|XP_002865546.1|  hypothetical protein ARALYDRAFT_494806             198   9e-58   
emb|CDY51660.1|  BnaC03g66990D                                          197   1e-57   Brassica napus [oilseed rape]
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    198   1e-57   Glycine max [soybeans]
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...    199   1e-57   
ref|XP_010110480.1|  Serine carboxypeptidase-like 42                    197   1e-57   
ref|XP_006596272.1|  PREDICTED: serine carboxypeptidase-like 42-l...    197   3e-57   Glycine max [soybeans]
emb|CDY37202.1|  BnaA09g08230D                                          196   4e-57   Brassica napus [oilseed rape]
emb|CDY23340.1|  BnaA08g12060D                                          197   4e-57   Brassica napus [oilseed rape]
ref|XP_009406489.1|  PREDICTED: serine carboxypeptidase-like 42         196   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009112251.1|  PREDICTED: serine carboxypeptidase-like 42         196   5e-57   Brassica rapa
ref|XP_002526159.1|  serine carboxypeptidase, putative                  196   7e-57   
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42         196   8e-57   Brassica rapa
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             196   9e-57   Phaseolus vulgaris [French bean]
gb|ADE76785.1|  unknown                                                 189   1e-56   Picea sitchensis
ref|XP_002865553.1|  hypothetical protein ARALYDRAFT_494807             196   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    196   1e-56   Solanum lycopersicum
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    196   1e-56   Solanum lycopersicum
ref|NP_001183841.1|  hypothetical protein precursor                     195   1e-56   Zea mays [maize]
ref|NP_199038.1|  serine carboxypeptidase-like 41                       195   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    196   1e-56   Populus euphratica
ref|XP_006299245.1|  hypothetical protein CARUB_v10015394mg             195   1e-56   
ref|XP_006383613.1|  hypothetical protein POPTR_0005s21010g             191   3e-56   
ref|NP_178937.2|  serine carboxypeptidase-like 43                       194   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461496.1|  PREDICTED: serine carboxypeptidase-like 42 i...    194   3e-56   Cucumis melo [Oriental melon]
ref|XP_010425083.1|  PREDICTED: serine carboxypeptidase-like 43         189   3e-56   
ref|NP_001031351.1|  serine carboxypeptidase-like 43                    194   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463193.1|  PREDICTED: serine carboxypeptidase-like 44         193   4e-56   Camelina sativa [gold-of-pleasure]
gb|AAD28662.1|  putative serine carboxypeptidase II                     194   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496048.1|  PREDICTED: serine carboxypeptidase-like 43         190   6e-56   
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               193   9e-56   Medicago truncatula
gb|KGN47484.1|  hypothetical protein Csa_6G338160                       197   2e-55   Cucumis sativus [cucumbers]
ref|XP_006279617.1|  hypothetical protein CARUB_v10026338mg             192   2e-55   Capsella rubella
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         192   2e-55   
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          191   7e-55   Sorghum bicolor [broomcorn]
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             191   8e-55   Arabidopsis lyrata subsp. lyrata
gb|KEH35413.1|  serine carboxypeptidase-like protein                    191   1e-54   Medicago truncatula
ref|XP_004139740.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    197   1e-54   
ref|XP_003577714.1|  PREDICTED: serine carboxypeptidase-like 42         190   1e-54   Brachypodium distachyon [annual false brome]
gb|AFW60601.1|  hypothetical protein ZEAMMB73_172356                    188   1e-54   
ref|XP_004979109.1|  PREDICTED: serine carboxypeptidase-like 42-like    190   1e-54   Setaria italica
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850          190   2e-54   Amborella trichopoda
ref|XP_008677381.1|  PREDICTED: serine carboxypeptidase F13S12.6 ...    189   3e-54   Zea mays [maize]
ref|XP_009414969.1|  PREDICTED: serine carboxypeptidase-like 42         189   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60190.1|  hypothetical protein M569_14612                         184   5e-54   Genlisea aurea
gb|AFW60600.1|  serine carboxypeptidase F13S12.6                        188   7e-54   
ref|XP_004977164.1|  PREDICTED: serine carboxypeptidase-like 42-l...    188   1e-53   Setaria italica
ref|NP_001067496.1|  Os11g0213600                                       187   1e-53   
ref|XP_002885858.1|  predicted protein                                  187   1e-53   
ref|NP_001151858.1|  serine carboxypeptidase F13S12.6 precursor         187   2e-53   Zea mays [maize]
gb|ACM17527.1|  putative serine carboxy peptidase                       187   2e-53   Oryza australiensis
emb|CDY66139.1|  BnaAnng21620D                                          187   3e-53   Brassica napus [oilseed rape]
gb|ABK25236.1|  unknown                                                 181   3e-51   Picea sitchensis
ref|XP_006663298.1|  PREDICTED: serine carboxypeptidase-like 42-like    181   4e-51   
gb|EEE51848.1|  hypothetical protein OsJ_33355                          180   7e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KJB59377.1|  hypothetical protein B456_009G252300                    172   5e-48   Gossypium raimondii
ref|XP_004977165.1|  PREDICTED: serine carboxypeptidase-like 42-l...    172   7e-48   
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                168   2e-46   
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                168   3e-46   
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                164   1e-44   Selaginella moellendorffii
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                163   2e-44   
emb|CDX81435.1|  BnaC09g08460D                                          160   1e-43   
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                155   1e-41   Selaginella moellendorffii
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                155   2e-41   Selaginella moellendorffii
gb|EMT31513.1|  Serine carboxypeptidase-like 42                         154   4e-41   
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                153   9e-41   
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                152   2e-40   
ref|XP_006830556.1|  hypothetical protein AMTR_s00117p00106310          150   1e-39   
ref|XP_007021535.1|  Serine carboxypeptidase 44                         147   5e-39   
ref|XP_007021532.1|  Serine carboxypeptidase 44                         148   7e-39   
ref|XP_007021681.1|  Serine carboxypeptidase 44                         147   1e-38   
gb|EYU42662.1|  hypothetical protein MIMGU_mgv1a022120mg                148   1e-38   Erythranthe guttata [common monkey flower]
emb|CAN74668.1|  hypothetical protein VITISV_005686                     146   4e-38   Vitis vinifera
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    145   7e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007021438.1|  Serine carboxypeptidase 44                         145   8e-38   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       145   1e-37   
ref|XP_007021448.1|  Serine carboxypeptidase 44                         144   1e-37   
ref|XP_007021444.1|  Serine carboxypeptidase 44 isoform 2               144   1e-37   
ref|XP_007021443.1|  Serine carboxypeptidase 44 isoform 1               144   2e-37   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            144   3e-37   Glycine soja [wild soybean]
ref|XP_007160822.1|  hypothetical protein PHAVU_001G019500g             143   4e-37   Phaseolus vulgaris [French bean]
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       143   4e-37   Glycine max [soybeans]
gb|KJB13335.1|  hypothetical protein B456_002G069000                    142   8e-37   Gossypium raimondii
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       142   2e-36   Glycine max [soybeans]
gb|KHN05141.1|  Serine carboxypeptidase II-3                            141   2e-36   Glycine soja [wild soybean]
ref|XP_007021534.1|  Serine carboxypeptidase 44                         141   2e-36   
gb|KDO66312.1|  hypothetical protein CISIN_1g039871mg                   141   3e-36   Citrus sinensis [apfelsine]
gb|KDP38392.1|  hypothetical protein JCGZ_04317                         139   3e-36   Jatropha curcas
ref|XP_006470494.1|  PREDICTED: serine carboxypeptidase-like 40-like    141   3e-36   
gb|KJB63052.1|  hypothetical protein B456_009G451300                    139   3e-36   Gossypium raimondii
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       141   4e-36   Glycine max [soybeans]
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    140   4e-36   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         140   4e-36   Jatropha curcas
emb|CBI29056.3|  unnamed protein product                                140   4e-36   Vitis vinifera
gb|KHN46300.1|  Serine carboxypeptidase II-3                            140   4e-36   Glycine soja [wild soybean]
ref|XP_008363303.1|  PREDICTED: serine carboxypeptidase-like 40         140   4e-36   
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         140   4e-36   Prunus mume [ume]
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         140   4e-36   Vitis vinifera
gb|KHN35601.1|  Serine carboxypeptidase II-3                            140   4e-36   Glycine soja [wild soybean]
ref|XP_010261659.1|  PREDICTED: serine carboxypeptidase-like 40         140   4e-36   
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         140   4e-36   Populus euphratica
ref|XP_008220190.1|  PREDICTED: serine carboxypeptidase II-3-like       140   5e-36   Prunus mume [ume]
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    140   5e-36   Nicotiana sylvestris
ref|XP_004293521.1|  PREDICTED: serine carboxypeptidase-like 31 i...    140   6e-36   Fragaria vesca subsp. vesca
gb|EPS67442.1|  hypothetical protein M569_07330                         139   8e-36   Genlisea aurea
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             140   9e-36   Phaseolus vulgaris [French bean]
ref|XP_009354385.1|  PREDICTED: serine carboxypeptidase-like 40         140   1e-35   Pyrus x bretschneideri [bai li]
gb|KJB62986.1|  hypothetical protein B456_009G446600                    139   1e-35   Gossypium raimondii
ref|XP_003544446.1|  PREDICTED: serine carboxypeptidase II-3-like...    139   1e-35   
gb|KJB63053.1|  hypothetical protein B456_009G451300                    139   1e-35   Gossypium raimondii
ref|XP_010279514.1|  PREDICTED: serine carboxypeptidase-like 40         139   1e-35   Nelumbo nucifera [Indian lotus]
gb|KJB62985.1|  hypothetical protein B456_009G446500                    139   1e-35   Gossypium raimondii
gb|KHN12757.1|  Serine carboxypeptidase II-3                            139   1e-35   Glycine soja [wild soybean]
ref|XP_006595959.1|  PREDICTED: serine carboxypeptidase II-3-like...    139   1e-35   
ref|NP_001242872.1|  uncharacterized protein LOC100820473 precursor     139   1e-35   
emb|CDP08509.1|  unnamed protein product                                139   1e-35   Coffea canephora [robusta coffee]
ref|XP_011025505.1|  PREDICTED: serine carboxypeptidase-like 40 i...    139   2e-35   Populus euphratica
ref|XP_011025504.1|  PREDICTED: serine carboxypeptidase-like 40 i...    139   2e-35   Populus euphratica
gb|KJB49314.1|  hypothetical protein B456_008G112500                    138   2e-35   Gossypium raimondii
ref|XP_010042631.1|  PREDICTED: serine carboxypeptidase-like 40         133   2e-35   Eucalyptus grandis [rose gum]
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       138   2e-35   Vitis vinifera
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       138   3e-35   
gb|KDO83297.1|  hypothetical protein CISIN_1g015244mg                   137   3e-35   Citrus sinensis [apfelsine]
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          138   3e-35   
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         138   3e-35   Nicotiana tomentosiformis
ref|XP_001751694.1|  predicted protein                                  138   3e-35   
ref|XP_007220730.1|  hypothetical protein PRUPE_ppa023387mg             134   4e-35   
gb|KEH40059.1|  serine carboxypeptidase-like protein                    138   4e-35   Medicago truncatula
emb|CDP19962.1|  unnamed protein product                                139   4e-35   Coffea canephora [robusta coffee]
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       138   4e-35   Eucalyptus grandis [rose gum]
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     138   4e-35   Eucalyptus grandis [rose gum]
gb|EYU37705.1|  hypothetical protein MIMGU_mgv1a005479mg                137   4e-35   Erythranthe guttata [common monkey flower]
emb|CDP08504.1|  unnamed protein product                                138   5e-35   Coffea canephora [robusta coffee]
ref|XP_002521402.1|  serine carboxypeptidase, putative                  137   5e-35   Ricinus communis
ref|XP_007223971.1|  hypothetical protein PRUPE_ppa014620mg             138   5e-35   
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  135   5e-35   Citrus sinensis [apfelsine]
ref|XP_007212080.1|  hypothetical protein PRUPE_ppa005035mg             137   6e-35   Prunus persica
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40         137   7e-35   Fragaria vesca subsp. vesca
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             137   7e-35   Citrus clementina [clementine]
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    137   8e-35   Citrus sinensis [apfelsine]
gb|EAZ09402.1|  hypothetical protein OsI_31676                          137   8e-35   Oryza sativa Indica Group [Indian rice]
gb|KJB79850.1|  hypothetical protein B456_013G069700                    137   8e-35   Gossypium raimondii
ref|XP_011088748.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    137   9e-35   
ref|XP_010279510.1|  PREDICTED: serine carboxypeptidase-like 40         137   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009368057.1|  PREDICTED: serine carboxypeptidase-like 40         137   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008231546.1|  PREDICTED: serine carboxypeptidase-like 40         137   1e-34   Prunus mume [ume]
gb|AAQ63884.1|  putative serine carboxypeptidase                        136   1e-34   Medicago truncatula
ref|XP_003534383.1|  PREDICTED: serine carboxypeptidase-like 40-l...    136   1e-34   Glycine max [soybeans]
gb|KHG12237.1|  Serine carboxypeptidase-like 40                         136   1e-34   Gossypium arboreum [tree cotton]
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         136   1e-34   Sesamum indicum [beniseed]
ref|XP_002876119.1|  predicted protein                                  136   1e-34   Arabidopsis lyrata subsp. lyrata
gb|KHN11708.1|  Serine carboxypeptidase-like 40                         136   1e-34   Glycine soja [wild soybean]
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               136   1e-34   
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       136   1e-34   Citrus sinensis [apfelsine]
ref|XP_008231545.1|  PREDICTED: serine carboxypeptidase-like 40         136   1e-34   Prunus mume [ume]
gb|EEC75382.1|  hypothetical protein OsI_11848                          136   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_002517750.1|  serine carboxypeptidase, putative                  136   2e-34   Ricinus communis
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         132   2e-34   Nicotiana tomentosiformis
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               136   2e-34   
gb|ACJ85847.1|  unknown                                                 134   2e-34   Medicago truncatula
ref|XP_007017344.1|  Serine carboxypeptidase II-3 chain B isoform 4     135   2e-34   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       135   2e-34   
ref|XP_003539875.1|  PREDICTED: serine carboxypeptidase-like 40-like    136   2e-34   Glycine max [soybeans]
ref|XP_007017343.1|  Serine carboxypeptidase II-3 chain B isoform 3     135   2e-34   
ref|XP_004231124.2|  PREDICTED: serine carboxypeptidase-like 40         136   2e-34   
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             136   2e-34   Citrus clementina [clementine]
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    135   2e-34   Glycine max [soybeans]
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                135   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             135   2e-34   Prunus persica
gb|KHN30516.1|  Serine carboxypeptidase-like 40                         135   2e-34   Glycine soja [wild soybean]
ref|XP_008442230.1|  PREDICTED: serine carboxypeptidase-like 31         135   2e-34   Cucumis melo [Oriental melon]
dbj|BAJ99451.1|  predicted protein                                      135   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006345395.1|  PREDICTED: serine carboxypeptidase-like 40-like    135   3e-34   Solanum tuberosum [potatoes]
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         135   3e-34   Nelumbo nucifera [Indian lotus]
emb|CBI19568.3|  unnamed protein product                                138   3e-34   Vitis vinifera
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       135   3e-34   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    135   3e-34   Medicago truncatula
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    135   3e-34   
ref|XP_007017341.1|  Serine carboxypeptidase II-3 chain B isoform 1     135   3e-34   
gb|AES71591.2|  serine carboxypeptidase-like protein                    135   3e-34   Medicago truncatula
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    135   3e-34   Nicotiana tomentosiformis
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       135   3e-34   
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       135   3e-34   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               135   4e-34   Medicago truncatula
ref|XP_002314061.1|  hypothetical protein POPTR_0009s06080g             135   4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       135   4e-34   
ref|XP_004146591.1|  PREDICTED: serine carboxypeptidase-like 31-like    135   4e-34   Cucumis sativus [cucumbers]
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         135   4e-34   Nicotiana tomentosiformis
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          135   4e-34   Amborella trichopoda
ref|XP_004959516.1|  PREDICTED: serine carboxypeptidase II-3-like       135   4e-34   
ref|XP_010067798.1|  PREDICTED: serine carboxypeptidase-like 40         135   4e-34   Eucalyptus grandis [rose gum]
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    135   4e-34   Glycine max [soybeans]
ref|XP_006346455.1|  PREDICTED: serine carboxypeptidase-like 26-like    135   5e-34   Solanum tuberosum [potatoes]
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               135   5e-34   
gb|AES71590.2|  serine carboxypeptidase-like protein                    135   5e-34   Medicago truncatula
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          135   5e-34   
ref|XP_004959517.1|  PREDICTED: serine carboxypeptidase II-3-like       135   5e-34   Setaria italica
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       135   5e-34   
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             135   5e-34   
gb|EEE59169.1|  hypothetical protein OsJ_11092                          135   5e-34   
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             134   5e-34   
ref|XP_006347176.1|  PREDICTED: serine carboxypeptidase-like 31-like    135   5e-34   
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       135   5e-34   
gb|AAT78819.1|  putative serine carboxypeptidase                        134   5e-34   
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    134   5e-34   
ref|XP_010413138.1|  PREDICTED: serine carboxypeptidase-like 40         135   6e-34   
ref|NP_191906.1|  serine carboxypeptidase-like 40                       134   6e-34   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    134   6e-34   
ref|XP_003580170.1|  PREDICTED: serine carboxypeptidase-like 35         134   6e-34   
ref|XP_004229673.1|  PREDICTED: serine carboxypeptidase-like 40         134   6e-34   
ref|XP_010512774.1|  PREDICTED: serine carboxypeptidase-like 40 i...    134   6e-34   
gb|ABK25202.1|  unknown                                                 134   7e-34   
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             134   7e-34   
ref|XP_006402270.1|  hypothetical protein EUTSA_v10005912mg             134   7e-34   
ref|XP_004229672.1|  PREDICTED: serine carboxypeptidase-like 40         134   7e-34   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         134   8e-34   
gb|KHN32398.1|  Serine carboxypeptidase-like 40                         134   8e-34   
ref|XP_008652807.1|  PREDICTED: serine carboxypeptidase-like 26         134   8e-34   
tpg|DAA61817.1|  TPA: hypothetical protein ZEAMMB73_814931              134   8e-34   
emb|CDP16350.1|  unnamed protein product                                134   8e-34   
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    134   8e-34   
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         134   8e-34   
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             134   8e-34   
ref|XP_010468839.1|  PREDICTED: serine carboxypeptidase-like 40         134   8e-34   
emb|CDO98312.1|  unnamed protein product                                134   9e-34   
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    134   9e-34   
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         134   9e-34   
gb|KJB61590.1|  hypothetical protein B456_009G368500                    134   1e-33   
ref|XP_008375221.1|  PREDICTED: serine carboxypeptidase-like 40         132   1e-33   
ref|XP_011088747.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    134   1e-33   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     133   1e-33   
gb|KDP37687.1|  hypothetical protein JCGZ_06344                         134   1e-33   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               134   1e-33   
gb|AES71588.2|  serine carboxypeptidase-like protein                    134   1e-33   
gb|KEH17669.1|  serine carboxypeptidase-like protein                    132   1e-33   
ref|XP_008809533.1|  PREDICTED: putative serine carboxypeptidase-...    135   1e-33   
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         133   1e-33   
ref|XP_010316720.1|  PREDICTED: serine carboxypeptidase-like 31         134   1e-33   
ref|XP_007017345.1|  Serine carboxypeptidase 40, putative               134   1e-33   
gb|KJB24944.1|  hypothetical protein B456_004G169200                    133   1e-33   
ref|XP_010324807.1|  PREDICTED: serine carboxypeptidase-like 40 i...    134   1e-33   
ref|XP_004231125.1|  PREDICTED: serine carboxypeptidase-like 40 i...    133   1e-33   
ref|XP_010454603.1|  PREDICTED: serine carboxypeptidase-like 34         134   1e-33   
gb|KDP31724.1|  hypothetical protein JCGZ_14937                         133   2e-33   
gb|EMS55463.1|  Serine carboxypeptidase-like 35                         132   2e-33   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     133   2e-33   
ref|XP_010908593.1|  PREDICTED: serine carboxypeptidase-like 42         131   2e-33   
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    133   2e-33   
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         133   2e-33   
gb|KJB13334.1|  hypothetical protein B456_002G068900                    133   2e-33   
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         133   2e-33   
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    133   2e-33   
ref|XP_011460256.1|  PREDICTED: serine carboxypeptidase-like 31 i...    133   2e-33   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       133   2e-33   
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       132   2e-33   
ref|XP_006661322.1|  PREDICTED: serine carboxypeptidase II-3-like       133   2e-33   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    133   2e-33   
gb|ABK26288.1|  unknown                                                 131   2e-33   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         133   2e-33   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    133   2e-33   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    133   2e-33   
emb|CDP16351.1|  unnamed protein product                                133   2e-33   
ref|XP_008652806.1|  PREDICTED: serine carboxypeptidase II-3-like       133   2e-33   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         133   2e-33   
gb|AAB65475.1|  Serine carboxypeptidase isolog; 30227-33069             133   2e-33   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    132   2e-33   
gb|KJB24943.1|  hypothetical protein B456_004G169200                    133   2e-33   
ref|NP_001184957.1|  serine carboxypeptidase-like 31                    133   2e-33   
emb|CDY46950.1|  BnaA02g32960D                                          133   2e-33   
ref|XP_006423055.1|  hypothetical protein CICLE_v10028330mg             133   3e-33   
gb|ABR16719.1|  unknown                                                 132   3e-33   
ref|NP_172575.2|  serine carboxypeptidase-like 31                       133   3e-33   
ref|XP_011088290.1|  PREDICTED: serine carboxypeptidase II-3-like       132   3e-33   
ref|XP_010067794.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    132   3e-33   
gb|ACU18095.1|  unknown                                                 129   3e-33   
ref|XP_007131400.1|  hypothetical protein PHAVU_011G010600g             133   3e-33   
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         132   3e-33   
gb|AAB71481.1|  similar to serine carboxypeptidases                     132   3e-33   
gb|KDO49122.1|  hypothetical protein CISIN_1g044068mg                   132   3e-33   
gb|KJB77375.1|  hypothetical protein B456_012G134700                    132   3e-33   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         132   3e-33   
ref|NP_176308.2|  serine carboxypeptidase-like 32                       132   3e-33   
emb|CDP16360.1|  unnamed protein product                                132   3e-33   
gb|KJB69468.1|  hypothetical protein B456_011G025000                    132   3e-33   
gb|KJB77373.1|  hypothetical protein B456_012G134700                    132   3e-33   
gb|KEH33266.1|  serine carboxypeptidase-like protein                    132   3e-33   
ref|XP_002876724.1|  hypothetical protein ARALYDRAFT_486857             132   3e-33   
ref|XP_008383787.1|  PREDICTED: serine carboxypeptidase-like 31         132   3e-33   
ref|XP_010932885.1|  PREDICTED: serine carboxypeptidase-like 40 i...    132   3e-33   
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                132   3e-33   
emb|CAN82217.1|  hypothetical protein VITISV_020424                     132   3e-33   
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         132   3e-33   
ref|XP_004959513.1|  PREDICTED: serine carboxypeptidase-like 40-like    132   3e-33   
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    132   4e-33   
ref|XP_006590795.1|  PREDICTED: serine carboxypeptidase-like 34-like    132   4e-33   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       132   4e-33   
ref|XP_007015559.1|  Serine carboxypeptidase-like 40, putative is...    131   4e-33   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    132   4e-33   
ref|XP_006473888.1|  PREDICTED: serine carboxypeptidase-like 40-like    132   4e-33   
ref|XP_010932884.1|  PREDICTED: putative serine carboxypeptidase-...    132   4e-33   
gb|KHG19786.1|  Serine carboxypeptidase-like 40                         132   4e-33   
emb|CBI18754.3|  unnamed protein product                                132   4e-33   
ref|XP_002892617.1|  hypothetical protein ARALYDRAFT_471242             132   4e-33   
ref|XP_010067819.1|  PREDICTED: serine carboxypeptidase-like 40         132   4e-33   
ref|NP_191213.1|  alpha/beta-Hydrolases superfamily protein             129   4e-33   
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         132   4e-33   
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...    132   4e-33   
ref|XP_009379538.1|  PREDICTED: serine carboxypeptidase-like 31         132   4e-33   
ref|XP_006495375.1|  PREDICTED: serine carboxypeptidase-like 45-like    130   5e-33   
emb|CDY68103.1|  BnaCnng57600D                                          127   5e-33   
ref|XP_004230807.1|  PREDICTED: serine carboxypeptidase-like 26         132   5e-33   
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40         133   5e-33   
ref|XP_002462503.1|  hypothetical protein SORBIDRAFT_02g026870          132   5e-33   
ref|XP_006346530.1|  PREDICTED: serine carboxypeptidase II-3-like       132   5e-33   
gb|KDO83183.1|  hypothetical protein CISIN_1g012396mg                   130   5e-33   
gb|KDP20920.1|  hypothetical protein JCGZ_21391                         132   5e-33   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    132   6e-33   
gb|KDP37688.1|  hypothetical protein JCGZ_06345                         132   6e-33   
emb|CDO99599.1|  unnamed protein product                                132   6e-33   
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                130   6e-33   
ref|XP_010055750.1|  PREDICTED: serine carboxypeptidase-like 45 i...    131   6e-33   
dbj|BAD33942.1|  putative serine carboxypeptidase precursor             132   6e-33   
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               132   6e-33   
ref|XP_002462502.1|  hypothetical protein SORBIDRAFT_02g026860          132   6e-33   
ref|XP_002462499.1|  hypothetical protein SORBIDRAFT_02g026830          131   6e-33   
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    131   6e-33   
ref|XP_002317229.2|  serine carboxypeptidase S10 family protein         131   7e-33   
gb|KEH17668.1|  serine carboxypeptidase-like protein                    131   7e-33   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       131   7e-33   
ref|XP_011458956.1|  PREDICTED: serine carboxypeptidase II-3-like       131   8e-33   
gb|KDP43605.1|  hypothetical protein JCGZ_16892                         131   8e-33   
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    131   8e-33   
ref|XP_008670270.1|  PREDICTED: serine carboxypeptidase II-3-like       131   8e-33   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         131   8e-33   
gb|KDO83182.1|  hypothetical protein CISIN_1g012396mg                   130   8e-33   
ref|XP_004230806.1|  PREDICTED: serine carboxypeptidase II-3-like       131   9e-33   
ref|XP_006346528.1|  PREDICTED: serine carboxypeptidase II-3-like       131   9e-33   
ref|XP_011096266.1|  PREDICTED: serine carboxypeptidase-like 31         131   9e-33   
ref|XP_006345491.1|  PREDICTED: serine carboxypeptidase-like 40-like    131   9e-33   
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    131   9e-33   
ref|XP_008670269.1|  PREDICTED: serine carboxypeptidase-like 28         131   1e-32   
ref|XP_007015558.1|  Serine carboxypeptidase-like 40, putative is...    130   1e-32   
ref|XP_007015557.1|  Serine carboxypeptidase-like 40, putative is...    130   1e-32   
ref|XP_002460405.1|  hypothetical protein SORBIDRAFT_02g027600          131   1e-32   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       131   1e-32   
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             131   1e-32   
ref|XP_006434837.1|  hypothetical protein CICLE_v10003343mg             130   1e-32   
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    131   1e-32   
tpg|DAA40334.1|  TPA: hypothetical protein ZEAMMB73_547551              131   1e-32   
ref|XP_004979757.1|  PREDICTED: p-(S)-hydroxymandelonitrile lyase...    131   1e-32   
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               131   1e-32   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    131   1e-32   
tpg|DAA36856.1|  TPA: hypothetical protein ZEAMMB73_455482              129   1e-32   
ref|XP_006477516.1|  PREDICTED: serine carboxypeptidase-like 45-like    128   1e-32   
ref|XP_007015556.1|  Serine carboxypeptidase II-3, expressed, put...    131   1e-32   
ref|XP_010421120.1|  PREDICTED: serine carboxypeptidase-like 34         131   1e-32   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    131   1e-32   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       131   1e-32   
ref|XP_006303173.1|  hypothetical protein CARUB_v10008980mg             130   1e-32   
ref|XP_004306277.2|  PREDICTED: serine carboxypeptidase II-3-like       130   1e-32   
ref|XP_010418062.1|  PREDICTED: serine carboxypeptidase-like 32         130   1e-32   
ref|XP_003543073.1|  PREDICTED: serine carboxypeptidase-like 31-l...    130   1e-32   
ref|XP_003543072.1|  PREDICTED: serine carboxypeptidase-like 31-l...    130   1e-32   
ref|XP_007159282.1|  hypothetical protein PHAVU_002G224800g             130   1e-32   
ref|XP_010475997.1|  PREDICTED: serine carboxypeptidase-like 31         130   1e-32   
ref|XP_006345492.1|  PREDICTED: serine carboxypeptidase-like 40-like    132   1e-32   
ref|XP_004292825.1|  PREDICTED: serine carboxypeptidase II-3-like       130   1e-32   
ref|XP_010493441.1|  PREDICTED: serine carboxypeptidase-like 34         130   1e-32   
ref|XP_006303174.1|  hypothetical protein CARUB_v10008980mg             130   1e-32   
gb|EMT08342.1|  Serine carboxypeptidase-like 40                         128   2e-32   
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         130   2e-32   
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         130   2e-32   
ref|XP_009794618.1|  PREDICTED: serine carboxypeptidase-like 26         130   2e-32   
ref|XP_008813035.1|  PREDICTED: putative serine carboxypeptidase-...    130   2e-32   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         130   2e-32   
ref|XP_004984182.1|  PREDICTED: serine carboxypeptidase-like 26-l...    130   2e-32   
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          130   2e-32   
emb|CDO99730.1|  unnamed protein product                                130   2e-32   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         130   2e-32   
emb|CDX68352.1|  BnaA07g23920D                                          130   2e-32   
ref|XP_006345490.1|  PREDICTED: serine carboxypeptidase-like 40-like    130   2e-32   
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              130   2e-32   
ref|NP_190770.1|  serine carboxypeptidase-like 39                       130   2e-32   
ref|XP_002520355.1|  serine carboxypeptidase, putative                  131   2e-32   
ref|NP_001050257.1|  Os03g0386800                                       130   2e-32   
ref|XP_004514571.1|  PREDICTED: serine carboxypeptidase-like 40-like    130   2e-32   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         130   2e-32   
ref|XP_004984181.1|  PREDICTED: serine carboxypeptidase-like 26-l...    130   2e-32   
ref|XP_009590317.1|  PREDICTED: serine carboxypeptidase-like 26         130   2e-32   
ref|XP_010431670.1|  PREDICTED: serine carboxypeptidase-like 32         130   2e-32   
gb|AAT78817.1|  putative serine carboxypeptidase                        130   2e-32   
ref|XP_010107053.1|  Serine carboxypeptidase-like 31                    130   2e-32   
ref|XP_008371321.1|  PREDICTED: serine carboxypeptidase-like 31         130   2e-32   
ref|XP_006394589.1|  hypothetical protein EUTSA_v10004057mg             130   2e-32   
ref|XP_010103278.1|  Serine carboxypeptidase-like 40                    130   2e-32   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    130   2e-32   
ref|XP_010458486.1|  PREDICTED: serine carboxypeptidase-like 31         130   2e-32   
gb|EEC84715.1|  hypothetical protein OsI_31677                          130   2e-32   
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    130   2e-32   
gb|KJB55516.1|  hypothetical protein B456_009G080300                    130   2e-32   
gb|KDO47635.1|  hypothetical protein CISIN_1g011108mg                   129   2e-32   
ref|XP_008658699.1|  PREDICTED: lysosomal protective protein isof...    130   2e-32   
ref|XP_002305011.2|  hypothetical protein POPTR_0004s03800g             130   2e-32   
ref|XP_009104963.1|  PREDICTED: serine carboxypeptidase-like 40         130   2e-32   
gb|ABR16997.1|  unknown                                                 130   2e-32   
gb|ABR16596.1|  unknown                                                 130   2e-32   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             130   2e-32   
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    130   2e-32   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    130   2e-32   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         130   2e-32   
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    130   3e-32   
ref|XP_006287580.1|  hypothetical protein CARUB_v10000790mg             130   3e-32   
gb|KCW66001.1|  hypothetical protein EUGRSUZ_G03291                     130   3e-32   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   130   3e-32   
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    130   3e-32   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         130   3e-32   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    130   3e-32   
gb|KJB29512.1|  hypothetical protein B456_005G104400                    130   3e-32   



