BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014E05

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776620.1|  PREDICTED: serine/threonine-protein phosphat...    283   2e-89   Nicotiana sylvestris
ref|XP_003637402.1|  Protein phosphatase 2A regulatory subunit A        273   3e-89   
gb|KDO70006.1|  hypothetical protein CISIN_1g0068982mg                  269   2e-88   Citrus sinensis [apfelsine]
ref|XP_009621929.1|  PREDICTED: serine/threonine-protein phosphat...    280   3e-88   
ref|XP_006440947.1|  hypothetical protein CICLE_v100194171mg            265   1e-87   
ref|XP_004241625.1|  PREDICTED: serine/threonine-protein phosphat...    278   2e-87   
ref|XP_006354729.1|  PREDICTED: serine/threonine-protein phosphat...    278   3e-87   Solanum tuberosum [potatoes]
gb|KDO39435.1|  hypothetical protein CISIN_1g039154mg                   264   2e-86   Citrus sinensis [apfelsine]
ref|XP_010102836.1|  Serine/threonine-protein phosphatase 2A 65 k...    269   2e-86   
ref|XP_009388386.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-86   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98444.1|  unnamed protein product                                275   4e-86   Coffea canephora [robusta coffee]
ref|XP_006279157.1|  hypothetical protein CARUB_v100079670mg            266   5e-86   
ref|XP_007036503.1|  Serine/threonine-protein phosphatase 2A 65 k...    270   1e-85   
ref|XP_008339694.1|  PREDICTED: serine/threonine-protein phosphat...    273   2e-85   
gb|KEH44250.1|  serine/threonine protein phosphatase 2A regulator...    273   3e-85   Medicago truncatula
ref|XP_008361732.1|  PREDICTED: serine/threonine-protein phosphat...    273   3e-85   
gb|KJB39314.1|  hypothetical protein B456_007G006100                    271   3e-85   Gossypium raimondii
gb|EPS62738.1|  hypothetical protein M569_12049                         273   3e-85   Genlisea aurea
ref|XP_006583401.1|  PREDICTED: serine/threonine-protein phosphat...    272   4e-85   Glycine max [soybeans]
ref|XP_002276180.1|  PREDICTED: serine/threonine-protein phosphat...    272   4e-85   Vitis vinifera
ref|XP_007152779.1|  hypothetical protein PHAVU_004G159000g             272   5e-85   Phaseolus vulgaris [French bean]
ref|XP_004135105.1|  PREDICTED: serine/threonine-protein phosphat...    272   5e-85   
ref|XP_006376763.1|  hypothetical protein POPTR_0012s06210g             266   7e-85   
gb|KHG03474.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    271   8e-85   Gossypium arboreum [tree cotton]
gb|KJB39317.1|  hypothetical protein B456_007G006100                    271   8e-85   Gossypium raimondii
ref|XP_009356482.1|  PREDICTED: serine/threonine-protein phosphat...    271   9e-85   Pyrus x bretschneideri [bai li]
ref|XP_002529138.1|  serine/threonine protein phosphatase 2a regu...    271   9e-85   Ricinus communis
gb|KJB39313.1|  hypothetical protein B456_007G006100                    271   9e-85   Gossypium raimondii
ref|XP_011077133.1|  PREDICTED: serine/threonine-protein phosphat...    271   1e-84   Sesamum indicum [beniseed]
emb|CBI15438.3|  unnamed protein product                                273   1e-84   Vitis vinifera
ref|XP_010044277.1|  PREDICTED: serine/threonine-protein phosphat...    271   1e-84   Eucalyptus grandis [rose gum]
gb|KDP29385.1|  hypothetical protein JCGZ_18306                         271   1e-84   Jatropha curcas
gb|AAG29594.1|AF196287_1  Ser/Thr specific protein phosphatase 2A...    271   1e-84   Medicago sativa subsp. x varia
ref|XP_009336593.1|  PREDICTED: serine/threonine-protein phosphat...    271   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_006854054.1|  hypothetical protein AMTR_s00048p00082810          271   2e-84   Amborella trichopoda
ref|XP_007225550.1|  hypothetical protein PRUPE_ppa003299m2g            271   2e-84   Prunus persica
ref|XP_009396282.1|  PREDICTED: serine/threonine-protein phosphat...    271   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243199.1|  PREDICTED: serine/threonine-protein phosphat...    270   2e-84   Prunus mume [ume]
ref|XP_008350866.1|  PREDICTED: serine/threonine-protein phosphat...    270   2e-84   
emb|CDY69424.1|  BnaAnng30450D                                          269   2e-84   Brassica napus [oilseed rape]
ref|XP_004297127.1|  PREDICTED: serine/threonine-protein phosphat...    270   2e-84   Fragaria vesca subsp. vesca