>ref|XP_009600050.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=472

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLVK LPGQPKV F+QYAGYVDVD+KAGRSLFYYFVEAEVNP  KPLTLWLNGG G
Sbjct  26   YPEEDLVKALPGQPKVSFRQYAGYVDVDVKAGRSLFYYFVEAEVNPDHKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYITG  145

Query  465  DASTASDMHIFMV  503
            DA TA DMHIFM+
Sbjct  146  DAKTAMDMHIFMM  158



>ref|XP_009798650.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009798651.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=472

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLVK LPGQPKV F+QYAGYVDVD+KAGRSLFYYFVEAEVNP  KPLTLWLNGG G
Sbjct  26   YPEEDLVKALPGQPKVSFRQYAGYVDVDVKAGRSLFYYFVEAEVNPDHKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            DA TA DMHIFM+
Sbjct  146  DAKTAMDMHIFMM  158



>ref|XP_004237734.1| PREDICTED: serine carboxypeptidase-like 42 [Solanum lycopersicum]
Length=472

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE+DLVK LPGQPKVGF+QYAGYVDVD+KAGRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  26   YPEKDLVKALPGQPKVGFRQYAGYVDVDVKAGRSLFYYFVEAEVKPDEKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTTG  145

Query  465  DASTASDMHIFMV  503
            DA TA DMH+FM+
Sbjct  146  DAKTAMDMHMFMM  158



>ref|XP_007019399.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
 gb|EOY16624.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
Length=439

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP+VGF QYAGYVDVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  27   YPAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTSSDYICG
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMHIFM+
Sbjct  147  DASTAKDMHIFMM  159



>ref|XP_007019398.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
 gb|EOY16623.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
Length=433

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP+VGF QYAGYVDVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  27   YPAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTSSDYICG
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMHIFM+
Sbjct  147  DASTAKDMHIFMM  159



>ref|XP_006356286.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=472

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLVK LPGQPKVGF+QYAGYV+VD+KAGRSLFYYFVEAEV P  KPL LWLNGG G
Sbjct  26   YPEEDLVKALPGQPKVGFRQYAGYVEVDVKAGRSLFYYFVEAEVKPDEKPLALWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTTG  145

Query  465  DASTASDMHIFMV  503
            DA TA DMH+FM+
Sbjct  146  DAKTAMDMHMFMM  158



>ref|XP_006434390.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47630.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=331

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  33   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  92

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  153  DASTARDMHVFMM  165



>ref|XP_007019397.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
 gb|EOY16622.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
Length=473

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP+VGF QYAGYVDVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  27   YPAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTSSDYICG
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMHIFM+
Sbjct  147  DASTAKDMHIFMM  159



>gb|KDO83625.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=330

 Score =   216 bits (549),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  152  DASTARDMHVFMM  164



>gb|KDO83623.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
 gb|KDO83624.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=353

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  152  DASTARDMHVFMM  164



>gb|KDO83622.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=396

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  152  DASTARDMHVFMM  164



>gb|KDO83613.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=394

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  152  DASTARDMHVFMM  164



>ref|XP_006434389.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47629.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=424

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  33   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  92

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  153  DASTARDMHVFMM  165



>gb|KDO83614.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83615.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=423

 Score =   216 bits (549),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  152  DASTARDMHVFMM  164



>ref|XP_006434388.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47628.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=479

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  33   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  92

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  153  DASTARDMHVFMM  165



>ref|XP_004171434.1| PREDICTED: serine carboxypeptidase-like 42-like, partial [Cucumis 
sativus]
Length=180

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V FKQYAGYVD+DLK GRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  26   FPSEDLVMRLPGQPPVSFKQYAGYVDIDLKNGRSLFYYFVEAEEQPEKKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  465  DASTASDMHIFMV  503
            DASTA DMH+F +
Sbjct  146  DASTARDMHMFFM  158



>ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Vitis 
vinifera]
 emb|CBI19968.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP+VGF+Q+AGYVDVD+KAGRSLFYYFVEAE +P  K LTLWLNGG G
Sbjct  21   YPEEDLVVRLPGQPEVGFRQFAGYVDVDVKAGRSLFYYFVEAEDDPDTKALTLWLNGGPG  80

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P+GDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  81   CSSMGGGAFTELGPFFPSGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  140

Query  465  DASTASDMHIFMV  503
            DASTA DM +FM+
Sbjct  141  DASTARDMRVFMM  153



>ref|XP_006472927.1| PREDICTED: serine carboxypeptidase-like 42-like [Citrus sinensis]
Length=478

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGG G
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGR LRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRALRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  465  DASTASDMHIFMV  503
            DASTA DMH+FM+
Sbjct  152  DASTARDMHVFMM  164



>ref|XP_007161487.1| hypothetical protein PHAVU_001G0732001g, partial [Phaseolus vulgaris]
 gb|ESW33481.1| hypothetical protein PHAVU_001G0732001g, partial [Phaseolus vulgaris]
Length=200

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQ+AGYVDVDLK GRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  46   YPAEDLVVRLPGQPNVGFKQFAGYVDVDLKHGRSLFYYFVEAEKDPDKKPLTLWLNGGPG  105

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNL+FVESPAGVGWSYSNT+SDY  G
Sbjct  106  CSSIGGGAFTELGPFYPNGDGRGLRRNSMSWNKASNLIFVESPAGVGWSYSNTTSDYNSG  165

Query  465  DASTASDMHIFMV  503
            D STA+DM++F++
Sbjct  166  DVSTANDMYLFLL  178



>ref|XP_007201403.1| hypothetical protein PRUPE_ppa008027mg [Prunus persica]
 gb|EMJ02602.1| hypothetical protein PRUPE_ppa008027mg [Prunus persica]
Length=348

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  27   YPAEDLVVRLPGQPNVGFKQYAGYVDVDVKAGRSLFYYFVEADREPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNLMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  147  DASTARDMHTFLL  159



>ref|XP_011101717.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=469

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP V F+QYAGYVDVD+K GRSLFYYFVEA  +P  KPLTLWLNGG G
Sbjct  23   FPEEDLVTKLPGQPVVKFRQYAGYVDVDVKNGRSLFYYFVEAAEDPDRKPLTLWLNGGPG  82

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR NSKSWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  83   CSSVGGGAFTELGPFYPRGDGRGLRINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  142

Query  465  DASTASDMHIFMV  503
            DASTA DMHIF++
Sbjct  143  DASTAMDMHIFLM  155



>ref|XP_006393769.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
 gb|ESQ31055.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
Length=479

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQPKV F+Q+AGYVDVD++AGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  32   YPEEDLVTKLPGQPKVAFRQFAGYVDVDVRAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGDGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  465  DASTASDMHIFMV  503
            D STA DM +FM+
Sbjct  152  DESTAKDMLVFML  164



>ref|XP_009377728.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=491

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  45   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDRKPLTLWLNGGPG  104

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  105  CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  164

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  165  DASTARDMHTFLL  177



>gb|KHN05260.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=474

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKVGFKQ+AGYVDVD K GRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  28   YPAEDLVVKLPGQPKVGFKQFAGYVDVDAKHGRSLFYYFVEAEQDPHKKPLTLWLNGGPG  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  88   CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  147

Query  465  DASTASDMHIFMV  503
            DASTA+DM++FM+
Sbjct  148  DASTANDMYLFML  160



>ref|XP_003544740.2| PREDICTED: serine carboxypeptidase-like 42-like isoformX1 [Glycine 
max]
Length=487

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKVGFKQ+AGYVDVD K GRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  41   YPAEDLVVKLPGQPKVGFKQFAGYVDVDAKHGRSLFYYFVEAEQDPHKKPLTLWLNGGPG  100

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  101  CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  160

Query  465  DASTASDMHIFMV  503
            DASTA+DM++FM+
Sbjct  161  DASTANDMYLFML  173



>ref|XP_010930631.1| PREDICTED: serine carboxypeptidase-like 42 [Elaeis guineensis]
Length=476

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV GLPGQPKV F+QYAGYVDVD K G+SLFYYF EA+ N   KPLTLWLNGG G
Sbjct  26   YPEEDLVVGLPGQPKVEFRQYAGYVDVDTKTGKSLFYYFAEADSNASKKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRN KSWNKASNLLFVESP GVGWSYSN SSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPRGDGRGLRRNKKSWNKASNLLFVESPVGVGWSYSNRSSDYTCG  145

Query  465  DASTASDMHIFMV  503
            D STA+DMH+F++
Sbjct  146  DESTANDMHVFLL  158



>emb|CDX80725.1| BnaC08g05590D [Brassica napus]
Length=476

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  31   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  90

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  91   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  150

Query  465  DASTASDMHIFMV  503
            D STA DM +F++
Sbjct  151  DESTAKDMLVFLL  163



>ref|XP_009360732.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  27   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADEQPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSVGGGAFTELGPFYPTGDGRGLRRNPMSWNRASNLLFVESPAGVGWSYSNTSSDYDSG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  147  DASTARDMHTFLM  159



>ref|XP_010245825.1| PREDICTED: serine carboxypeptidase-like 42 [Nelumbo nucifera]
Length=470

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKV F+Q+AGYVDVD KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  24   YPVEDLVLKLPGQPKVDFRQFAGYVDVDEKAGRSLFYYFVEAEGEPEKKPLTLWLNGGPG  83

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGG+FTELGPF+P GDGRGL+RN+KSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  84   CSSVGGGSFTELGPFFPRGDGRGLQRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  143

Query  465  DASTASDMHIFMV  503
            DASTA DMHIF +
Sbjct  144  DASTARDMHIFFL  156



>ref|XP_008237677.1| PREDICTED: serine carboxypeptidase-like 42 [Prunus mume]
Length=471

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  27   YPAEDLVVRLPGQPNVGFKQYAGYVDVDVKAGRSLFYYFVEADKEPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNLMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  147  DASTARDMHTFLL  159



>gb|EYU17411.1| hypothetical protein MIMGU_mgv1a005783mg [Erythranthe guttata]
Length=471

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP V F+QYAGYVDVD+K GRSLFYYFVEA+ NP  KPLTLWLNGG G
Sbjct  25   FPEEDLVVKLPGQPFVKFRQYAGYVDVDVKKGRSLFYYFVEADNNPDHKPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGR LR NSKSWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  85   CSSIGGGAFTELGPFFPNGDGRSLRVNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  144

Query  465  DASTASDMHIFMV  503
            DASTA DMH+F++
Sbjct  145  DASTAMDMHVFLM  157



>ref|XP_008461495.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Cucumis 
melo]
Length=472

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V FKQYAGYVD+D+K GRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  26   FPSEDLVLRLPGQPPVSFKQYAGYVDIDVKNGRSLFYYFVEAEEHPEKKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  465  DASTASDMHIFMV  503
            DASTA DMHIF +
Sbjct  146  DASTARDMHIFFM  158



>ref|XP_010244030.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP E LV  LPGQPKV F+Q+AGY+DVD KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  23   YPVEHLVSKLPGQPKVDFRQFAGYIDVDEKAGRSLFYYFVEAEGEPEKKPLTLWLNGGPG  82

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  83   CSSVGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  142

Query  465  DASTASDMHIFMV  503
            DAS+A DMH+F++
Sbjct  143  DASSARDMHMFLM  155



>gb|KGN44500.1| hypothetical protein Csa_7G319000 [Cucumis sativus]
Length=472

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V FKQYAGYVD+DLK GRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  26   FPSEDLVLRLPGQPPVSFKQYAGYVDIDLKNGRSLFYYFVEAEEQPEKKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  465  DASTASDMHIFMV  503
            DASTA DMH+F +
Sbjct  146  DASTARDMHMFFM  158



>ref|XP_009377699.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  K LTLWLNGG G
Sbjct  27   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDKKSLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  147  DASTAKDMHTFLL  159



>ref|XP_010244029.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nelumbo 
nucifera]
Length=505

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP E LV  LPGQPKV F+Q+AGY+DVD KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  59   YPVEHLVSKLPGQPKVDFRQFAGYIDVDEKAGRSLFYYFVEAEGEPEKKPLTLWLNGGPG  118

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  119  CSSVGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  178

Query  465  DASTASDMHIFMV  503
            DAS+A DMH+F++
Sbjct  179  DASSARDMHMFLM  191



>ref|XP_008373914.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=474

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAG VDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  28   YPAEDLVVSLPGQPSVGFKQYAGSVDVDVKAGRSLFYYFVEADKQPDKKPLTLWLNGGPG  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  147

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  148  DASTARDMHAFLL  160



>ref|XP_009107652.1| PREDICTED: serine carboxypeptidase-like 44 isoform X3 [Brassica 
rapa]
Length=454

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGG G
Sbjct  7    YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  66

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  67   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  126

Query  465  DASTASDMHIFMV  503
            D STA DM +F++
Sbjct  127  DESTAKDMLVFLL  139



>gb|KJB59374.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59376.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59378.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=483

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+ NP  +PLTLWLNGG G
Sbjct  37   YPAEDLVVKLPGQPPVGFKQYAGYVDVDVKAGRSLFYYFVEADKNPEKQPLTLWLNGGPG  96

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGR LR NS SWNKASNLLFVESP GVGWSYSNTSSDYI G
Sbjct  97   CSSVGGGAFTELGPFYPRGDGRSLRINSMSWNKASNLLFVESPVGVGWSYSNTSSDYIRG  156

Query  465  DASTASDMHIFMV  503
            DASTA DM+IFM+
Sbjct  157  DASTAKDMYIFMM  169



>gb|KHF97371.1| Serine carboxypeptidase-like 42 [Gossypium arboreum]
Length=483

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+ NP  +PLTLWLNGG G
Sbjct  37   YPAEDLVVKLPGQPPVGFKQYAGYVDVDVKAGRSLFYYFVEADKNPEKQPLTLWLNGGPG  96

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGR LR NS SWNKASNLLFVESP GVGWSYSNTSSDYI G
Sbjct  97   CSSVGGGAFTELGPFYPRGDGRSLRINSMSWNKASNLLFVESPVGVGWSYSNTSSDYIRG  156

Query  465  DASTASDMHIFMV  503
            DASTA DM+IFM+
Sbjct  157  DASTAKDMYIFMM  169



>ref|XP_009107650.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
 ref|XP_009107651.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
Length=464

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGG G
Sbjct  17   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  76

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  77   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  136

Query  465  DASTASDMHIFMV  503
            D STA DM +F++
Sbjct  137  DESTAKDMLVFLL  149



>ref|XP_010679983.1| PREDICTED: serine carboxypeptidase-like 42 [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKVGFKQ+AGY+DVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  31   YPMEDLVVNLPGQPKVGFKQFAGYIDVDVKAGRSLFYYFVEAKNDPHSKPLTLWLNGGPG  90

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P+GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91   CSSMGGGAFTELGPFFPSGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  150

Query  465  DASTASDMHIFMV  503
            DA++A DM  F+V
Sbjct  151  DAASAKDMLTFLV  163



>ref|XP_009377698.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=474

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYF EA+  P  KPLTLWLNGG G
Sbjct  28   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFAEADKQPDKKPLTLWLNGGPG  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRTNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  147

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  148  DASTARDMHTFLL  160



>emb|CDP12019.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P ED V+ LPGQPKVGFKQYAGY+DVD+KAGRSLFYYFVEAE +P  KPL LWLNGG G
Sbjct  24   FPAEDFVEALPGQPKVGFKQYAGYIDVDVKAGRSLFYYFVEAEKDPDQKPLALWLNGGPG  83

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTE GPF+P GDGR LRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  84   CSSIGGGAFTEFGPFFPRGDGRALRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNTG  143

Query  465  DASTASDMHIFMV  503
            DA+TA DMHIFM+
Sbjct  144  DANTARDMHIFMM  156



>gb|KFK24266.1| hypothetical protein AALP_AAs40498U001000 [Arabis alpina]
Length=480

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LP QPKV F+Q+AGYVDVD+KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  32   FPEEDLVTKLPRQPKVAFRQFAGYVDVDVKAGRSLFYYFVEAENQPHSKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR+NSKSWNKASNLLFVESPAGVGWSYSNTSSDY   
Sbjct  92   CSSIGGGAFTELGPFYPTGDGRGLRKNSKSWNKASNLLFVESPAGVGWSYSNTSSDYNTD  151

Query  465  DASTASDMHIFMV  503
            DA+TA DM +FM+
Sbjct  152  DATTAKDMLVFML  164



>emb|CDY48945.1| BnaA08g04690D [Brassica napus]
Length=477

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGG G
Sbjct  30   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  90   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  149

Query  465  DASTASDMHIFMV  503
            D STA DM +F++
Sbjct  150  DESTAKDMLVFLL  162



>ref|XP_009107648.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
 ref|XP_009107649.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
Length=477

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGG G
Sbjct  30   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  90   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  149

Query  465  DASTASDMHIFMV  503
            D STA DM +F++
Sbjct  150  DESTAKDMLVFLL  162



>ref|XP_009586680.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=470

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  25   HPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADKLPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  85   CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  144

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  145  DDSTAKDMLTFMI  157



>emb|CDY70042.1| BnaCnng66490D [Brassica napus]
Length=449

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQPKVGF+QYAGYV+VD K GRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  26   YPEEDLVVRLPGQPKVGFRQYAGYVNVDSKNGRSLFYYFVEADKQPDTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            D +TASDM +F++
Sbjct  146  DETTASDMVVFLL  158



>ref|XP_004290564.1| PREDICTED: serine carboxypeptidase-like 42 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP+VGFKQYAGYVDVD+K GRSLFYYFVEAE     KPL+LWLNGG G
Sbjct  21   YPAEDLVVKLPGQPQVGFKQYAGYVDVDVKNGRSLFYYFVEAENQADKKPLSLWLNGGPG  80

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  81   CSSIGGGAFTELGPFYPTGDGRGLRRNPSSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  140

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  141  DASTARDMHTFLL  153



>ref|XP_011074776.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=475

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PE+DLV  LPGQP V F+Q+AGYVDVD+K GRSLFYYFVEA  +P  KPLTLWLNGG G
Sbjct  29   FPEKDLVVRLPGQPVVKFRQFAGYVDVDVKNGRSLFYYFVEAVEDPDHKPLTLWLNGGPG  88

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGRGLR NSKSWNKASNLLFVESP+GVGWSYSNTSSDY CG
Sbjct  89   CSSIGGGAFTELGPFFPKGDGRGLRINSKSWNKASNLLFVESPSGVGWSYSNTSSDYTCG  148

Query  465  DASTASDMHIFMV  503
            DASTA DMHIFM+
Sbjct  149  DASTAIDMHIFMM  161



>ref|XP_002300939.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE80212.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=480

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP +DLV  LPGQPKVGF+QYAGYVDVD+K GRSLFYYFVEA+ +P  KPL LWLNGG G
Sbjct  34   YPSKDLVLNLPGQPKVGFRQYAGYVDVDVKNGRSLFYYFVEADKDPDQKPLALWLNGGPG  93

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  94   CSSIGGGAFTELGPFFPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  153

Query  465  DASTASDMHIFMV  503
            DA TA DMH+F++
Sbjct  154  DAKTAKDMHMFLL  166



>ref|XP_010493597.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493598.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493599.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=462

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  23   YPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  82

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  83   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRTSDYNAG  142

Query  465  DASTASDMHIFMV  503
            D STASDM +F++
Sbjct  143  DRSTASDMLVFLL  155



>emb|CDX93108.1| BnaA03g38300D [Brassica napus]
Length=449

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP VGF+QYAGYV+VD K GRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  26   YPEEDLVVRLPGQPNVGFRQYAGYVNVDSKNGRSLFYYFVEADKQPNTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            D +TASDM +F++
Sbjct  146  DETTASDMVVFLL  158



>ref|XP_010479023.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=479

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P+EDLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  32   FPKEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTG+GRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  465  DASTASDMHIFMV  503
            D +TA DM +FM+
Sbjct  152  DETTAKDMLVFML  164



>ref|XP_008786550.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=475

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV GLP QPKVGF+QYAGYVDVD KAGRSLFYYF EA+ N   KPLTLWLNGG G
Sbjct  25   YPEEDLVVGLPRQPKVGFRQYAGYVDVDEKAGRSLFYYFAEADGNADKKPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGRGLRRN  SWNKASNLLFVESPAGVGWSYSN +SDY CG
Sbjct  85   CSSIGGGAFTELGPFFPRGDGRGLRRNKMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  144

Query  465  DASTASDMHIFMV  503
            D S A+D+H+F++
Sbjct  145  DESAANDLHVFLL  157



>ref|XP_006351861.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=478

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  26   YPIEDLVDNLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHKLPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  145

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  146  DESTAKDMLNFML  158



>ref|XP_003522555.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
 gb|KHN44256.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=473

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP+EDL+  LPGQPKVGFKQYAGYVD+D+K GRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  27   YPDEDLIVSLPGQPKVGFKQYAGYVDIDVKHGRSLFYYFVEAENGPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNKTSDYNSG  146

Query  465  DASTASDMHIFM  500
            D+STA+DM +F+
Sbjct  147  DSSTATDMLLFL  158



>ref|XP_008373913.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=473

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  K LTLWLNGG G
Sbjct  27   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDKKSLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRG+R N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGVRSNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  465  DASTASDMHIFMV  503
            DASTA DMH F++
Sbjct  147  DASTAKDMHTFLL  159



>ref|XP_009767156.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=445

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  30   HPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADKLPLTLWLNGGPG  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  90   CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  149

Query  465  DASTASDMHIFMV  503
            D  TA DM  FM+
Sbjct  150  DDPTAKDMLTFML  162



>ref|XP_010530237.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=474

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP V F+Q+AGYVDVDLK+GRSLFYYFVEAE  P  KPL+LWLNGG G
Sbjct  28   YPEEDLVVKLPGQPDVQFRQFAGYVDVDLKSGRSLFYYFVEAEKKPDEKPLSLWLNGGPG  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNKTSDYTTG  147

Query  465  DASTASDMHIFMV  503
            DA+TA DM +F++
Sbjct  148  DATTAKDMLVFLL  160



>ref|XP_010482006.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=473

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP+EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  27   YPDEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNAG  146

Query  465  DASTASDMHIFMV  503
            D STASDM +F++
Sbjct  147  DRSTASDMLVFLL  159



>ref|XP_010062160.1| PREDICTED: serine carboxypeptidase-like 42 [Eucalyptus grandis]
 gb|KCW69227.1| hypothetical protein EUGRSUZ_F02740 [Eucalyptus grandis]
Length=472

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP +DLV  LPGQPKVGF+Q+AGYVDVD+K GRSLFYYFVEA+ +P  KPL LWLNGG G
Sbjct  26   YPAQDLVVNLPGQPKVGFRQFAGYVDVDVKHGRSLFYYFVEADKDPESKPLALWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  86   CSSIGGGAFTELGPFYPRGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYNCG  145

Query  465  DASTASDMHIFMV  503
            D S+A D+H F +
Sbjct  146  DESSAKDLHTFFL  158



>ref|XP_009767155.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
Length=475

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  30   HPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADKLPLTLWLNGGPG  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  90   CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  149

Query  465  DASTASDMHIFMV  503
            D  TA DM  FM+
Sbjct  150  DDPTAKDMLTFML  162



>ref|XP_010442147.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442148.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442149.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=465

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP V FKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  19   YPEEDLVVRLPGQPTVAFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  78

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  79   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNAG  138

Query  465  DASTASDMHIFMV  503
            D STASDM +F++
Sbjct  139  DRSTASDMLVFLL  151



>ref|XP_004502581.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=468

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV+ LPGQPKV F QYAGYVD+D+K G+SLFYYFVEA  NP  KPLTLWLNGG G
Sbjct  24   YPSEDLVERLPGQPKVKFSQYAGYVDIDVKNGKSLFYYFVEAHHNPHKKPLTLWLNGGPG  83

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP+G+GRGLR+NSKSWN+ SNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  84   CSSIGGGAFTELGPFYPSGNGRGLRKNSKSWNRVSNLLFVESPAGVGWSYSNTTSDYNAG  143

Query  465  DASTASDMHIFMV  503
            DASTA+DM +FM+
Sbjct  144  DASTANDMLLFML  156



>ref|XP_006307408.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
 gb|EOA40306.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
Length=473

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP+V F+QYAGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  26   FPEEDLVTKLPGQPEVAFRQYAGYVDIDVKAGRSLFYYFVEAEKEPHTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTG+G GLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  86   CSSIGGGAFTELGPFYPTGNGLGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYNTG  145

Query  465  DASTASDMHIFMV  503
            D  TA DM +FM+
Sbjct  146  DEKTAKDMLMFML  158



>ref|XP_009107653.1| PREDICTED: serine carboxypeptidase-like 44 isoform X4 [Brassica 
rapa]
Length=449

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            EEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGG GCS
Sbjct  4    EEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPGCS  63

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  470
            S+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  GD 
Sbjct  64   SIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTGDE  123

Query  471  STASDMHIFMV  503
            STA DM +F++
Sbjct  124  STAKDMLVFLL  134



>ref|NP_175046.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
 sp|Q9MAR8.1|SCP44_ARATH RecName: Full=Serine carboxypeptidase-like 44; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF63101.1|AC006423_2 Putative serine carboxypeptidases [Arabidopsis thaliana]
 gb|AEE31996.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
Length=479

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P +DLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  32   FPVQDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHSKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGD RGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGDARGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  465  DASTASDMHIFMV  503
            D STA DM +FM+
Sbjct  152  DESTAKDMLVFML  164



>ref|XP_006280410.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
 gb|EOA13308.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
Length=471

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEED V  LPGQPKVGF+QYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  25   YPEEDFVVRLPGQPKVGFRQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN S+DY  G
Sbjct  85   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSTDYNTG  144

Query  465  DASTASDMHIFMV  503
            D +TASDM +F++
Sbjct  145  DKTTASDMVMFLL  157



>ref|XP_002268397.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera]
 emb|CBI20040.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQPKVGF+Q+ GYVDVD KAGRS+FYYFVEAE +P+ KPLTLWLNGG G
Sbjct  29   WPEEDLVVRLPGQPKVGFRQFGGYVDVDEKAGRSMFYYFVEAEEDPQNKPLTLWLNGGPG  88

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFT LGPF+P G  RG+RRNSKSWNK SNLLFVESPAGVGWSYSNTS+DY CG
Sbjct  89   CSSVGGGAFTALGPFFPKGHSRGVRRNSKSWNKVSNLLFVESPAGVGWSYSNTSADYNCG  148

Query  465  DASTASDMHIFMV  503
            DASTASDM  FM+
Sbjct  149  DASTASDMLTFML  161



>ref|XP_009136205.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=466

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  26   YPEEDLVVRLPGQPKVEFRQYAGYVNVDSKNGRSLFYYFVEADKQPDTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            D +TASDM +F++
Sbjct  146  DETTASDMVVFLL  158



>gb|KDP43043.1| hypothetical protein JCGZ_25229 [Jatropha curcas]
Length=491

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP +DLV  LPGQPKV F+Q++GYVDVD+K GRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  45   YPIKDLVVNLPGQPKVAFRQFSGYVDVDVKNGRSLFYYFVEADKDPDKKPLTLWLNGGPG  104

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTS+DY  G
Sbjct  105  CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSTDYTTG  164

Query  465  DASTASDMHIFMV  503
            DA TA DMH+F++
Sbjct  165  DAKTAKDMHMFLL  177



>ref|XP_002891272.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67531.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  32   FPIEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHSKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP G+GRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPIGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  465  DASTASDMHIFMV  503
            D STA DM +FM+
Sbjct  152  DESTAKDMLVFML  164



>ref|XP_004515138.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=470

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKV F QYAGYVD+D+K G+SLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  28   YPMEDLVVRLPGQPKVKFSQYAGYVDIDVKHGKSLFYYFVEADHHPHKKPLTLWLNGGPG  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP+GDGRGLRRNSKSWN+ SNLLFVESPAGVGWSYSNT+SDY   
Sbjct  88   CSSIGGGAFTELGPFYPSGDGRGLRRNSKSWNRVSNLLFVESPAGVGWSYSNTTSDYDSD  147

Query  465  DASTASDMHIFMV  503
            DASTA+DM +FM+
Sbjct  148  DASTANDMVLFML  160



>ref|NP_199039.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
 sp|Q9FH05.1|SCP42_ARATH RecName: Full=Serine carboxypeptidase-like 42; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32772.1|AF361604_1 AT5g42240/K5J14_4 [Arabidopsis thaliana]
 dbj|BAB10197.1| serine carboxypeptidase II-like [Arabidopsis thaliana]
 gb|AAN28838.1| At5g42240/K5J14_4 [Arabidopsis thaliana]
 gb|AED94786.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
Length=473

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  27   YPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKAS+LLFVESPAGVGWSYSN SSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTG  146

Query  465  DASTASDMHIFMV  503
            D STA+DM +F++
Sbjct  147  DKSTANDMLVFLL  159



>ref|XP_004148827.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=480

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P +DLV  LPGQP VGF+Q+AGYVDVD+ AGRSLFYYF EA+ +P L PLTLWLNGG G
Sbjct  34   FPAQDLVDRLPGQPTVGFRQFAGYVDVDVNAGRSLFYYFAEAQQDPHLLPLTLWLNGGPG  93