ref|XP_007036502.1|  Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1     270   3e-84   Theobroma cacao [chocolate]
ref|XP_010265183.1|  PREDICTED: serine/threonine-protein phosphat...    270   3e-84   Nelumbo nucifera [Indian lotus]
gb|AAG29593.1|AF196286_1  Ser/Thr specific protein phosphatase 2A...    270   3e-84   Medicago sativa subsp. x varia
ref|XP_010094777.1|  hypothetical protein L484_019987                   270   3e-84   
gb|AEQ75494.1|  serine/threonine protein phosphatase 2a regulator...    270   4e-84   Rosa multiflora [Japanese rose]
ref|XP_006437703.1|  hypothetical protein CICLE_v10031047mg             270   4e-84   Citrus clementina [clementine]
ref|XP_006484434.1|  PREDICTED: serine/threonine-protein phosphat...    270   4e-84   Citrus sinensis [apfelsine]
ref|XP_002312385.1|  hypothetical protein POPTR_0008s11730g             270   5e-84   
ref|XP_010681587.1|  PREDICTED: serine/threonine-protein phosphat...    269   5e-84   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB23733.1|  hypothetical protein B456_004G112500                    267   6e-84   Gossypium raimondii
gb|KDO41974.1|  hypothetical protein CISIN_1g007863mg                   267   6e-84   Citrus sinensis [apfelsine]
gb|KEH27050.1|  serine/threonine protein phosphatase 2A regulator...    269   7e-84   Medicago truncatula
ref|XP_006660451.1|  PREDICTED: serine/threonine-protein phosphat...    269   7e-84   Oryza brachyantha
ref|XP_004956390.1|  PREDICTED: serine/threonine-protein phosphat...    269   7e-84   Setaria italica
ref|XP_004497109.1|  PREDICTED: serine/threonine-protein phosphat...    269   8e-84   Cicer arietinum [garbanzo]
ref|XP_002314877.1|  hypothetical protein POPTR_0010s13760g             269   8e-84   
ref|XP_009152111.1|  PREDICTED: serine/threonine-protein phosphat...    269   8e-84   Brassica rapa
ref|XP_010263329.1|  PREDICTED: serine/threonine-protein phosphat...    269   9e-84   Nelumbo nucifera [Indian lotus]
ref|XP_006660452.1|  PREDICTED: serine/threonine-protein phosphat...    269   9e-84   Oryza brachyantha
gb|KDO41973.1|  hypothetical protein CISIN_1g007863mg                   267   9e-84   Citrus sinensis [apfelsine]
ref|XP_004956389.1|  PREDICTED: serine/threonine-protein phosphat...    269   1e-83   Setaria italica
emb|CDY13586.1|  BnaA06g33370D                                          269   1e-83   Brassica napus [oilseed rape]
gb|KJB52972.1|  hypothetical protein B456_008G286100                    268   1e-83   Gossypium raimondii
ref|NP_001062674.1|  Os09g0249700                                       268   1e-83   
ref|XP_008648330.1|  PREDICTED: LOC732740 isoform X1                    268   1e-83   Zea mays [maize]
ref|XP_002511958.1|  serine/threonine protein phosphatase 2a regu...    268   2e-83   Ricinus communis
ref|XP_006395624.1|  hypothetical protein EUTSA_v10003886mg             268   2e-83   Eutrema salsugineum [saltwater cress]
ref|XP_004972370.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Setaria italica
ref|XP_008659343.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   
ref|NP_001105839.1|  LOC732740                                          268   2e-83   Zea mays [maize]
ref|XP_011008279.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Populus euphratica
gb|ACL54598.1|  unknown                                                 268   2e-83   Zea mays [maize]
gb|KJB23732.1|  hypothetical protein B456_004G112500                    268   2e-83   Gossypium raimondii
ref|XP_007046273.1|  Phosphatase 2A subunit A2, 65,PP2AA2               268   2e-83   
ref|XP_008659344.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Zea mays [maize]
ref|XP_009606530.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Nicotiana tomentosiformis
ref|XP_004238945.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Solanum lycopersicum
ref|XP_006362557.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Solanum tuberosum [potatoes]
ref|XP_009766514.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Nicotiana sylvestris
ref|XP_006485775.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Citrus sinensis [apfelsine]
ref|XP_010528048.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Tarenaya hassleriana [spider flower]
ref|XP_003555890.1|  PREDICTED: serine/threonine-protein phosphat...    268   2e-83   Glycine max [soybeans]
emb|CDP00596.1|  unnamed protein product                                269   2e-83   Coffea canephora [robusta coffee]