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSN +SDY CG
Sbjct  94   CSSVGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  153

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  154  DDSTARDMLTFML  166



>ref|XP_010519388.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=471

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP V F+Q+AGYVDVD K+GRSLFYYFVEAE NP  KPLTLWLNGG G
Sbjct  25   YPEEDLVVKLPGQPDVEFRQFAGYVDVDFKSGRSLFYYFVEAEKNPLDKPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR N  SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  85   CSSIGGGAFTELGPFYPTGDGRGLRVNPMSWNKASNLLFVESPAGVGWSYSNRTSDYNTG  144

Query  465  DASTASDMHIFMV  503
            DASTA DM +F++
Sbjct  145  DASTAKDMLVFLL  157



>gb|KHN23425.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=457

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P+EDL+  LPGQPKV FKQYAGYVD+D+K GRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  27   HPDEDLIVSLPGQPKVEFKQYAGYVDIDVKHGRSLFYYFVEAENVPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLR NS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRTNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  465  DASTASDMHIFMV  503
            D+STA+DM +F++
Sbjct  147  DSSTATDMLLFLL  159



>ref|XP_004490638.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Cicer 
arietinum]
Length=476

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKV F QY GYVD+D+K GRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  30   YPIEDLVVRLPGQPKVKFSQYGGYVDIDVKHGRSLFYYFVEADHHPHKKPLTLWLNGGPG  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR+NS SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  90   CSSIGGGAFTELGPFYPTGDGRGLRKNSMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  149

Query  465  DASTASDMHIFMV  503
            DASTA DM +F++
Sbjct  150  DASTADDMVLFLL  162



>ref|XP_010315079.1| PREDICTED: serine carboxypeptidase-like 42 isoform X4 [Solanum 
lycopersicum]
Length=345

 Score =   195 bits (496),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  145  DESTAKDMLNFML  157



>ref|XP_010315078.1| PREDICTED: serine carboxypeptidase-like 42 isoform X3 [Solanum 
lycopersicum]
Length=346

 Score =   195 bits (496),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  145  DESTAKDMLNFML  157



>ref|XP_003602149.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES72400.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKV F QYAGYVD+D+K GRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  23   YPIEDLVVKLPGQPKVKFSQYAGYVDIDIKHGRSLFYYFVEADHLPHKKPLTLWLNGGPG  82

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP+GDGRGLR+NSKSWN  SN+LFVESPAGVGWSYSNT+SDY  G
Sbjct  83   CSSIGGGAFTELGPFYPSGDGRGLRKNSKSWNTVSNILFVESPAGVGWSYSNTTSDYNIG  142

Query  465  DASTASDMHIFMV  503
            DASTA+DM +FM+
Sbjct  143  DASTANDMLLFML  155



>ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP VGF+QYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  27   YPEEDLVVRLPGQPTVGFRQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN S+DY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRVNSLSWNKASNLLFVESPAGVGWSYSNRSTDYNTG  146

Query  465  DASTASDMHIFMV  503
            D +TA DM +F++
Sbjct  147  DKTTARDMLVFLL  159



>emb|CDY51660.1| BnaC03g66990D [Brassica napus]
Length=441

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEE+LV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA   P  KPLTLWLNGG G
Sbjct  19   YPEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETKPLTLWLNGGPG  78

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  79   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  138

Query  465  DASTASDMHIFMV  503
            D +TA DM +F++
Sbjct  139  DETTAKDMLVFLM  151



>ref|XP_003527966.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
Length=473

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P+EDL+  LPGQPKV FKQYAGYVD+D+K GRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  27   HPDEDLIVSLPGQPKVEFKQYAGYVDIDVKHGRSLFYYFVEAENVPDKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLR NS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRTNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  465  DASTASDMHIFMV  503
            D+STA+DM +F++
Sbjct  147  DSSTATDMLLFLL  159



>ref|XP_004490637.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Cicer 
arietinum]
Length=509

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKV F QY GYVD+D+K GRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  30   YPIEDLVVRLPGQPKVKFSQYGGYVDIDVKHGRSLFYYFVEADHHPHKKPLTLWLNGGPG  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTGDGRGLR+NS SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  90   CSSIGGGAFTELGPFYPTGDGRGLRKNSMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  149

Query  465  DASTASDMHIFMV  503
            DASTA DM +F++
Sbjct  150  DASTADDMVLFLL  162



>ref|XP_010110480.1| Serine carboxypeptidase-like 42 [Morus notabilis]
 gb|EXC26581.1| Serine carboxypeptidase-like 42 [Morus notabilis]
Length=442

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKV F QYAGYVDVD  AGRSLFYYFVEA+  P  KPLTLWLNGG G
Sbjct  27   YPVEDLVVKLPGQPKVSFSQYAGYVDVDFNAGRSLFYYFVEADNEPHKKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGL RNS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSVGGGAFTELGPFYPTGDGRGLHRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  465  DASTASDMHIFMV  503
            DA+ A+DM  FM+
Sbjct  147  DAAAANDMREFML  159



>ref|XP_006596272.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=456

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKVGFKQ+AGYVDVD K GRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  41   YPAEDLVVKLPGQPKVGFKQFAGYVDVDAKHGRSLFYYFVEAEQDPHKKPLTLWLNGGPG  100

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  101  CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  160

Query  465  DAST  476
            DAST
Sbjct  161  DAST  164



>emb|CDY37202.1| BnaA09g08230D [Brassica napus]
Length=456

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQPKV F+QYAGYVDVD +  RSLFYYFVEA+  P  KPLTLWLN G G
Sbjct  29   YPEEDLVVRLPGQPKVLFRQYAGYVDVDSETCRSLFYYFVEADTQPETKPLTLWLNRGPG  88

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGD RGLR NS SWNKASNLLFV+SPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDDRGLRINSMSWNKASNLLFVDSPAGVGWSYSNTSSDYNTG  148

Query  465  DASTASDMHIFMV  503
            D +TASDM +F++
Sbjct  149  DETTASDMLVFLL  161



>emb|CDY23340.1| BnaA08g12060D [Brassica napus]
Length=469

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEE+LV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA   P  KPLTLWLNGG G
Sbjct  29   YPEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETKPLTLWLNGGPG  88

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR N  SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDGRGLRINPMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  148

Query  465  DASTASDMHIFMV  503
            D +TA DM +F++
Sbjct  149  DETTAKDMLVFLI  161



>ref|XP_009406489.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQPKVGF+QYAGYVDVD KAGR+LFYYF EA+ +   KPLTLWLNGG G
Sbjct  25   YPEEDLVVRLPGQPKVGFRQYAGYVDVDEKAGRTLFYYFAEADGDAHAKPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPF+P GDGRGLR N  SWNK SNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  85   CSSVGGGAFTELGPFFPRGDGRGLRLNKMSWNKVSNLLFVESPAGVGWSYSNTTSDYNCG  144

Query  465  DASTASDMHIFMV  503
            D STA+DM+ F++
Sbjct  145  DESTANDMYKFLL  157



>ref|XP_009112251.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQPKV F+QYAGYVDVD +  RSLFYYFVEA+  P  KPLTLWLN G G
Sbjct  29   YPEEDLVVRLPGQPKVLFRQYAGYVDVDSETCRSLFYYFVEADTQPETKPLTLWLNRGPG  88

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGD RGLR NS SWNKASNLLFV+SPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDDRGLRINSMSWNKASNLLFVDSPAGVGWSYSNTSSDYNAG  148

Query  465  DASTASDMHIFMV  503
            D +TASDM +F++
Sbjct  149  DETTASDMLVFLL  161



>ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis]
Length=476

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKVGF+QYAGY+DVD+  GRSL+YYFVEA+ +P  KPL LWLNGG G
Sbjct  30   YPVEDLVVNLPGQPKVGFRQYAGYIDVDVNNGRSLYYYFVEADKDPDNKPLALWLNGGPG  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P G+GRGLR NS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  90   CSSIGGGAFTELGPFFPKGNGRGLRINSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  149

Query  465  DASTASDMHIFMV  503
            DA TA DMHIF++
Sbjct  150  DAKTAKDMHIFLL  162



>ref|XP_009123167.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEE+LV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA   P  KPLTLWLNGG G
Sbjct  29   YPEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETKPLTLWLNGGPG  88

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR N  SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDGRGLRINPMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  148

Query  465  DASTASDMHIFMV  503
            D +TA DM +F++
Sbjct  149  DETTAKDMLVFLM  161



>ref|XP_007137531.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
 gb|ESW09525.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
Length=472

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDL++ LPGQP VGFKQ+AGYVDVD+K GRSLFYYFVEA+ +   KPLTLWLNGG G
Sbjct  27   YPAEDLIERLPGQPNVGFKQFAGYVDVDVKHGRSLFYYFVEADNDHHNKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLF+ESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFLESPAGVGWSYSNTTSDYSSG  146

Query  465  DASTASDMHIFMV  503
            DASTA+D  +F++
Sbjct  147  DASTANDTLLFLL  159



>gb|ADE76785.1| unknown [Picea sitchensis]
Length=240

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            EEDLV+ LPGQP+V FKQYAGY++VD +AGR+LFYYFVEAE +    PL LWLNGG GCS
Sbjct  46   EEDLVERLPGQPEVDFKQYAGYINVDDEAGRALFYYFVEAEKDSHSMPLALWLNGGPGCS  105

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  470
            S+GGGAF ELGPFYP GDGRGL  NS+SWNK SNLLFVESPAGVGWSYSNTSSDY CGDA
Sbjct  106  SIGGGAFMELGPFYPRGDGRGLITNSQSWNKVSNLLFVESPAGVGWSYSNTSSDYTCGDA  165

Query  471  STASDMHIFM  500
            STA+DM +F+
Sbjct  166  STAADMQVFL  175



>ref|XP_002865553.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41812.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE DLV  LPGQ KV F+QYAGYVD+D+ AGRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  27   YPEADLVVRLPGQLKVAFRQYAGYVDLDMNAGRSLFYYFVEAEEHPDTKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS  GGAFTELGPFYPTGDG GLR NS SWNKASNLLFVESP GVGWSYSN SSDY  G
Sbjct  87   CSSGCGGAFTELGPFYPTGDGGGLRVNSMSWNKASNLLFVESPVGVGWSYSNRSSDYNTG  146

Query  465  DASTASDMHIFMV  503
            D STASDM +F++
Sbjct  147  DKSTASDMLVFLL  159



>ref|XP_004230572.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Solanum 
lycopersicum]
Length=477

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  145  DESTAKDMLNFML  157



>ref|XP_010315077.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Solanum 
lycopersicum]
Length=478

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGG G
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  145  DESTAKDMLNFML  157



>ref|NP_001183841.1| hypothetical protein precursor [Zea mays]
 gb|ACR38507.1| unknown [Zea mays]
 tpg|DAA38901.1| TPA: hypothetical protein ZEAMMB73_424549 [Zea mays]
Length=473

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V F+Q+AGYVDVD+KAGRSLFYYF EA+ N   KPLTLWLNGG G
Sbjct  26   FPAEDLVTRLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQENAAAKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLR N KSWNKASNLLFVESPAGVGWSYSNTSSDYI G
Sbjct  86   CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYITG  145

Query  465  DASTASDMHIFMV  503
            DA TA+DM  F++
Sbjct  146  DARTANDMLRFLL  158



>ref|NP_199038.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
 sp|Q9FH06.1|SCP41_ARATH RecName: Full=Serine carboxypeptidase-like 41; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10196.1| serine carboxypeptidase-II like [Arabidopsis thaliana]
 gb|AAO22761.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AAO42380.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AED94783.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
Length=469

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE DLV  LPGQPKV F+QYAGYVD+DL AGRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  23   YPETDLVVRLPGQPKVVFRQYAGYVDLDLNAGRSLFYYFVEAEKHPDTKPLTLWLNGGPG  82

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTG GRGLR NS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  83   CSSVGGGAFTELGPFYPTGYGRGLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAG  142

Query  465  DASTASDMHIFMV  503
            D S ASDM +F++
Sbjct  143  DKSAASDMLVFLL  155



>ref|XP_011027377.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
42 [Populus euphratica]
Length=480

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP +DLV  LPGQPK GF+QYAGYVDVD+K GRSLFYYFVEA+ +P  KPL LWLNGG G
Sbjct  34   YPAKDLVLNLPGQPKAGFRQYAGYVDVDVKNGRSLFYYFVEADKDPDQKPLALWLNGGPG  93

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTE+ PF+P+ DGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  94   CSSIGGGAFTEVXPFFPSRDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  153

Query  465  DASTASDMHIFMV  503
            DA TA DMH+F++
Sbjct  154  DAKTAEDMHMFLL  166



>ref|XP_006299245.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
 gb|EOA32143.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
Length=459

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE+DLV  LPGQPKVGF+Q+AGYV+VD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  17   YPEDDLVARLPGQPKVGFRQFAGYVNVDSENGRSLFYYYVEAVKEPETKPLTLWLNGGPG  76

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  77   CSSVGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  136

Query  465  DASTASDMHIFMV  503
            D STA+DM +F++
Sbjct  137  DKSTANDMLVFLL  149



>ref|XP_006383613.1| hypothetical protein POPTR_0005s21010g [Populus trichocarpa]
 gb|ERP61410.1| hypothetical protein POPTR_0005s21010g [Populus trichocarpa]
Length=348

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKVGF+Q+AGYVDVD++  RSLFYYF+EAE +P  KPL LWLNGG  
Sbjct  27   YPAEDLVLNLPGQPKVGFRQHAGYVDVDVRNVRSLFYYFLEAEKDPDQKPLALWLNGGPS  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGR LRRNS SWN+A NLLF+ES AGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFFPRGDGRDLRRNSMSWNRAFNLLFIESSAGVGWSYSNTSSDYTIG  146

Query  465  DASTASDMHIFMV  503
            DA TA DMH+F +
Sbjct  147  DAKTAKDMHMFFL  159



>ref|NP_178937.2| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 sp|Q84W27.1|SCP43_ARATH RecName: Full=Serine carboxypeptidase-like 43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO42304.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC06202.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=442

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP VGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  26   YPEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            D ST +DM +F++
Sbjct  146  DKSTVNDMLVFLL  158



>ref|XP_008461496.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Cucumis 
melo]
Length=441

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V FKQYAGYVD+D+K GRSLFYYFVEAE +P  KPLTLWLNGG G
Sbjct  26   FPSEDLVLRLPGQPPVSFKQYAGYVDIDVKNGRSLFYYFVEAEEHPEKKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  465  DASTA  479
            DAST 
Sbjct  146  DASTG  150



>ref|XP_010425083.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=268

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE+DLV  LPGQPKVGF+Q+AGY++VD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  20   YPEDDLVVRLPGQPKVGFRQFAGYINVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  79

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  80   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVKSPAGVGWSYSNRSSDYNTG  139

Query  465  DASTASDMHIFMV  503
            D ST +DM +F++
Sbjct  140  DKSTTNDMLVFLL  152



>ref|NP_001031351.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 gb|AEC06203.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=443

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP VGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  26   YPEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            D ST +DM +F++
Sbjct  146  DKSTVNDMLVFLL  158



>ref|XP_010463193.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=422

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  32   FPEEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  91

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYPTG+GRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  465  DASTA  479
            D +T 
Sbjct  152  DETTV  156



>gb|AAD28662.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=468

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQP VGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  26   YPEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            D ST +DM +F++
Sbjct  146  DKSTVNDMLVFLL  158



>ref|XP_010496048.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=329

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE+DLV  LPGQPKVGF+ +AGY++VD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  21   YPEDDLVVVLPGQPKVGFRPFAGYINVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  80

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  81   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  140

Query  465  DASTASDMHIFMV  503
            D STA DM +F++
Sbjct  141  DKSTADDMLVFLL  153



>ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES98769.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQPKV F QYAGYVD+D+K GRSLFYYFVEA+  P+ KPLTLWLNGG G
Sbjct  24   YPIEDLVVSLPGQPKVEFSQYAGYVDIDVKHGRSLFYYFVEADHKPQNKPLTLWLNGGPG  83

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPF+P GDGRGLR NS SWN+ASNLLF+ESPAGVGWSYSNT+SDY  G
Sbjct  84   CSSIGGGAFTELGPFFPAGDGRGLRTNSMSWNRASNLLFIESPAGVGWSYSNTTSDYNIG  143

Query  465  DASTASDMHIFMV  503
            DASTA+DM  F +
Sbjct  144  DASTANDMLSFFL  156



>gb|KGN47484.1| hypothetical protein Csa_6G338160 [Cucumis sativus]
Length=806

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 107/133 (80%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P +DLV  LPGQP VGF+Q+AGYVDVD+ AGRSLFYYF EA+ +P L PLTLWLNG  G
Sbjct  34   FPAQDLVDRLPGQPTVGFRQFAGYVDVDVNAGRSLFYYFAEAQQDPHLLPLTLWLNGVGG  93

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                   AFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSN +SDY CG
Sbjct  94   G------AFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  147

Query  465  DASTASDMHIFMV  503
            D STA DM  FM+
Sbjct  148  DDSTARDMLTFML  160



>ref|XP_006279617.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
 gb|EOA12515.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
Length=472

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE DLV  LPGQPKV F+QYAGYV+VDL  GRSLFYY+VEAE +P  KPLTLWLNGG G
Sbjct  26   YPEADLVVRLPGQPKVTFRQYAGYVEVDLSVGRSLFYYYVEAETHPDTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGG FTELGPFYPTGDGRGLR N+ SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  86   CSSVGGGGFTELGPFYPTGDGRGLRINTMSWNKASNLLFVESPAGVGWSYSNRTSDYNAG  145

Query  465  DASTASDMHIFMV  503
            D S  SDM +F++
Sbjct  146  DESATSDMLLFLL  158



>ref|XP_010468548.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=462

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE+DLV  LPGQPKVGF+Q+AGY++VD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  22   YPEDDLVVRLPGQPKVGFRQFAGYINVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  81

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  82   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  141

Query  465  DASTASDMHIFMV  503
            D STA+DM +F++
Sbjct  142  DKSTANDMLMFLL  154



>ref|XP_002449388.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
 gb|EES08376.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
Length=476

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V F+Q+AGYVDVD+KAGRSLFYYF EA+ +   KPLTLWLNGG G
Sbjct  31   FPAEDLVTRLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQQDAAAKPLTLWLNGGPG  90

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLR N KSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91   CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  150

Query  465  DASTASDMHIFMV  503
            D  TA+DM+ F++
Sbjct  151  DVQTANDMYQFLL  163



>ref|XP_002863806.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40065.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPE D V  LPGQP V F+QYAGYVD+D   GRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  26   YPEADFVVKLPGQPMVTFRQYAGYVDIDKVVGRSLFYYFVEAEKRPDTKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAG  145

Query  465  DASTASDMHIFMV  503
            D S ASDM +F++
Sbjct  146  DESAASDMLVFLL  158



>gb|KEH35413.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=477

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP ED +  LPGQPKV FKQYAGY+D+D++ GRSLFYYFVEA+ +P  KPLTLWLNGG G
Sbjct  28   YPIEDFIVKLPGQPKVEFKQYAGYIDIDVRHGRSLFYYFVEADHDPHKKPLTLWLNGGPG  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-  461
            CSS+GGGAFTELGPFYPTGDGRGLRRN KSWN+ASNLLFVESPAGVGWSYSNT+SDY   
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRRNKKSWNRASNLLFVESPAGVGWSYSNTTSDYNNY  147

Query  462  GDASTASDMHIFMV  503
             D STA+D  +FM+
Sbjct  148  DDTSTANDTLLFML  161



>ref|XP_004139740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g09040, mitochondrial-like [Cucumis sativus]
Length=1441

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  105   YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
             +P EDLV  LPGQP V FKQYAGYVD+DLK GRSLFYYFVEAE  P  KPLTLWLNGG G
Sbjct  1049  FPSEDLVLRLPGQPPVSFKQYAGYVDIDLKNGRSLFYYFVEAEEQPEKKPLTLWLNGGPG  1108

Query  285   cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
             CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  1109  CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  1168

Query  465   DAST  476
             DAST
Sbjct  1169  DAST  1172



>ref|XP_003577714.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=472

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV+ LPGQP VGF+Q++GYVDVD KAGRSLFYYF EA+     KPLTLWLNGG G
Sbjct  27   FPEEDLVRRLPGQPVVGFRQFSGYVDVDEKAGRSLFYYFTEAQEGAAGKPLTLWLNGGPG  86