ref|XP_002876929.1|  hypothetical protein ARALYDRAFT_904748             268   2e-83   Arabidopsis lyrata subsp. lyrata
gb|KDO41972.1|  hypothetical protein CISIN_1g007863mg                   268   3e-83   Citrus sinensis [apfelsine]
gb|KJB23730.1|  hypothetical protein B456_004G112500                    268   3e-83   Gossypium raimondii
gb|KJB23731.1|  hypothetical protein B456_004G112500                    268   3e-83   Gossypium raimondii
ref|XP_007153361.1|  hypothetical protein PHAVU_003G029000g             267   3e-83   Phaseolus vulgaris [French bean]
gb|AFW75382.1|  hypothetical protein ZEAMMB73_324274                    268   3e-83   
ref|XP_011070821.1|  PREDICTED: serine/threonine-protein phosphat...    267   3e-83   Sesamum indicum [beniseed]
ref|XP_006297363.1|  hypothetical protein CARUB_v10013383mg             266   3e-83   
ref|XP_008374745.1|  PREDICTED: serine/threonine-protein phosphat...    267   4e-83   Malus domestica [apple tree]
gb|KGN52064.1|  hypothetical protein Csa_5G608520                       271   4e-83   Cucumis sativus [cucumbers]
ref|XP_003536691.1|  PREDICTED: serine/threonine-protein phosphat...    267   5e-83   Glycine max [soybeans]
ref|XP_007210261.1|  hypothetical protein PRUPE_ppa003291mg             267   5e-83   Prunus persica
ref|XP_008659342.1|  PREDICTED: serine/threonine-protein phosphat...    267   5e-83   Zea mays [maize]
ref|XP_009347000.1|  PREDICTED: serine/threonine-protein phosphat...    267   5e-83   Pyrus x bretschneideri [bai li]
ref|XP_010551283.1|  PREDICTED: serine/threonine-protein phosphat...    266   6e-83   Tarenaya hassleriana [spider flower]
ref|XP_008240282.1|  PREDICTED: serine/threonine-protein phosphat...    266   6e-83   Prunus mume [ume]
ref|XP_010554238.1|  PREDICTED: serine/threonine-protein phosphat...    266   6e-83   Tarenaya hassleriana [spider flower]
gb|KJB50734.1|  hypothetical protein B456_008G184500                    266   8e-83   Gossypium raimondii
ref|XP_004512939.1|  PREDICTED: serine/threonine-protein phosphat...    266   8e-83   Cicer arietinum [garbanzo]
ref|XP_008797605.1|  PREDICTED: serine/threonine-protein phosphat...    266   9e-83   Phoenix dactylifera
ref|XP_011021847.1|  PREDICTED: serine/threonine-protein phosphat...    266   1e-82   Populus euphratica
gb|KJB80118.1|  hypothetical protein B456_013G081300                    264   2e-82   Gossypium raimondii
ref|XP_006307029.1|  hypothetical protein CARUB_v10008615mg             266   2e-82   
ref|XP_010495219.1|  PREDICTED: serine/threonine-protein phosphat...    265   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010942275.1|  PREDICTED: serine/threonine-protein phosphat...    265   3e-82   Elaeis guineensis
ref|XP_010458784.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    265   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010476329.1|  PREDICTED: serine/threonine-protein phosphat...    265   3e-82   Camelina sativa [gold-of-pleasure]
gb|KJB80114.1|  hypothetical protein B456_013G081300                    265   4e-82   Gossypium raimondii
gb|KJB80117.1|  hypothetical protein B456_013G081300                    265   4e-82   Gossypium raimondii
ref|NP_001030769.1|  protein phosphatase 2A subunit A2                  263   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011006221.1|  PREDICTED: serine/threonine-protein phosphat...    264   5e-82   Populus euphratica
ref|XP_010929062.1|  PREDICTED: serine/threonine-protein phosphat...    264   5e-82   Elaeis guineensis
ref|XP_008393303.1|  PREDICTED: serine/threonine-protein phosphat...    264   6e-82   
ref|XP_010677978.1|  PREDICTED: serine/threonine-protein phosphat...    264   7e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534171.1|  PREDICTED: serine/threonine-protein phosphat...    264   7e-82   Glycine max [soybeans]
gb|KHN27183.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    264   8e-82   Glycine soja [wild soybean]
ref|XP_003518674.1|  PREDICTED: serine/threonine-protein phosphat...    264   8e-82   Glycine max [soybeans]
emb|CAA57528.1|  protein phosphatase 2A 65 kDa regulatory subunit       263   1e-81   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189208.1|  protein phosphatase 2A subunit A2                     263   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15336.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    263   1e-81   Gossypium arboreum [tree cotton]