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYKTG  146

Query  465  DASTASDMHIFMV  503
            D  TA DM+ F++
Sbjct  147  DTRTADDMYRFLL  159



>gb|AFW60601.1| hypothetical protein ZEAMMB73_172356 [Zea mays]
Length=382

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGG G
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  465  DASTASDMHIFMV  503
            D  TA DM+ F++
Sbjct  146  DVRTAHDMYQFLL  158



>ref|XP_004979109.1| PREDICTED: serine carboxypeptidase-like 42-like [Setaria italica]
Length=473

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V F+Q+AGYVDVD+KAGRSLFYYF EA+ +   KPLTLWLNGG G
Sbjct  28   FPAEDLVARLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQEDAAAKPLTLWLNGGPG  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+GGGAFTELGPFYP GDGRGLR N KSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88   CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  147

Query  465  DASTASDMHIFMV  503
            D  TA DM+ F++
Sbjct  148  DVRTADDMYRFLL  160



>ref|XP_006858474.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
 gb|ERN19941.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
Length=474

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            P EDLV  LPGQPKV FKQYAGYV+VD KAGRSLFYYF EA+ +   KPLTLWLNGG GC
Sbjct  29   PVEDLVHRLPGQPKVDFKQYAGYVNVDEKAGRSLFYYFAEADGDADKKPLTLWLNGGPGC  88

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SS+GGGAFTELGPF+P GDGRGL RN KSWN+ SNLLFVESPAGVGWSYSNT++DY CGD
Sbjct  89   SSIGGGAFTELGPFFPRGDGRGLIRNKKSWNRVSNLLFVESPAGVGWSYSNTTADYTCGD  148

Query  468  ASTASDMHIFMV  503
            ASTA DM  F++
Sbjct  149  ASTAKDMLRFLL  160



>ref|XP_008677381.1| PREDICTED: serine carboxypeptidase F13S12.6 isoform X1 [Zea mays]
Length=490

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGG G
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  465  DASTASDMHIFMV  503
            D  TA DM+ F++
Sbjct  146  DVRTAHDMYQFLL  158



>ref|XP_009414969.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414970.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414971.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414972.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            PEEDLV  LPGQPKVGF+QYAG+VDVD+KAGRSLFYY  EA+ +   KPLTLWLNGG GC
Sbjct  26   PEEDLVVRLPGQPKVGFRQYAGHVDVDVKAGRSLFYYLAEADGDAHKKPLTLWLNGGPGC  85

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SSVGGGAFTELGPFYP GDGRGLR N  SWNK SNLLFVESPAGVGWSYSNT+SDY   D
Sbjct  86   SSVGGGAFTELGPFYPRGDGRGLRINKMSWNKVSNLLFVESPAGVGWSYSNTTSDYNRDD  145

Query  468  ASTASDMHIFMV  503
             STA+DM+IF++
Sbjct  146  ESTANDMYIFLL  157



>gb|EPS60190.1| hypothetical protein M569_14612, partial [Genlisea aurea]
Length=297

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            P  DLV+ LPGQP V F+QYAGYVDVD   GRSLFYYFVEA  +P  KPLTLWLNGG GC
Sbjct  22   PAGDLVRNLPGQPPVKFRQYAGYVDVDAIKGRSLFYYFVEAAEDPHRKPLTLWLNGGPGC  81

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SSVGGGAFTELGPF+P GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSNTSSDY  GD
Sbjct  82   SSVGGGAFTELGPFFPRGDGRGLVSNSNSWNRASNLLFVESPAGVGWSYSNTSSDYNTGD  141

Query  468  ASTASDMHIFMV  503
            A+TA D+ +F+ 
Sbjct  142  ANTARDLRVFLT  153



>gb|AFW60600.1| serine carboxypeptidase F13S12.6 [Zea mays]
Length=471

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGG G
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  465  DASTASDMHIFMV  503
            D  TA DM+ F++
Sbjct  146  DVRTAHDMYQFLL  158



>ref|XP_004977164.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Setaria 
italica]
Length=476

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRL-KPLTLWLNggs  281
            YPE DLV+GLPGQP V F+Q+AGYVDVD +AGRSLFYY  EA+      KPLTLWLNGG 
Sbjct  30   YPESDLVRGLPGQPPVAFRQFAGYVDVDERAGRSLFYYLAEADGAAAASKPLTLWLNGGP  89

Query  282  gcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC  461
            GCSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  
Sbjct  90   GCSSVGGGAFTELGPFYPRGDGRGLRINDKSWNKVSNLLFVESPAGVGWSYSNTSSDYKT  149

Query  462  GDASTASDMHIFMV  503
            GDA TASDMHIF++
Sbjct  150  GDARTASDMHIFLL  163



>ref|NP_001067496.1| Os11g0213600 [Oryza sativa Japonica Group]
 gb|ABA92134.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27859.1| Os11g0213600 [Oryza sativa Japonica Group]
Length=465

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA      KPLTLWLNGG G
Sbjct  20   FPEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAKPLTLWLNGGPG  79

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  80   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTG  139

Query  465  DASTASDMHIFMV  503
            DA TA+DM+ F++
Sbjct  140  DAQTANDMYKFLL  152



>ref|XP_002885858.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62117.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEED+V  LPGQPKVGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGG G
Sbjct  35   YPEEDMVVRLPGQPKVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  94

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGG FT+LGPFYPTGDGRGLR NS SWNKASNLLFVESPA VGWSYSN SS+Y  G
Sbjct  95   CSSVGGGDFTKLGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAVVGWSYSNRSSNYNTG  154

Query  465  DASTASDMHIFMV  503
            D STA+DM +F++
Sbjct  155  DKSTANDMLVFLL  167



>ref|NP_001151858.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
 gb|ACG44640.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
Length=471

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGG G
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  465  DASTASDMHIFMV  503
            D  TA DM+ F++
Sbjct  146  DVWTAHDMYQFLL  158



>gb|ACM17527.1| putative serine carboxy peptidase [Oryza australiensis]
Length=466

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA      KPLTLWLNGG G
Sbjct  26   FPEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  465  DASTASDMHIFMV  503
            DA TA+DM+ F++
Sbjct  146  DARTANDMYKFVL  158



>emb|CDY66139.1| BnaAnng21620D [Brassica napus]
Length=486

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 107/132 (81%), Gaps = 8/132 (6%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YPEEDLV  LPGQPKV F+QYAGYVDVD + GRSLFYYFVEA+ +P  KPLTLWLNG   
Sbjct  29   YPEEDLVARLPGQPKVLFRQYAGYVDVDFETGRSLFYYFVEADTHPETKPLTLWLNGILI  88

Query  285  c--------ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSN  440
                     SSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN
Sbjct  89   KLYLAGPGCSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSN  148

Query  441  TSSDYICGDAST  476
            TSSDY  GD +T
Sbjct  149  TSSDYNTGDETT  160



>gb|ABK25236.1| unknown [Picea sitchensis]
Length=469

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            P EDL+  LPGQPKV FKQYAGY+ VD  AGR+LFYYF EAE +   KP+ LWLNGG GC
Sbjct  29   PAEDLIDRLPGQPKVNFKQYAGYITVDEHAGRALFYYFAEAEDDSDSKPVALWLNGGPGC  88

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SSVGGGAFTELGPFYP  DG GLR+N +SWNK SNLLFVESPAGVGWSYSNT+SDY CGD
Sbjct  89   SSVGGGAFTELGPFYPRDDGHGLRKNLQSWNKVSNLLFVESPAGVGWSYSNTTSDYTCGD  148

Query  468  ASTASDMHIFM  500
             STA +M +F+
Sbjct  149  ESTARNMLVFL  159



>ref|XP_006663298.1| PREDICTED: serine carboxypeptidase-like 42-like [Oryza brachyantha]
Length=486

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 112/145 (77%), Gaps = 12/145 (8%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGG  
Sbjct  29   FPEEDLVTRLPGQPIVGFRQFAGYVDVDEKAGRSLFYYFAEAAEDAAGKPLTLWLNGGRL  88

Query  285  ------------cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGW  428
                        CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGW
Sbjct  89   PPPATGSSPGPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGW  148

Query  429  SYSNTSSDYICGDASTASDMHIFMV  503
            SYSNTSSDY  GD  TA+DM+ F++
Sbjct  149  SYSNTSSDYNTGDQRTANDMYKFLL  173



>gb|EEE51848.1| hypothetical protein OsJ_33355 [Oryza sativa Japonica Group]
Length=474

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 106/142 (75%), Gaps = 9/142 (6%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA      KPLTLWLNG   
Sbjct  20   FPEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAKPLTLWLNGDGI  79

Query  285  cssvggg---------AFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYS  437
               +  G         AFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYS
Sbjct  80   GVVIVNGPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYS  139

Query  438  NTSSDYICGDASTASDMHIFMV  503
            NTSSDY  GDA TA+DM+ F++
Sbjct  140  NTSSDYNTGDAQTANDMYKFLL  161



>gb|KJB59377.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=468

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 107/133 (80%), Gaps = 15/133 (11%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+ NP  +PLTLWLNGG G
Sbjct  37   YPAEDLVVKLPGQPPVGFKQYAGYVDVDVKAGRSLFYYFVEADKNPEKQPLTLWLNGGPG  96

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP               +ASNLLFVESP GVGWSYSNTSSDYI G
Sbjct  97   CSSVGGGAFTELGPFYP---------------RASNLLFVESPVGVGWSYSNTSSDYIRG  141

Query  465  DASTASDMHIFMV  503
            DASTA DM+IFM+
Sbjct  142  DASTAKDMYIFMM  154



>ref|XP_004977165.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Setaria 
italica]
Length=445

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRL-KPLTLWLNggs  281
            YPE DLV+GLPGQP V F+Q+AGYVDVD +AGRSLFYY  EA+      KPLTLWLNGG 
Sbjct  30   YPESDLVRGLPGQPPVAFRQFAGYVDVDERAGRSLFYYLAEADGAAAASKPLTLWLNGGP  89

Query  282  gcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC  461
            GCSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  
Sbjct  90   GCSSVGGGAFTELGPFYPRGDGRGLRINDKSWNKVSNLLFVESPAGVGWSYSNTSSDYKT  149

Query  462  GDAST  476
            GDA T
Sbjct  150  GDART  154



>ref|XP_002974500.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ24722.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=471

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            PE DLV  LPGQP V FKQYAGYV VD  AGR+LFYYFVEA  +   +PL LWLNGG GC
Sbjct  29   PEHDLVTNLPGQPAVPFKQYAGYVTVDSHAGRALFYYFVEAHSHASSRPLALWLNGGPGC  88

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+GGGAFTELGPFYP G GRGL +NS SWNKA+N+LF+ESPAGVGWSYSN S DY I  
Sbjct  89   SSIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIYN  148

Query  465  DASTASDMHIFMV  503
            DA TA D   FM+
Sbjct  149  DAKTAKDSVTFML  161



>ref|XP_002990798.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ08071.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=467

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            PE DLV  LPGQP V FKQYAGYV VD  AGR+LFYYFVEA  +   KPL LWLNGG GC
Sbjct  25   PEHDLVTNLPGQPAVPFKQYAGYVTVDSHAGRALFYYFVEAHSHASSKPLALWLNGGPGC  84

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+GGGAFTELGPFYP G GRGL +NS SWNKA+N+LF+ESPAGVGWSYSN S DY I  
Sbjct  85   SSIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIYN  144

Query  465  DASTASDMHIFMV  503
            DA TA D   F++
Sbjct  145  DAKTAKDSVTFLL  157



>ref|XP_002972012.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26929.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            P  DLVK LPGQP+V FKQYAGYV +D ++G++LFYYFVEAE +P  KPL+LWLNGG GC
Sbjct  25   PASDLVKDLPGQPEVSFKQYAGYVTIDQRSGKALFYYFVEAEEDPTSKPLSLWLNGGPGC  84

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  464
            SS+GGGAFTELGPFYP     GL RNSK+WNKASN+LFV+SP GVGWSYSNTSSDY    
Sbjct  85   SSLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTYN  144

Query  465  DASTASDMHIFM  500
            D  T+ D+  F+
Sbjct  145  DEKTSRDLVKFL  156



>ref|XP_002972549.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26635.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            P  DLVK LPGQP V FKQYAGYV +D ++G++LFYYFVEAE +P  KPL+LWLNGG GC
Sbjct  25   PASDLVKDLPGQPDVSFKQYAGYVTIDQRSGKALFYYFVEAEEDPTSKPLSLWLNGGPGC  84

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  464
            SS+GGGAFTELGPFYP     GL RNSK+WNKASN+LFV+SP GVGWSYSNTSSDY    
Sbjct  85   SSLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTYN  144

Query  465  DASTASDMHIFM  500
            D  T+ D+  F+
Sbjct  145  DEKTSRDLVKFL  156



>emb|CDX81435.1| BnaC09g08460D [Brassica napus]
Length=413

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 102/131 (78%), Gaps = 13/131 (10%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            EEDLV  LPGQPKV F+QYA YVDVD + GRSLFYYFVEA+  P  KPLTLWLNGG GCS
Sbjct  12   EEDLVVRLPGQPKVLFRQYAVYVDVDSETGRSLFYYFVEADSQPETKPLTLWLNGGPGCS  71

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  470
            SVGGGAFTELGPFYPTGDG GLR NS SWNKASNLLFV+SPAGV             GD 
Sbjct  72   SVGGGAFTELGPFYPTGDGHGLRINSMSWNKASNLLFVDSPAGV-------------GDE  118

Query  471  STASDMHIFMV  503
            +TASDM +F++
Sbjct  119  TTASDMLVFLL  129



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            PE +LV  LPGQP V FKQYAGYV VD  AGR+LFYYF EAE     +PLTLWLNGG GC
Sbjct  23   PESELVSRLPGQPHVSFKQYAGYVTVDKNAGRALFYYFAEAETRASSQPLTLWLNGGPGC  82

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+GGGAFTELGPFYP   G+GL  N ++WNK SN+LF+E+PAGVGWSYSN SSDY    
Sbjct  83   SSIGGGAFTELGPFYPNASGQGLLVNRRAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVT  142

Query  465  DASTASDMHIFMV  503
            D  TA D   F++
Sbjct  143  DRITAVDTLNFLL  155



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            PE +LV  LPGQP V FKQYAGYV VD  AGR+LFYYF EAE     +PLTLWLNGG GC
Sbjct  23   PESELVSRLPGQPHVSFKQYAGYVTVDKNAGRALFYYFAEAETRASSQPLTLWLNGGPGC  82

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+GGGAFTELGPFYP   G+GL  N ++WNK SN+LF+E+PAGVGWSYSN SSDY    
Sbjct  83   SSIGGGAFTELGPFYPNASGQGLLVNRQAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVT  142

Query  465  DASTASDMHIFMV  503
            D  TA D   F++
Sbjct  143  DRITAVDTLNFLL  155



>gb|EMT31513.1| Serine carboxypeptidase-like 42 [Aegilops tauschii]
Length=433

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 102/133 (77%), Gaps = 13/133 (10%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA+ +   KPLTLWLNGG G
Sbjct  26   FPEEDLVGRLPGQPIVGFRQFAGYVDVDDKAGRSLFYYFAEAQDHAAGKPLTLWLNGGPG  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVGGGAFTELGPFYP GD              SNLLFVESPAGVG SYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGD-------------VSNLLFVESPAGVGRSYSNTSSDYNTG  132

Query  465  DASTASDMHIFMV  503
            D  TA+DM+ F++
Sbjct  133  DTRTANDMYKFLL  145



>ref|XP_002971138.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ27736.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=475

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVN-PRLKPLTLWLNggsg  284
            P  DLV  LPGQP+V F+QYAGYV VD  AGR+LFYYFVE E   P+ KPLTLWLNG   
Sbjct  23   PLSDLVTNLPGQPRVRFRQYAGYVTVDPSAGRALFYYFVEVEGGAPQSKPLTLWLNGEFL  82

Query  285  cssvggg----------AFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSY  434
              +              AFTELGPFYP   G GL RN +SWNK SNLLF++SPAGVGWSY
Sbjct  83   SGTKKKKGPGCSSIGCGAFTELGPFYPNASGTGLLRNPQSWNKVSNLLFLDSPAGVGWSY  142

Query  435  SNTSSDYI-CGDASTASDMHIFMV  503
            SNTSSDY    D  TA D  +F++
Sbjct  143  SNTSSDYDNVTDEKTAQDTLLFLL  166



>ref|XP_002961948.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ37208.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=480

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 96/149 (64%), Gaps = 17/149 (11%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVN-PRLKPLTLWLNggsg  284
            P  DLV  LPGQP+V F+QYAGYV VD  AGR+LFYYFVE E   P+ KPLTLWLNG   
Sbjct  23   PLSDLVTNLPGQPRVRFRQYAGYVTVDPSAGRALFYYFVEVEGGAPQSKPLTLWLNGVVS  82

Query  285  cssvgggA---------------FTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAG  419
             +     A               FTELGPFYP   G GL RN +SWNK SNLLF++SPAG
Sbjct  83   LTQSSCLAPKKKGPGCSSIGCGAFTELGPFYPNASGTGLLRNPQSWNKVSNLLFLDSPAG  142

Query  420  VGWSYSNTSSDYI-CGDASTASDMHIFMV  503
            VGWSYSNTSSDY    D  TA D  +F++
Sbjct  143  VGWSYSNTSSDYDNVTDEKTAQDTLLFLL  171



>ref|XP_006830556.1| hypothetical protein AMTR_s00117p00106310 [Amborella trichopoda]
 gb|ERM97972.1| hypothetical protein AMTR_s00117p00106310 [Amborella trichopoda]
Length=486

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  108  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            P E L+  LPGQP+V F+QY+GY++VD  AG +LFYYFVEA+ N   +PL LWLNGG GC
Sbjct  25   PTEHLISSLPGQPQVSFRQYSGYINVDESAGTNLFYYFVEAQSNASSQPLALWLNGGPGC  84

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SS+GGGAFTELGPFYP G G GLR N  SWNK +N+LF+ESPAGVGWSYS   + Y   D
Sbjct  85   SSIGGGAFTELGPFYPNGKGDGLRINPYSWNKVANVLFLESPAGVGWSYSRIPAGYRYND  144

Query  468  ASTASDMHIFMV  503
            A  A++  +F++
Sbjct  145  ARVANESLVFLL  156



>ref|XP_007021535.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13060.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=364

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V F+Q++GY+DVD K GRSLFYYFVEAE +P  +PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDVDGKFGRSLFYYFVEAENDPMNRPLTIWL-TGGP  79

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW K SNLLF++SP G GWSYSNTSSDY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKVSNLLFIDSPVGAGWSYSNTSSDYEVG  139

Query  465  DASTASDMHIFMV  503
            D ST +D+  F++
Sbjct  140  DDSTNNDLLAFIL  152



>ref|XP_007021532.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13057.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=464

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V FKQ++GY+DVD KAGRSLFYYFVEAE +P  +PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFKQFSGYIDVDGKAGRSLFYYFVEAENDPMKRPLTIWL-TGGP  79

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW K SNLLF++SP G GWSYSNTSSDY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKVSNLLFIDSPIGAGWSYSNTSSDYEVG  139

Query  465  DASTASDMHIFMV  503
            D ST  D+   ++
Sbjct  140  DDSTNKDLLTLIL  152



>ref|XP_007021681.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13206.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=464

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V F+Q++GY+DVD  AGRSLFYYFVEAE +P  +PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDVDENAGRSLFYYFVEAENDPMNRPLTIWL-TGGP  79

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW KASNLLF++SP G GWSYSNTSSD+  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKASNLLFIDSPIGEGWSYSNTSSDHEVG  139

Query  465  DASTASDMHIFMV  503
            D ST  D+  F++
Sbjct  140  DESTNKDLLTFIL  152



>gb|EYU42662.1| hypothetical protein MIMGU_mgv1a022120mg [Erythranthe guttata]
Length=489

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            Y E D +  LPGQP+V F QY+GYV VD  AGR+LFYYF E+E +   KPL LWLNGG G
Sbjct  67   YKEVDRILSLPGQPEVSFDQYSGYVTVDASAGRALFYYFAESENSSSTKPLVLWLNGGPG  126

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSS+G GA TELGPF    DG+ L  N  SWN  +N++F+ESPAGVG+SYSNTSSDYI G
Sbjct  127  CSSLGAGAMTELGPFRVNPDGKTLWHNKNSWNILANVIFLESPAGVGFSYSNTSSDYITG  186

Query  465  DASTASDMHIFMV  503
            D  TA+D + F+V
Sbjct  187  DRKTAADAYTFLV  199



>emb|CAN74668.1| hypothetical protein VITISV_005686 [Vitis vinifera]
Length=480

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 87/133 (65%), Gaps = 36/133 (27%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +PEEDLV  LPGQPKVGF+Q+ GYVDVD KAGRSLFYYFVEAE +P+ KPLTLWLNG   
Sbjct  29   WPEEDLVVRLPGQPKVGFRQFGGYVDVDEKAGRSLFYYFVEAEEDPQNKPLTLWLNG---  85

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                                              SNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   ---------------------------------VSNLLFVESPAGVGWSYSNTSSDYNCG  112

Query  465  DASTASDMHIFMV  503
            DASTASDM  FM+
Sbjct  113  DASTASDMLTFML  125



>ref|XP_010279511.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Nelumbo 
nucifera]
Length=493

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D+++ LPGQP VGFKQY GYV VD  AGR+LFYYFVEA+ +P+ KPL LWLNGG GCS
Sbjct  70   EKDMIERLPGQPPVGFKQYGGYVTVDESAGRALFYYFVEAQ-DPKSKPLLLWLNGGPGCS  128

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  467
            S+G GA  ELGPF    DG+ L  N  SWN+  N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  129  SLGYGAMEELGPFRVHSDGKTLYENRYSWNRVVNVLFLESPAGVGFSYSNRTSDYATRGD  188

Query  468  ASTASDMHIFMV  503
             STA D ++F+V
Sbjct  189  QSTAEDNYVFLV  200



>ref|XP_007021438.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY12963.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=516

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  31   FPMNDLIEKLPGQPNVTFRQFSGYIDIDAKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  89

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  90   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  149

Query  465  DASTASDMHIFMV  503
            D ST  D+  F++
Sbjct  150  DDSTNKDLLTFIL  162



>ref|XP_008813040.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=487

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +K LPGQP  V F QY+GYV VD K GR+LFYYFVE++ NP  KPL LWLNGG GC
Sbjct  69   EADRIKSLPGQPTGVEFNQYSGYVTVDTKNGRALFYYFVESQHNPSTKPLILWLNGGPGC  128

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GA  ELGPF    DG+ L+RN  +WN  +N+LF+ESPAGVG+SYSNTSSDY + G
Sbjct  129  SSLGYGAMQELGPFRVHSDGKTLQRNKYAWNNVANVLFLESPAGVGFSYSNTSSDYDMNG  188

Query  465  DASTASDMHIFMV  503
            D  TA D + F+V
Sbjct  189  DQRTAEDSYTFLV  201



>ref|XP_007021448.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY12973.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=465

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  79

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  139

Query  465  DASTASDMHIFMV  503
            D ST  D+  F++
Sbjct  140  DDSTNKDLLTFIL  152



>ref|XP_007021444.1| Serine carboxypeptidase 44 isoform 2 [Theobroma cacao]
 gb|EOY12969.1| Serine carboxypeptidase 44 isoform 2 [Theobroma cacao]
Length=465

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  79

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  139

Query  465  DASTASDMHIFMV  503
            D ST  D+  F++
Sbjct  140  DDSTNKDLLTFIL  152



>ref|XP_007021443.1| Serine carboxypeptidase 44 isoform 1 [Theobroma cacao]
 gb|EOY12968.1| Serine carboxypeptidase 44 isoform 1 [Theobroma cacao]
Length=476

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  32   FPMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  90

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  91   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  150

Query  465  DASTASDMHIFMV  503
            D ST  D+  F++
Sbjct  151  DDSTNKDLLTFIL  163



>gb|KHN05312.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=484

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGG GC
Sbjct  61   EADRIVALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  120

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG  L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  121  SSLGYGAFEELGPFRINSDGETLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYGHSG  180

Query  465  DASTASDMHIFMV  503
            D STA D ++F++
Sbjct  181  DKSTAKDAYVFLI  193



>ref|XP_007160822.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
 gb|ESW32816.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
Length=486

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E+D VKGLPG+P+ V F QY GYV VD KAGR LFYYFVE+  N   KPL LWLNGG GC
Sbjct  73   EDDKVKGLPGEPEGVDFDQYGGYVTVDAKAGRRLFYYFVESPHNASNKPLVLWLNGGPGC  132

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS+G GA  ELGPF    DGR LR+N  +WN  +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  133  SSLGYGAMQELGPFRVNSDGRTLRKNEYAWNNVANVIFLESPAGVGFSYSNTSSDYSDSG  192

Query  465  DASTASDMHIFMV  503
            D STA D + F++
Sbjct  193  DKSTAMDSYTFLI  205



>ref|XP_006595329.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=489

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGG GC
Sbjct  70   EADRIVALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG  L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGETLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYGHSG  189

Query  465  DASTASDMHIFMV  503
            D STA D ++F++
Sbjct  190  DKSTAKDAYVFLI  202



>gb|KJB13335.1| hypothetical protein B456_002G069000 [Gossypium raimondii]
Length=464

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            Y   D +  LPGQP V F+Q++GY+DVD  AGRSLFYYFVEAE +P   PLT+WL GG G
Sbjct  21   YHLSDQIGTLPGQPNVNFRQFSGYIDVDPNAGRSLFYYFVEAENDPLSLPLTIWLTGGPG  80

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
            CSSVG  +F  +GPF  T + RGL+RN  +W K SN+LF++SP G GWSYSNT+SDY  G
Sbjct  81   CSSVGD-SFVGIGPFTTTNNARGLKRNPYAWTKVSNMLFIDSPIGSGWSYSNTNSDYQAG  139

Query  465  DASTASDMHIFMV  503
            D ST  D+ +F++
Sbjct  140  DVSTNDDLVVFIL  152



>ref|XP_006593897.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=490

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGG GC
Sbjct  70   QADKIAALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDHSG  189

Query  465  DASTASDMHIFMV  503
            D  TA D ++F++
Sbjct  190  DKPTAKDAYVFLI  202



>gb|KHN05141.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=490

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGG GC
Sbjct  70   QADKIAALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDHSG  189

Query  465  DASTASDMHIFMV  503
            D  TA D ++F++
Sbjct  190  DKPTAKDAYVFLI  202



>ref|XP_007021534.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13059.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=472

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            +P  DL++ LPGQP V F+Q++ Y+D+D KAGRSLFYYFVEAE +P    LT+WL  G  
Sbjct  29   FPMNDLIEKLPGQPNVTFRQFSDYIDIDEKAGRSLFYYFVEAEKDPMNLSLTIWL-TGGP  87

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  464
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTSSDY  G
Sbjct  88   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSSDYEVG  147

Query  465  DASTASDMHIFMV  503
            D ST  D+  F++
Sbjct  148  DDSTNKDLLTFIL  160



>gb|KDO66312.1| hypothetical protein CISIN_1g039871mg [Citrus sinensis]
Length=503

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E+D +  LPGQP  +GF QYAGYV VD +AGR+LFYYFVE+  N    PL LWLNGG GC
Sbjct  87   EQDKINALPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLNGGPGC  146

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS G GA TELGPF    DG+ L +N  +WN  +N++F+ESPAGVG+SYSNT+SDY   G
Sbjct  147  SSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSDYDHAG  206

Query  465  DASTASDMHIFMV  503
            D STA+D + F+V
Sbjct  207  DNSTAADSYTFLV  219



>gb|KDP38392.1| hypothetical protein JCGZ_04317 [Jatropha curcas]
Length=359

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP +V F QYAGYV VD K GR+LFYYFVE+  N   KPL LWL+GG GC
Sbjct  69   KADKIDSLPGQPQRVNFDQYAGYVTVDPKNGRALFYYFVESPHNSSTKPLVLWLSGGPGC  128

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SS+G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+S+SNTSSDYI GD
Sbjct  129  SSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANIIFLESPAGVGFSHSNTSSDYITGD  188

Query  468  ASTASDMHIFMV  503
              TA D + F++
Sbjct  189  KKTAEDSYTFLI  200



>ref|XP_006470494.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=503

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E+D +  LPGQP  +GF QYAGYV VD +AGR+LFYYFVE+  N    PL LWLNGG GC
Sbjct  87   EQDKINALPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLNGGPGC  146

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS G GA TELGPF    DG+ L +N  +WN  +N++F+ESPAGVG+SYSNT+SDY   G
Sbjct  147  SSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSDYDHAG  206

Query  465  DASTASDMHIFMV  503
            D STA+D + F+V
Sbjct  207  DNSTAADSYTFLV  219



>gb|KJB63052.1| hypothetical protein B456_009G451300 [Gossypium raimondii]
Length=342

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +3

Query  117  DLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P ++PLT+WL  G    S
Sbjct  3    DLINKLPGQPDVNFRQFAGYIDVDENVDGRSLFYYFVEAEKDPMIQPLTVWL-TGGPGCS  61

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAS  473
              G  F  +GPF  T D  GL++N  SWNK SNLLF++SP G GWSYSNTSSDY  GD +
Sbjct  62   SVGDGFASVGPFIVTKDVHGLQKNLFSWNKVSNLLFIDSPIGSGWSYSNTSSDYDNGDDA  121

Query  474  TASDMHIFM  500
            T + +  FM
Sbjct  122  TNTILLTFM  130



>ref|XP_006578498.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=545

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP  V F QY+GYV VD +AGR+LFYYFVE+  NP  KPL LWLNGG GC
Sbjct  125  EADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNGGPGC  184

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L RN  +WN  +N+LF+ESPAGVG+SYSNT SDY   G
Sbjct  185  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSYSNTISDYEHSG  244

Query  465  DASTASDMHIFMV  503
            D STA D ++F++
Sbjct  245  DKSTAKDAYVFLI  257



>ref|XP_002298413.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
 gb|EEE83218.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
Length=496

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D ++ LPGQPKV F QY GYV VD  AGR+L+YYFVEA+ +    PL LWLNGG GCS
Sbjct  70   EKDRIESLPGQPKVEFSQYGGYVTVDKSAGRALYYYFVEAQHSKESSPLLLWLNGGPGCS  129

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  130  SLAYGAMQELGPFRVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDYEKSGD  189

Query  468  ASTASDMHIFMV  503
              TA D ++F+V
Sbjct  190  KRTAEDNYVFLV  201



>gb|KDP38391.1| hypothetical protein JCGZ_04316 [Jatropha curcas]
Length=488

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP+ V F QYAGYV VD + GR+LFYYFVE+  N   KPL LWLNGG GC
Sbjct  68   KADKIGSLPGQPQGVDFDQYAGYVTVDPENGRALFYYFVESPYNSSTKPLVLWLNGGPGC  127

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDYI GD
Sbjct  128  SSFGYGAMEELGPFRVNSDGKTLYRNKYAWNNVANVIFLESPAGVGFSYSNTSSDYITGD  187

Query  468  ASTASDMHIFMV  503
              TA D + F+V
Sbjct  188  KKTAEDSYTFLV  199



>emb|CBI29056.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            + D VK LPGQP+VGF+QYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGG GCS
Sbjct  35   KADRVKKLPGQPEVGFRQYAGYVTVNESHGRALFYWFFEATQNPHQKPLLLWLNGGPGCS  94

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+G GA  ELGPF+P  DG+ L+ N  +WNKA+NLLFVESP GVG+SY+NTSSD    GD
Sbjct  95   SIGFGATEELGPFFPRRDGK-LKFNPHTWNKAANLLFVESPVGVGFSYTNTSSDIDQLGD  153

Query  468  ASTASDMHIFMV  503
              TA D + F++
Sbjct  154  TITAKDSYAFLI  165



>gb|KHN46300.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGG G
Sbjct  25   EGDKVKALPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLVLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  461
            CSS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  85   CSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  144

Query  462  GDASTASDMHIFMV  503
            GD STA D + F++
Sbjct  145  GDKSTAMDSYTFLL  158



>ref|XP_008363303.1| PREDICTED: serine carboxypeptidase-like 40 [Malus domestica]
Length=502

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +  LPGQPKV F QY GYV VD KAGR+LFYY VEAE      PL LWLNGG GCS
Sbjct  75   EKDRIDKLPGQPKVKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLNGGPGCS  134

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  135  SLAYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNRTSDYDASGD  194

Query  468  ASTASDMHIFMV  503
             +TA+D ++F+V
Sbjct  195  RNTAADNYVFLV  206



>ref|XP_008224993.1| PREDICTED: serine carboxypeptidase-like 31 [Prunus mume]
Length=484

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            +DLV  LPGQP V FK YAGYV V+   GR+LFY+F EA  NP  KPL LWLNGG GCSS
Sbjct  44   QDLVTNLPGQPAVDFKHYAGYVTVNQTNGRALFYWFYEAATNPDAKPLVLWLNGGPGCSS  103

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGDA  470
            VG GA  E+GPF    DG G+R N+ SWNK +N+LF+ESP GVG+SYSNT+SDY+  GD 
Sbjct  104  VGYGATQEIGPFIVDTDGHGIRFNNYSWNKEANMLFLESPVGVGFSYSNTTSDYVNLGDV  163

Query  471  STASDMHIFM  500
             TA+D + F+
Sbjct  164  FTANDAYTFL  173



>ref|XP_010655923.1| PREDICTED: serine carboxypeptidase-like 34 [Vitis vinifera]
Length=504

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            + D VK LPGQP+VGF+QYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGG GCS
Sbjct  58   KADRVKKLPGQPEVGFRQYAGYVTVNESHGRALFYWFFEATQNPHQKPLLLWLNGGPGCS  117

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+G GA  ELGPF+P  DG+ L+ N  +WNKA+NLLFVESP GVG+SY+NTSSD    GD
Sbjct  118  SIGFGATEELGPFFPRRDGK-LKFNPHTWNKAANLLFVESPVGVGFSYTNTSSDIDQLGD  176

Query  468  ASTASDMHIFMV  503
              TA D + F++
Sbjct  177  TITAKDSYAFLI  188



>gb|KHN35601.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=495

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP  V F QY+GYV VD +AGR+LFYYFVE+  NP  KPL LWLNGG GC
Sbjct  71   EADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNGGPGC  130

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L RN  +WN  +N+LF+ESPAGVG+SYSNT SDY   G
Sbjct  131  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSYSNTISDYEHSG  190

Query  465  DASTASDMHIFMV  503
            D STA D ++F++
Sbjct  191  DKSTAKDAYVFLI  203



>ref|XP_010261659.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=484

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 97/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D +  LPGQP V F QY GYV VD  AGR+LFYYFVEA  +   +PL LWLNGG GCS
Sbjct  67   ESDRISMLPGQPSVNFNQYGGYVTVDGSAGRALFYYFVEAP-DAMSRPLVLWLNGGPGCS  125

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  467
            S+G GA TELGPF    DGR L RN  +WN+ +N+LF+ESPAGVG+SYSNTSSDY   GD
Sbjct  126  SLGDGAMTELGPFRVQSDGRTLYRNPYAWNQVANVLFLESPAGVGFSYSNTSSDYSTRGD  185

Query  468  ASTASDMHIFMV  503
             STA D ++F+V
Sbjct  186  QSTAEDNYVFLV  197



>ref|XP_011008273.1| PREDICTED: serine carboxypeptidase-like 40 [Populus euphratica]
Length=496

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D ++ LPGQPKV F QY GYV VD  AGR+L+YYFVEA+ +    PL LWLNGG GCS
Sbjct  70   EKDRIESLPGQPKVEFSQYGGYVTVDKSAGRALYYYFVEAQHSKESSPLLLWLNGGPGCS  129

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  130  SLAYGAMQELGPFRVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDYEKSGD  189

Query  468  ASTASDMHIFMV  503
              TA D ++F+V
Sbjct  190  KRTAEDNYVFLV  201



>ref|XP_008220190.1| PREDICTED: serine carboxypeptidase II-3-like [Prunus mume]
Length=490

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D ++ LPGQP  V F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGG GC
Sbjct  76   EADKIEALPGQPAGVNFDQYAGYVTVDPKAGRALFYYFVESPHNSSTKPLVLWLNGGPGC  135

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GA  ELGPF  + D R L RN  +WNK +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  136  SSLGYGAMEELGPFRVSSDNRTLYRNDYAWNKVANVIFLESPAGVGFSYSNTSSDYESVG  195

Query  465  DASTASDMHIFMV  503
            D  TA D + F+V
Sbjct  196  DKQTAKDSYTFLV  208



>ref|XP_009794620.1| PREDICTED: putative serine carboxypeptidase-like 23 [Nicotiana 
sylvestris]
Length=512

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            EED +  LPGQP  V F QY+GYV VD  AGR+LFYYF E+  +P  KPL LWLNGG GC
Sbjct  95   EEDKISALPGQPSGVNFDQYSGYVTVDADAGRALFYYFTESTQDPSTKPLVLWLNGGPGC  154

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SS+G GA  ELGPF    DG+ L  N  +WN  +N+LF+ESPAGVG+SYSNTSSDYI GD
Sbjct  155  SSLGAGAMMELGPFRVNKDGKTLWLNPFAWNNVANILFLESPAGVGFSYSNTSSDYITGD  214

Query  468  ASTASDMHIFMV  503
              T  D   F+V
Sbjct  215  EKTRQDSFTFLV  226



>ref|XP_004293521.1| PREDICTED: serine carboxypeptidase-like 31 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            +DLV  LPGQP V F+ YAGYV+V+   GR+LFY+F EA  NP LKPL LWLNGG GCSS
Sbjct  40   QDLVTNLPGQPAVDFQHYAGYVNVNETNGRALFYWFYEAATNPDLKPLVLWLNGGPGCSS  99

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGDA  470
            VG GA  E+GPF    DG GLR N+ SWN+ +NLLF+ESP GVG+SYSNT++DY   GDA
Sbjct  100  VGYGATQEIGPFIVGTDGHGLRFNNYSWNQEANLLFLESPVGVGFSYSNTTTDYDNLGDA  159

Query  471  STASDMHIFM  500
             TA+D + F+
Sbjct  160  FTANDAYAFL  169



>gb|EPS67442.1| hypothetical protein M569_07330, partial [Genlisea aurea]
Length=408

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  117  DLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcssv  296
            DLV GLPGQP V FK YAGYV V+   GR+LFY+F EA   P+ KPL LWLNGG GCSS+
Sbjct  25   DLVIGLPGQPPVSFKHYAGYVTVNPIHGRALFYWFFEASRTPQRKPLVLWLNGGPGCSSI  84

Query  297  gggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDAS  473
            G G   ELGPF+P  D   L+ NS SWN  +NLLF+ESP GVG+SYSNTSSDY + GD S
Sbjct  85   GYGEAEELGPFFPQPDIPSLKLNSHSWNNVANLLFLESPIGVGFSYSNTSSDYNLLGDKS  144

Query  474  TASDMHIFMV  503
            TA D + F+V
Sbjct  145  TADDTYRFLV  154



>ref|XP_007146042.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
 gb|ESW18036.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
Length=489

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQ   V F QY+GYV VD +AGR+LFYYFVE+  NP  KPL LWLNGG GC
Sbjct  70   QADKIVALPGQSYGVNFDQYSGYVTVDPEAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNTSSDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTSSDYDHAG  189

Query  465  DASTASDMHIFMV  503
            D STA D ++F++
Sbjct  190  DKSTAKDAYVFLI  202



>ref|XP_009354385.1| PREDICTED: serine carboxypeptidase-like 40 [Pyrus x bretschneideri]
Length=502

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +  LPGQP V F QY GYV VD KAGR+LFYY VEAE      PL LWLNGG GCS
Sbjct  75   EKDRIDKLPGQPNVKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLNGGPGCS  134

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  135  SLAYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNRTSDYDASGD  194

Query  468  ASTASDMHIFMV  503
             +TA+D ++F+V
Sbjct  195  RNTAADNYVFLV  206



>gb|KJB62986.1| hypothetical protein B456_009G446600 [Gossypium raimondii]
Length=435

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = +3

Query  117  DLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P  +PLT+WL  G    S
Sbjct  3    DLISKLPGQPDVNFRQFAGYIDVDENVVGRSLFYYFVEAEKDPLTQPLTVWL-TGGPGCS  61

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAS  473
              G AF  +GPF  T D  GL+ N  SWNK SNLLF++SP G GWSYSNTSSDY  GD S
Sbjct  62   SVGDAFGSVGPFIVTKDAHGLQTNILSWNKVSNLLFIDSPIGSGWSYSNTSSDYNNGDDS  121

Query  474  TASDMHIFM  500
            T   +  FM
Sbjct  122  TNKILLTFM  130



>ref|XP_003544446.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Glycine 
max]
Length=495

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   +PL LWLNGG G
Sbjct  75   EGDKVKALPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNRPLVLWLNGGPG  134

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  461
            CSS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  135  CSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  194

Query  462  GDASTASDMHIFMV  503
            GD STA D + F++
Sbjct  195  GDKSTAMDSYTFLL  208



>gb|KJB63053.1| hypothetical protein B456_009G451300 [Gossypium raimondii]
Length=443

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +3

Query  117  DLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P ++PLT+WL  G    S
Sbjct  3    DLINKLPGQPDVNFRQFAGYIDVDENVDGRSLFYYFVEAEKDPMIQPLTVWL-TGGPGCS  61

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAS  473
              G  F  +GPF  T D  GL++N  SWNK SNLLF++SP G GWSYSNTSSDY  GD +
Sbjct  62   SVGDGFASVGPFIVTKDVHGLQKNLFSWNKVSNLLFIDSPIGSGWSYSNTSSDYDNGDDA  121

Query  474  TASDMHIFM  500
            T + +  FM
Sbjct  122  TNTILLTFM  130



>ref|XP_010279514.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=491

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D+++ LPGQP VGFKQY GYV VD  AGR+LFYYF EA+ + + KPL LWLNGG GCS
Sbjct  70   EKDMIERLPGQPPVGFKQYGGYVTVDESAGRALFYYFAEAQ-DAKSKPLLLWLNGGPGCS  128

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S G GA  ELGPF    DG+ L  N  SWN+ +N++F+ESPAGVG+SYSN +SDY   GD
Sbjct  129  SFGYGAMVELGPFRVHSDGKTLYENHYSWNRVANVVFLESPAGVGFSYSNKTSDYNTRGD  188

Query  468  ASTASDMHIFMV  503
             +TA D ++F+V
Sbjct  189  GNTAQDNYVFLV  200



>gb|KJB62985.1| hypothetical protein B456_009G446500 [Gossypium raimondii]
Length=469

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggs  281
            +   DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P  +PLT+WL GG 
Sbjct  23   FSMNDLISKLPGQPDVNFRQFAGYIDVDENVVGRSLFYYFVEAEKDPLTQPLTVWLTGGP  82

Query  282  gcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC  461
            GCSSVG  AF  +GPF  T D  GL+ N  SWNK SNLLF++SP G GWSYSNTSSDY  
Sbjct  83   GCSSVGD-AFGSVGPFIVTKDAHGLQTNILSWNKVSNLLFIDSPIGSGWSYSNTSSDYNN  141

Query  462  GDASTASDMHIFM  500
            GD ST   +  FM
Sbjct  142  GDDSTNKILLTFM  154



>gb|KHN12757.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGG G
Sbjct  25   EGDKVKALPGQPAQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLVLWLNGGPG  84

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  461
            CSS G GA  ELGPF    DGR L  N  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  85   CSSFGYGAMQELGPFRVNSDGRTLYTNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  144

Query  462  GDASTASDMHIFMV  503
            GD STA D + F++
Sbjct  145  GDKSTAMDSYTFLL  158



>ref|XP_006595959.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Glycine 
max]
Length=531

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   +PL LWLNGG G
Sbjct  75   EGDKVKALPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNRPLVLWLNGGPG  134

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  461
            CSS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  135  CSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  194

Query  462  GDASTASDMHIFMV  503
            GD STA D + F++
Sbjct  195  GDKSTAMDSYTFLL  208



>ref|NP_001242872.1| uncharacterized protein LOC100820473 precursor [Glycine max]
 gb|ACU18820.1| unknown [Glycine max]
Length=496

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGG G
Sbjct  76   EGDKVKALPGQPAQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLVLWLNGGPG  135

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  461
            CSS G GA  ELGPF    DGR L  N  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  136  CSSFGYGAMQELGPFRVNSDGRTLYTNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  195

Query  462  GDASTASDMHIFMV  503
            GD STA D + F++
Sbjct  196  GDKSTAMDSYTFLL  209



>emb|CDP08509.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 96/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP  V F QY+GYV VD KAGR+LFYYF E++ N   KPL LWLNGG GC
Sbjct  68   EADRITTLPGQPNAVNFDQYSGYVTVDPKAGRALFYYFAESQ-NSSAKPLVLWLNGGPGC  126

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SS+G GA TELGPF    DG  L  N  +WN  +N+LF+ESPAGVG+SYSNTSSDYI GD
Sbjct  127  SSIGAGAMTELGPFRVNKDGSTLWLNPYAWNTVANVLFLESPAGVGFSYSNTSSDYITGD  186

Query  468  ASTASDMHIFMV  503
              TA+D + F+V
Sbjct  187  TKTAADSYTFLV  198



>ref|XP_011025505.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Populus 
euphratica]
Length=453

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D ++ LPGQPKV F QY GYV VD  AGR+L+YYF EA+ +    PL LWLNGG GCS
Sbjct  72   EKDRIESLPGQPKVEFSQYGGYVTVDESAGRALYYYFAEAQHSKESLPLLLWLNGGPGCS  131

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  132  SLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGD  191

Query  468  ASTASDMHIFMV  503
              TA D ++F+V
Sbjct  192  KMTAEDNYVFLV  203



>ref|XP_011025504.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Populus 
euphratica]
Length=498

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D ++ LPGQPKV F QY GYV VD  AGR+L+YYF EA+ +    PL LWLNGG GCS
Sbjct  72   EKDRIESLPGQPKVEFSQYGGYVTVDESAGRALYYYFAEAQHSKESLPLLLWLNGGPGCS  131

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  132  SLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGD  191

Query  468  ASTASDMHIFMV  503
              TA D ++F+V
Sbjct  192  KMTAEDNYVFLV  203



>gb|KJB49314.1| hypothetical protein B456_008G112500 [Gossypium raimondii]
Length=482

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +  LPGQP V F QY GYV VD KAGR+L+YYFVEA+ +    PL LWLNGG GCS
Sbjct  52   EKDRIPKLPGQPHVRFSQYGGYVTVDKKAGRALYYYFVEAQQSKESLPLLLWLNGGPGCS  111

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  E+GPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  112  SLAYGAMEEIGPFRVHSDGKTLYRNRYSWNHAANVLFLESPAGVGFSYSNTTSDYDRSGD  171

Query  468  ASTASDMHIFMV  503
            + T  D ++F++
Sbjct  172  SKTVVDNYVFLI  183



>ref|XP_010042631.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
Length=214

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D++K LPGQP V F  Y GYV VD  AGR+ +YYFVE   N    PL LWLNGG G S
Sbjct  9    EKDMIKRLPGQPPVKFDHYGGYVTVDELAGRAFYYYFVEGVRNKESMPLLLWLNGGPGAS  68

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+G GA  ELGPF    DG+ L +N  +WN A+N+LF+ESPAGVG+SYSNT++DY   GD
Sbjct  69   SLGYGAMQELGPFRVHSDGKTLYKNKFAWNNAANVLFLESPAGVGFSYSNTTADYSSSGD  128

Query  468  ASTASDMHIFMV  503
            + TA+D ++F++
Sbjct  129  SKTAADNYVFLL  140



>ref|XP_002282331.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera]
Length=488

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            ++D ++ LPGQP+ V F QYAGYV VD KAGR+LFYYFVE+  +   KPL LWLNGG GC
Sbjct  74   QDDKIESLPGQPEGVNFDQYAGYVTVDPKAGRALFYYFVESPEDSSTKPLVLWLNGGPGC  133

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS+G GA  ELGPF    DG+ L RN  +WN  SN++F+ESPAGVG+SYSNTSSDY+  G
Sbjct  134  SSLGYGAMEELGPFRVNPDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDYVNVG  193

Query  465  DASTASDMHIFMV  503
            D  TA D + F++
Sbjct  194  DKKTAEDSYTFLI  206



>ref|XP_003592237.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601334.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 gb|AES71585.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP  V F QY+GYV VD +AGR LFYYFVE+  N   KPL LWLNGG GC
Sbjct  74   QADKIDTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPYNSSTKPLVLWLNGGPGC  133

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  134  SSLGYGAFQELGPFRINSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTTSDYDKSG  193

Query  465  DASTASDMHIFMV  503
            D STA D ++F+V
Sbjct  194  DKSTAKDTYVFLV  206



>gb|KDO83297.1| hypothetical protein CISIN_1g015244mg [Citrus sinensis]
Length=410

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D ++ LPGQP+V F QY GYV VD  AGR+++YYFVEA+ +    PL LWLNGG GCS
Sbjct  71   ENDRIEKLPGQPEVEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGGPGCS  130

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  131  SLAYGAMQELGPFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYDESGD  190

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  191  RKTAADNYMFLV  202



>ref|XP_006853073.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
 gb|ERN14540.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
Length=494

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            ++++V GL GQP+ V FKQYAGYV +D  AGR+LFYYF EA V+P  KPL LWLNGG GC
Sbjct  71   KDEIVGGLHGQPEGVEFKQYAGYVTLDETAGRALFYYFAEA-VDPLSKPLLLWLNGGPGC  129

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GA  ELGPF    DG+ L +N  +WNKA+N+LF+ESPAGVG+SYSNT+SDY + G
Sbjct  130  SSLGYGAMEELGPFRVQSDGKTLYKNRYAWNKAANVLFLESPAGVGFSYSNTTSDYELSG  189

Query  465  DASTASDMHIFMV  503
            D+ TASD + F++
Sbjct  190  DSRTASDAYTFLI  202



>ref|XP_009592794.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=499

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D ++ LPGQP+V F+QY GYV VD  AGR+ +YYFVEA+ +    PL LWLNGG GCS
Sbjct  76   ENDKIQKLPGQPRVRFEQYGGYVTVDESAGRAFYYYFVEAQRSKDSLPLLLWLNGGPGCS  135

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GAF ELGPF    DG+ L +N  +WN A+N+LF+ESPAGVG+SYSNTSSD  I GD
Sbjct  136  SLAYGAFQELGPFRVNSDGKTLHKNKFAWNHAANVLFLESPAGVGFSYSNTSSDVKIGGD  195

Query  468  ASTASDMHIFMV  503
              TA D + F+V
Sbjct  196  RKTAKDNYQFLV  207



>ref|XP_001751694.1| predicted protein [Physcomitrella patens]
 gb|EDQ83129.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  120  LVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEV-NPRLKPLTLWLNggsgcssv  296
             ++ LPG P V F   +GY+ VD KAGR+LFY+FVEA+V +    PLTLWLNGG GCSSV
Sbjct  56   FIESLPGAPPVPFAMRSGYITVDEKAGRALFYWFVEADVADSASAPLTLWLNGGPGCSSV  115

Query  297  gggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAST  476
            GGG  +ELGPFYPT +GR L +N  SWNK SN+LF+ESPAGVG+SYSNT+ DY  GD  T
Sbjct  116  GGGMLSELGPFYPTPNGRHLLKNPYSWNKVSNMLFLESPAGVGFSYSNTTDDYRTGDQQT  175

Query  477  ASDMHIFMV  503
            A D +IF++
Sbjct  176  AQDSYIFLL  184



>ref|XP_007220730.1| hypothetical protein PRUPE_ppa023387mg, partial [Prunus persica]
 gb|EMJ21929.1| hypothetical protein PRUPE_ppa023387mg, partial [Prunus persica]
Length=251

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +  LPGQP V F QY GYV VD +AGR+ FYYF EAE      PL LWLNGG GCS
Sbjct  69   EKDRIDILPGQPHVNFSQYGGYVTVDKEAGRAFFYYFAEAEKAKDSSPLLLWLNGGPGCS  128

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  467
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  129  SLAYGAMLELGPFRIHSDGKTLYQNKFSWNYAANVLFLESPAGVGFSYSNKTSDYDANGD  188

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  189  RRTAADNYVFLV  200



>gb|KEH40059.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E+D VK LPGQPK V F QYAGYV VD K GR LFYYFVE+ +N   KPL LWLNGG GC
Sbjct  86   EDDKVKALPGQPKGVDFDQYAGYVTVDSKGGRELFYYFVESSLNSSTKPLILWLNGGPGC  145

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS G GA  ELGPF    DG  L  N  +WNK +N++F+ESPAGVG+SYS  S DY   G
Sbjct  146  SSFGYGAMQELGPFRVNSDGTTLSLNKDAWNKVANIIFLESPAGVGFSYSKNSLDYSNIG  205

Query  465  DASTASDMHIFMV  503
            D STA D +IF++
Sbjct  206  DNSTAKDSYIFLL  218



>emb|CDP19962.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +3

Query  117  DLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            D +  LPG+PK V F QY+GYV VD KAGR+LFYYF E++ NP  KPL LWLNGG GCSS
Sbjct  263  DKITALPGEPKGVNFDQYSGYVTVDPKAGRALFYYFAESQ-NPSTKPLVLWLNGGPGCSS  321

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAS  473
            +G GA  ELGPF  T  G+ L +N  +WN  +N++F+ESPAGVG+SYSNTSSDYI GD  
Sbjct  322  LGAGAMNELGPFRVTKGGKMLWKNPYAWNNVANIIFLESPAGVGFSYSNTSSDYITGDTK  381

Query  474  TASDMHIFMV  503
            +A+D + F+V
Sbjct  382  SAADAYTFLV  391



>ref|XP_010041326.1| PREDICTED: serine carboxypeptidase II-3-like [Eucalyptus grandis]
 gb|KCW44445.1| hypothetical protein EUGRSUZ_L02059 [Eucalyptus grandis]
Length=482

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP  V F QYAGYV V+ KAGR+LFYYFVE+  N   KPL LWLNGG GC
Sbjct  68   EADKITALPGQPDGVDFDQYAGYVTVNPKAGRALFYYFVESPQNSSTKPLVLWLNGGPGC  127

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS+G GA  ELGPF    DG+ L RN+ +WN  +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  128  SSLGYGAMEELGPFRVHSDGKTLYRNNYAWNNVANVIFLESPAGVGFSYSNTSSDYAKAG  187

Query  465  DASTASDMHIFMV  503
            D STA D + F+V
Sbjct  188  DNSTADDSYTFLV  200



>gb|KCW66184.1| hypothetical protein EUGRSUZ_F00022 [Eucalyptus grandis]
Length=480

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP  V F QYAGYV V+ KAGR+LFYYFVE+  N   KPL LWLNGG GC
Sbjct  68   EADKITALPGQPDGVDFDQYAGYVTVNPKAGRALFYYFVESPQNSSTKPLVLWLNGGPGC  127

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS+G GA  ELGPF    DG+ L RN+ +WN  +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  128  SSLGYGAMEELGPFRVHSDGKTLYRNNYAWNNVANVIFLESPAGVGFSYSNTSSDYAKAG  187

Query  465  DASTASDMHIFMV  503
            D STA D + F+V
Sbjct  188  DNSTADDSYTFLV  200



>gb|EYU37705.1| hypothetical protein MIMGU_mgv1a005479mg [Erythranthe guttata]
Length=482

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D +  LPGQP+V F QY+GYV VD  AGR+LFYYF E+E +   KPL LWLNGG GCS
Sbjct  70   EVDKILSLPGQPQVNFSQYSGYVTVDPIAGRALFYYFTESE-DSSTKPLVLWLNGGPGCS  128

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  470
            S+G GA TELGPF    DG+ L  N  +WN  +N++F+ESPAGVG+SYSN SSDYI GD 
Sbjct  129  SLGAGAMTELGPFRVNPDGKTLWLNKNAWNNEANVVFLESPAGVGFSYSNRSSDYITGDK  188

Query  471  STASDMHIFMV  503
             TA+D + F+V
Sbjct  189  QTAADAYTFVV  199



>emb|CDP08504.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPG+P  V F QY+GYV VD KAGR+LFYYF E++ N   KPL LWLNGG GC
Sbjct  69   EADKITTLPGEPNGVNFDQYSGYVTVDPKAGRALFYYFAESQ-NSSTKPLVLWLNGGPGC  127

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  467
            SS+G GA TELGPF  +  G+ L +N  +WN  +N+LF+ESPAGVG+SYSNTSSDYI GD
Sbjct  128  SSLGAGAMTELGPFRVSKGGKTLWKNPYAWNNVANVLFLESPAGVGFSYSNTSSDYITGD  187

Query  468  ASTASDMHIFMV  503
              TA+D + F+V
Sbjct  188  TKTAADSYTFLV  199



>ref|XP_002521402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40892.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            E LV  LPGQP V F+QYAGYV V+ K GR+LFY+F EA  +P  KPL LWLNGG GCSS
Sbjct  43   EHLVTNLPGQPAVDFRQYAGYVTVNEKNGRALFYWFYEATTHPDEKPLVLWLNGGPGCSS  102

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  470
            VG GA  E+GPF    DG GL+ N  SWNK +N+LF+ESP GVG+SYSNT+SDY + GD 
Sbjct  103  VGYGATQEIGPFLVDNDGHGLKYNPYSWNKEANMLFLESPVGVGFSYSNTTSDYSVLGDD  162

Query  471  STASDMHIFM  500
             TA+D + F+
Sbjct  163  FTANDAYAFL  172



>ref|XP_007223971.1| hypothetical protein PRUPE_ppa014620mg, partial [Prunus persica]
 gb|EMJ25170.1| hypothetical protein PRUPE_ppa014620mg, partial [Prunus persica]
Length=557

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK--VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsg  284
            E D ++ LPGQP   V F QYAGYV VD +AGR+LFYYFVE+  N   KPL LWLNGG G
Sbjct  87   EADKIEALPGQPAEGVNFDQYAGYVTVDPRAGRALFYYFVESPHNSSTKPLVLWLNGGPG  146

Query  285  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-IC  461
            CSS+G GA  ELGPF  + D + L RN  +WNK +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  147  CSSLGYGAMEELGPFRVSSDNKTLYRNDYAWNKVANVIFLESPAGVGFSYSNTSSDYESV  206

Query  462  GDASTASDMHIFMV  503
            GD  TA D + F+V
Sbjct  207  GDKQTAKDSYTFLV  220



>gb|KDO75846.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
 gb|KDO75847.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
Length=318

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            EDLV  LPGQP V F+ YAGYV V+   GR+LFY+F EA   P+ KPL LWLNGG GCSS
Sbjct  46   EDLVTNLPGQPNVDFRHYAGYVTVNEHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCSS  105

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  470
            VG GA  E+GPF    DGRGL+ N  +WNK +N+LF+ESP GVG+SYSNT++DY + GD 
Sbjct  106  VGYGATQEIGPFLVDTDGRGLQFNPYAWNKEANMLFLESPIGVGFSYSNTTNDYEMLGDD  165

Query  471  STASDMHIFM  500
             TA+D + F+
Sbjct  166  FTANDSYTFL  175



>ref|XP_007212080.1| hypothetical protein PRUPE_ppa005035mg [Prunus persica]
 gb|EMJ13279.1| hypothetical protein PRUPE_ppa005035mg [Prunus persica]
Length=480

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            +DLV  LPGQP V FK YAGYV V+   GR+LFY+F EA  NP  KPL LWLNGG GCSS
Sbjct  44   QDLVTNLPGQPAVDFKHYAGYVTVNQTNGRALFYWFYEAATNPDAKPLVLWLNGGPGCSS  103

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGDA  470
            VG GA  E+GPF    DG G+R N+ SWNK +N+LF+ESP GVG+SYSNT+SDY   GD 
Sbjct  104  VGYGATQEIGPFIVDTDGHGIRFNNYSWNKEANMLFLESPVGVGFSYSNTTSDYENLGDV  163

Query  471  STASDMHIFM  500
             TA+D + F+
Sbjct  164  FTANDAYNFL  173



>ref|XP_004303115.1| PREDICTED: serine carboxypeptidase-like 40 [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 5/135 (4%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLK---PLTLWLNggs  281
            E+D +  LPGQPKV F QY GYV VD KAGR+ FYYF EAE + + K   PL LWLNGG 
Sbjct  75   EKDRITSLPGQPKVNFNQYGGYVTVDKKAGRAFFYYFAEAE-DQQAKDSLPLLLWLNGGP  133

Query  282  gcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-I  458
            GCSS+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSNT+SDY  
Sbjct  134  GCSSLAYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNTTSDYDK  193

Query  459  CGDASTASDMHIFMV  503
             GD  TA+D ++F+V
Sbjct  194  SGDRRTAADNYVFLV  208



>ref|XP_006438918.1| hypothetical protein CICLE_v10031327mg [Citrus clementina]
 gb|ESR52158.1| hypothetical protein CICLE_v10031327mg [Citrus clementina]
Length=497

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D ++ LPGQP+V F QY GYV VD  AGR+++YYFVEA+ +    PL LWLNGG GCS
Sbjct  71   ENDRIEKLPGQPEVEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGGPGCS  130

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  131  SLAYGAMQELGPFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYDESGD  190

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  191  RKTAADNYMFLV  202



>ref|XP_006482952.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=497

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D ++ LPGQP+V F QY GYV VD  AGR+++YYFVEA+ +    PL LWLNGG GCS
Sbjct  71   ENDRIEKLPGQPEVEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGGPGCS  130

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  131  SLAYGAMQELGPFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYDESGD  190

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  191  RKTAADNYMFLV  202



>gb|EAZ09402.1| hypothetical protein OsI_31676 [Oryza sativa Indica Group]
Length=464

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +3

Query  117  DLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            D +  LPGQPK VGF QY GYV VD   GR+LFYYFVEA  +   KPL LWLNGG GCSS
Sbjct  79   DKITALPGQPKGVGFNQYGGYVTVDEMNGRALFYYFVEATTDAAAKPLLLWLNGGPGCSS  138

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  470
            VG GA  ELGPF    D + L RN  +WN  +N+LF+ESPAGVG+SYSNTSSDY   GD 
Sbjct  139  VGYGAMIELGPFRINSDNKTLSRNEYAWNNVANVLFLESPAGVGFSYSNTSSDYDKSGDQ  198

Query  471  STASDMHIFMV  503
             TA+D +IF+V
Sbjct  199  RTANDSYIFLV  209



>gb|KJB79850.1| hypothetical protein B456_013G069700 [Gossypium raimondii]
Length=491

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D V  LPGQP VGFKQYAGYV V+ K GR+LFY+F EA   P+ +PL LWLNGG GCS
Sbjct  48   EADRVTKLPGQPTVGFKQYAGYVTVNEKHGRALFYWFFEATSEPQKRPLLLWLNGGPGCS  107

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGD  467
            S+G G   ELGPF+P  D + L+ N   WNKA+NLLFVESP GVG+SY+NTS D    GD
Sbjct  108  SIGYGQAEELGPFFPKKDQQTLKLNPHRWNKAANLLFVESPVGVGFSYTNTSRDLKELGD  167

Query  468  ASTASDMHIFMV  503
              TA D + F+V
Sbjct  168  EITAKDSYAFLV  179



>ref|XP_011088748.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase II-3-like 
[Sesamum indicum]
Length=468

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D +  LPGQP+V F QY+GYV VD  AGR+LFY+F   + +P  KPL LWLNGG GCS
Sbjct  52   EADEITDLPGQPQVSFSQYSGYVTVDPVAGRALFYWFTXCDDSPN-KPLVLWLNGGPGCS  110

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  470
            S+G GA TELGPF    DG+ L  N   WN  +N+LF+ESPAGVG+SYSNTSSDY+ GD 
Sbjct  111  SIGSGAMTELGPFRVNPDGKTLWYNKNGWNTVANILFLESPAGVGFSYSNTSSDYVTGDT  170

Query  471  STASDMHIFMV  503
             TA+D + F++
Sbjct  171  RTAADSYTFLL  181



>ref|XP_010279510.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=493

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +K LPGQP V F QY GYV VD  AGR+L+YYF E+  N + KPL LWLNGG GCS
Sbjct  67   EKDRIKRLPGQPPVRFSQYGGYVTVDESAGRALYYYFAESHYNKKSKPLLLWLNGGPGCS  126

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  467
            S+G GA  ELGPF    DG+ L  N  +WNK +N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  127  SLGYGAMEELGPFRVKSDGKTLYENPFAWNKVANVLFLESPAGVGFSYSNRTSDYATRGD  186

Query  468  ASTASDMHIFMV  503
             +TA D ++F+V
Sbjct  187  RNTAEDNYVFLV  198



>ref|XP_009368057.1| PREDICTED: serine carboxypeptidase-like 40 [Pyrus x bretschneideri]
Length=502

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            +D +  LPGQP V F QY GYV VD KAGR++FYY VEAE      PL LWLNGG GCSS
Sbjct  76   KDRIVKLPGQPNVKFSQYGGYVTVDKKAGRAMFYYLVEAEQAKDSSPLLLWLNGGPGCSS  135

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  470
            +  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD 
Sbjct  136  LAYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNRTSDYDASGDR  195

Query  471  STASDMHIFMV  503
            +TA+D ++F+V
Sbjct  196  NTAADNYVFLV  206



>ref|XP_008231546.1| PREDICTED: serine carboxypeptidase-like 40 [Prunus mume]
Length=500

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +  LPGQP V F QY GYV VD +AGR+LFYYFVEAE       L LWLNGG GCS
Sbjct  73   EKDRIGSLPGQPHVNFSQYGGYVTVDKEAGRALFYYFVEAEKTKDSSRLLLWLNGGPGCS  132

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+G GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  133  SLGYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNKTSDYDASGD  192

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  193  RITAADNYVFLV  204



>gb|AAQ63884.1| putative serine carboxypeptidase [Medicago truncatula]
Length=495

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  108  PEEDL-----VKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWL  269
            P+E+L     +  LPGQP  V F QY+GYV VD +AGR LFYYFVE+  N   KPL LWL
Sbjct  68   PQEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWL  127

Query  270  NggsgcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSS  449
            NGG GCSS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNTSS
Sbjct  128  NGGPGCSSLGYGAFEELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSS  187

Query  450  DYI-CGDASTASDMHIFMV  503
            DY   GD STA D ++F++
Sbjct  188  DYDNSGDKSTAKDAYVFLI  206



>ref|XP_003534383.1| PREDICTED: serine carboxypeptidase-like 40-like isoform 1 [Glycine 
max]
Length=496

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D ++ LPGQP V F  Y GYV VD +AGR+ +YYFVEA+ + +  PL LWLNGG GCS
Sbjct  71   EKDRIESLPGQPPVSFSHYGGYVTVDKEAGRAFYYYFVEAQRSKQTLPLLLWLNGGPGCS  130

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+G GA  ELGPF    DG+ L RN  SWNK +N+LF+ESPAGVG+SYSN S DY   GD
Sbjct  131  SLGYGAMQELGPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDTNGD  190

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  191  KKTAADNYLFLV  202



>gb|KHG12237.1| Serine carboxypeptidase-like 40 [Gossypium arboreum]
Length=502

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +  LPGQP V F QY GYV VD KAGR+L+YYFVEA  +    PL LWLNGG GCS
Sbjct  72   EKDRIPKLPGQPHVRFSQYGGYVTVDKKAGRALYYYFVEAHHSKESLPLLLWLNGGPGCS  131

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  E+GPF    +G+ + RN  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  132  SLAYGAMEEIGPFRVHSNGKTVYRNRYSWNHAANVLFLESPAGVGFSYSNTTSDYDKSGD  191

Query  468  ASTASDMHIFMV  503
            + TA D ++F++
Sbjct  192  SKTAVDNYVFLI  203



>ref|XP_011091773.1| PREDICTED: serine carboxypeptidase-like 40 [Sesamum indicum]
Length=499

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D ++ LPGQP V FKQY GYV VD KAGR+ +YYFVEA+ + +  PL LWLNGG GCS
Sbjct  73   ESDRIERLPGQPPVKFKQYGGYVTVDRKAGRAFYYYFVEAQRSHKSLPLLLWLNGGPGCS  132

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+  GA  ELGPF    DG+ L +N  +WN A+N+LF+ESPAGVG+SYSNT++D+ I GD
Sbjct  133  SLAYGAMQELGPFRVHSDGKTLYKNRFAWNYAANVLFLESPAGVGFSYSNTTTDFEIGGD  192

Query  468  ASTASDMHIFMV  503
              TA D ++F++
Sbjct  193  RKTAMDNYVFLL  204



>ref|XP_002876119.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52378.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=497

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E DL++ LPGQP V F+QY GYV V+  AGRSL+YYFVEA  N +  PL LWLN G    
Sbjct  75   ERDLIENLPGQPSVSFRQYGGYVTVNESAGRSLYYYFVEATENKKSSPLVLWLN-GGPGC  133

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  467
            S   GAF ELGPF    DG+ L  N  SWNK +N+LF+ESPAG G+SY+NT++D    GD
Sbjct  134  SSLYGAFQELGPFRTHSDGKTLYTNPYSWNKLANILFLESPAGTGFSYTNTTTDLENPGD  193

Query  468  ASTASDMHIFMV  503
             +TA+D +IF+V
Sbjct  194  MNTAADNYIFLV  205



>gb|KHN11708.1| Serine carboxypeptidase-like 40 [Glycine soja]
Length=496

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D ++ LPGQP V F  Y GYV VD +AGR+ +YYFVEA+ + +  PL LWLNGG GCS
Sbjct  71   EKDRIESLPGQPPVSFSHYGGYVTVDKEAGRAFYYYFVEAQRSKQTLPLLLWLNGGPGCS  130

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  467
            S+G GA  ELGPF    DG+ L RN  SWNK +N+LF+ESPAGVG+SYSN S DY   GD
Sbjct  131  SLGYGAMQELGPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDTNGD  190

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  191  KKTAADNYLFLV  202



>ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES71587.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 7/139 (5%)
 Frame = +3

Query  108  PEEDL-----VKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWL  269
            P+E+L     +  LPGQP  V F QY+GYV VD +AGR LFYYFVE+  N   KPL LWL
Sbjct  68   PQEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWL  127

Query  270  NggsgcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSS  449
            NGG GCSS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNTSS
Sbjct  128  NGGPGCSSLGYGAFEELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSS  187

Query  450  DYI-CGDASTASDMHIFMV  503
            DY   GD STA D ++F++
Sbjct  188  DYDNSGDKSTAKDAYVFLI  206



>ref|XP_006473369.1| PREDICTED: serine carboxypeptidase II-3-like [Citrus sinensis]
Length=485

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +K LPGQP+ V F QYAGY+ VD KAGR+LFYYFVE+  +   KPL LWLNGG GC
Sbjct  73   EADKIKTLPGQPQGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSTKPLVLWLNGGPGC  132

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  464
            SS+G GA  ELGPF    DG+ L RN  +WN  +N+LF+E+PAGVG+SYSNTSSDY   G
Sbjct  133  SSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPG  192

Query  465  DASTASDMHIFMV  503
            D +TA D + F+V
Sbjct  193  DNNTAEDSYTFLV  205



>ref|XP_008231545.1| PREDICTED: serine carboxypeptidase-like 40 [Prunus mume]
Length=500

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D +  LPGQP V F QY GYV VD +AGR+LFYYF EAE      PL LWLNGG GCS
Sbjct  73   EKDRIDSLPGQPHVNFSQYGGYVTVDKEAGRALFYYFAEAEKAKDSSPLLLWLNGGPGCS  132

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  467
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  133  SLAYGAMLELGPFRIHSDGKTLYQNKFSWNYAANVLFLESPAGVGFSYSNKTSDYDANGD  192

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  193  RRTAADNYVFLV  204



>gb|EEC75382.1| hypothetical protein OsI_11848 [Oryza sativa Indica Group]
Length=482

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D V  LPGQP + GF QYAGYV V+  +G++LFYYF EA  +P  KPL LWLNGG GC
Sbjct  65   EADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGPGC  124

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS+G GA  E+GPF+  GD R L  N  +WN  +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  125  SSLGDGAMLEIGPFFVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTG  184

Query  465  DASTASDMHIFMV  503
            D STA+D + F+ 
Sbjct  185  DTSTAADAYTFLT  197



>ref|XP_002517750.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF44557.1| serine carboxypeptidase, putative [Ricinus communis]
Length=513

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLK-PLTLWLNggsgc  287
            E+D ++ LPGQP V F QY GYV  D  AGR+L+YYFVEA+   +   PL LWLNGG GC
Sbjct  86   EKDRIERLPGQPDVEFTQYGGYVTTDKSAGRALYYYFVEAQHYAKESFPLLLWLNGGPGC  145

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSNTSSDY  CG
Sbjct  146  SSLGYGAMQELGPFRVHSDGKTLYKNRYSWNYAANVLFLESPAGVGFSYSNTSSDYEKCG  205

Query  465  DASTASDMHIFMV  503
            D +TA D ++F+V
Sbjct  206  DKATAEDNYLFLV  218



>ref|XP_009618061.1| PREDICTED: serine carboxypeptidase-like 34 [Nicotiana tomentosiformis]
Length=232

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E D V  LPGQP V FKQYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGG GCS
Sbjct  32   EADRVNRLPGQPPVSFKQYAGYVTVNETHGRALFYWFFEATTNPEKKPLLLWLNGGPGCS  91

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGD  467
            S+G G   ELGPF+   +   L+ N+ SWNKA+NLLF+ESP GVG+SY+NTSSD    GD
Sbjct  92   SIGYGEAEELGPFFTQKNKPELKFNNFSWNKAANLLFLESPVGVGFSYTNTSSDITELGD  151

Query  468  ASTASDMHIFMV  503
              TA D + F+V
Sbjct  152  TVTAQDSYKFLV  163



>ref|XP_003592240.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP  V F QY+GYV V+ +AGR LFYYFVE+  N   KPL LWLNGG GC
Sbjct  72   QADKIDTLPGQPYGVNFDQYSGYVTVNPEAGRELFYYFVESPYNSSTKPLVLWLNGGPGC  131

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  132  SSLGYGAFQELGPFRINSDGKTLYRNQYAWNEVANVLFLESPAGVGFSYSNTTSDYDKSG  191

Query  465  DASTASDMHIFMV  503
            D STA D ++F++
Sbjct  192  DKSTAKDSYVFLI  204



>gb|ACJ85847.1| unknown [Medicago truncatula]
 gb|AFK43110.1| unknown [Medicago truncatula]
Length=316

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            EED V GLPGQP V FKQYAGY++V+   GR+LFY+F E+   P+ KPL LWLNGG GCS
Sbjct  31   EEDRVYGLPGQPPVNFKQYAGYINVNETHGRALFYWFFESVDQPQTKPLLLWLNGGPGCS  90

Query  291  svgggAFTELGPFYPTGDGR-GLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            S+G G   ELGPF+P    +  L+ N  SWNK +NLLF+ESPAGVG+SY+NT+SD    G
Sbjct  91   SIGYGEAEELGPFFPQNSSQPKLKLNPYSWNKTANLLFLESPAGVGFSYTNTTSDISELG  150

Query  465  DASTASDMHIFMV  503
            D  TA D H F++
Sbjct  151  DTITAKDSHTFLI  163



>ref|XP_007017344.1| Serine carboxypeptidase II-3 chain B isoform 4 [Theobroma cacao]
 gb|EOY14569.1| Serine carboxypeptidase II-3 chain B isoform 4 [Theobroma cacao]
Length=394

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP+ VGF QYAGYV VD  A R+LFYYFVE+ V+P  KPL LWLNGG GC
Sbjct  2    QADKINALPGQPEGVGFDQYAGYVTVDPVADRALFYYFVESPVDPSKKPLVLWLNGGPGC  61

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS G GA  ELGPF    DG  L RN  +WN  +N++F+ESPAGVG+SYS  SSDY   G
Sbjct  62   SSFGYGAMQELGPFRVNSDGETLYRNEYAWNNVANVIFLESPAGVGFSYSKNSSDYTSVG  121

Query  465  DASTASDMHIFMV  503
            D  TA D +IF++
Sbjct  122  DRKTAQDSYIFLI  134



>ref|XP_010916829.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=459

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +  LPGQP+ V F QYAGYV VD +AGR+LFYYFVE+  +P  KPL LWLNGG GC
Sbjct  44   EADKIDELPGQPEGVNFDQYAGYVTVDPEAGRALFYYFVESPQDPSTKPLVLWLNGGPGC  103

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GA  ELGPF    DGR L  N  +WN  +N++F+ESPAGVG+SYSNT++DY + G
Sbjct  104  SSLGAGAMVELGPFGVNSDGRTLYANIHAWNIVANVIFLESPAGVGFSYSNTTTDYELSG  163

Query  465  DASTASDMHIFMV  503
            D  TA D + F+V
Sbjct  164  DKRTAEDSYTFLV  176



>ref|XP_003539875.1| PREDICTED: serine carboxypeptidase-like 40-like [Glycine max]
Length=496

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  111  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcs  290
            E+D ++ LPGQP V F QY GYV VD  AGR+ +YYFVEA+ + +  PL LWLNGG GCS
Sbjct  71   EKDRIESLPGQPPVSFSQYGGYVTVDKVAGRAFYYYFVEAQRSKQTLPLLLWLNGGPGCS  130

Query  291  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGD  467
            S+G GA  ELGPF    DG+ L RN  SWNK +N+LF+ESPAGVG+SYSN S DY   GD
Sbjct  131  SLGYGAMQELGPFRVNSDGKTLHRNIFSWNKVANVLFLESPAGVGFSYSNKSKDYDNNGD  190

Query  468  ASTASDMHIFMV  503
              TA+D ++F+V
Sbjct  191  KKTAADNYLFLV  202



>ref|XP_007017343.1| Serine carboxypeptidase II-3 chain B isoform 3, partial [Theobroma 
cacao]
 gb|EOY14568.1| Serine carboxypeptidase II-3 chain B isoform 3, partial [Theobroma 
cacao]
Length=411

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP+ VGF QYAGYV VD  A R+LFYYFVE+ V+P  KPL LWLNGG GC
Sbjct  69   QADKINALPGQPEGVGFDQYAGYVTVDPVADRALFYYFVESPVDPSKKPLVLWLNGGPGC  128

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS G GA  ELGPF    DG  L RN  +WN  +N++F+ESPAGVG+SYS  SSDY   G
Sbjct  129  SSFGYGAMQELGPFRVNSDGETLYRNEYAWNNVANVIFLESPAGVGFSYSKNSSDYTSVG  188

Query  465  DASTASDMHIFMV  503
            D  TA D +IF++
Sbjct  189  DRKTAQDSYIFLI  201



>ref|XP_004231124.2| PREDICTED: serine carboxypeptidase-like 40 [Solanum lycopersicum]
Length=527

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 98/131 (75%), Gaps = 2/131 (2%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            +D +  LPGQP V F+QY GYV V+  AGR+L+YYF EAE N    PL LWLNGG GCSS
Sbjct  107  KDWINKLPGQPPVKFQQYGGYVTVNQSAGRALYYYFTEAE-NSEALPLLLWLNGGPGCSS  165

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  470
            +  GA  ELGPF    DG+ L RNS +WN+A+N+LF+ESPAGVG+SY+NTSSD+   GD+
Sbjct  166  MAYGAMEELGPFRVNSDGKTLHRNSYAWNRAANVLFLESPAGVGFSYTNTSSDFNTTGDS  225

Query  471  STASDMHIFMV  503
            +TA+D  +F++
Sbjct  226  TTANDNVVFLL  236



>ref|XP_006434836.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
 gb|ESR48076.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
Length=485

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            E D +K LPGQP+ V F QYAGY+ VD KAGR+LFYYFVE+  +   KPL LWLNGG GC
Sbjct  73   EADKIKTLPGQPEGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSSKPLVLWLNGGPGC  132

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  464
            SS+G GA  ELGPF    DG+ L RN  +WN  +N+LF+E+PAGVG+SYSNTSSDY   G
Sbjct  133  SSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNLG  192

Query  465  DASTASDMHIFMV  503
            D +TA D + F+V
Sbjct  193  DNNTAEDSYTFLV  205



>ref|XP_003542323.2| PREDICTED: serine carboxypeptidase-like 40-like isoform X1 [Glycine 
max]
 ref|XP_006593895.1| PREDICTED: serine carboxypeptidase-like 40-like isoform X2 [Glycine 
max]
Length=488

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +3

Query  111  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgc  287
            + D +  LPGQP  V F QY+G+V VD K GRSLFYYFVE+  N   KPL LWLNGG GC
Sbjct  70   QADKIVTLPGQPHGVNFDQYSGHVTVDPKTGRSLFYYFVESPHNSSAKPLVLWLNGGPGC  129

Query  288  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  464
            SS+G GAF ELGPF    DG+ L  N  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  130  SSLGYGAFEELGPFRVNSDGKTLFHNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDRSG  189

Query  465  DASTASDMHIFMV  503
            D STA D ++F++
Sbjct  190  DKSTAKDAYVFLI  202



>gb|EYU27945.1| hypothetical protein MIMGU_mgv1a005674mg [Erythranthe guttata]
Length=475

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  114  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggsgcss  293
            EDLV GLPGQP V F+ YAG+V VD K GRSLFY+F EA   P  KPL LWLNGG GCSS
Sbjct  39   EDLVTGLPGQPSVNFRHYAGFVTVDEKNGRSLFYWFYEATSLPDEKPLVLWLNGGPGCSS  98

Query  294  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGDA  470
            VG GA  E+GPF    +G GL+ NS +WN  +NLLF+ESP GVG+SYSNTS DY   GD 
Sbjct  99   VGYGATQEIGPFLVDANGHGLKFNSFAWNTEANLLFLESPIGVGFSYSNTSGDYDNLGDD  158

Query  471  STASDMHIFM  500
             TA+D ++F+
Sbjct  159  FTANDAYVFL  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300