ref|XP_010458785.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006845686.1|  hypothetical protein AMTR_s00019p00236090          263   2e-81   
gb|KDP20104.1|  hypothetical protein JCGZ_05873                         263   2e-81   Jatropha curcas
ref|XP_010495228.1|  PREDICTED: serine/threonine-protein phosphat...    262   3e-81   Camelina sativa [gold-of-pleasure]
gb|EYU40874.1|  hypothetical protein MIMGU_mgv1a003588mg                262   3e-81   Erythranthe guttata [common monkey flower]
ref|XP_009391301.1|  PREDICTED: serine/threonine-protein phosphat...    261   6e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEB40165.1|  protein phosphatase 2A structural subunit               261   7e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009415447.1|  PREDICTED: serine/threonine-protein phosphat...    261   9e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893420.1|  serine/threonine protein phosphatase type 2A...    260   2e-80   
ref|XP_010477897.1|  PREDICTED: serine/threonine-protein phosphat...    260   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002892742.1|  hypothetical protein ARALYDRAFT_888699             260   2e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_006307078.1|  hypothetical protein CARUB_v10008664mg             260   2e-80   Capsella rubella
ref|XP_010476330.1|  PREDICTED: serine/threonine-protein phosphat...    260   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_004300534.1|  PREDICTED: serine/threonine-protein phosphat...    259   3e-80   Fragaria vesca subsp. vesca
ref|XP_003577085.1|  PREDICTED: serine/threonine-protein phosphat...    259   3e-80   Brachypodium distachyon [annual false brome]
ref|XP_010237336.1|  PREDICTED: serine/threonine-protein phosphat...    259   3e-80   Brachypodium distachyon [annual false brome]
emb|CDY51132.1|  BnaA07g37150D                                          259   5e-80   Brassica napus [oilseed rape]
ref|XP_002282096.2|  PREDICTED: serine/threonine-protein phosphat...    259   5e-80   Vitis vinifera
ref|XP_010499103.1|  PREDICTED: serine/threonine-protein phosphat...    259   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_009103071.1|  PREDICTED: serine/threonine-protein phosphat...    259   5e-80   Brassica rapa
ref|NP_001150156.1|  LOC100283785                                       258   1e-79   Zea mays [maize]
emb|CBI27044.3|  unnamed protein product                                259   1e-79   Vitis vinifera
emb|CAN68660.1|  hypothetical protein VITISV_002162                     258   1e-79   Vitis vinifera
ref|XP_008783038.1|  PREDICTED: serine/threonine-protein phosphat...    258   1e-79   Phoenix dactylifera
emb|CDY36104.1|  BnaA08g19440D                                          258   2e-79   Brassica napus [oilseed rape]
ref|XP_010460344.1|  PREDICTED: serine/threonine-protein phosphat...    258   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006417131.1|  hypothetical protein EUTSA_v10007164mg             257   2e-79   Eutrema salsugineum [saltwater cress]
gb|AAB60713.1|  serine/threonine protein phosphatase type 2A regu...    258   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173920.1|  serine/threonine-protein phosphatase 2A regulat...    257   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109883.1|  PREDICTED: serine/threonine-protein phosphat...    257   3e-79   Brassica rapa
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...    263   5e-79   
ref|XP_010237331.1|  PREDICTED: serine/threonine-protein phosphat...    256   8e-79   
ref|XP_003577041.1|  PREDICTED: serine/threonine-protein phosphat...    256   8e-79   Brachypodium distachyon [annual false brome]
emb|CAA57527.1|  65 kDa regulatory subunit of protein phosphatase 2A    254   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415878.1|  hypothetical protein EUTSA_v10007162mg             254   4e-78   Eutrema salsugineum [saltwater cress]
ref|XP_006441864.1|  hypothetical protein CICLE_v10022447mg             242   4e-78   
ref|XP_010036877.1|  PREDICTED: serine/threonine-protein phosphat...    254   4e-78   Eucalyptus grandis [rose gum]
ref|XP_001775815.1|  predicted protein                                  253   2e-77   
ref|XP_001777048.1|  predicted protein                                  252   3e-77   
emb|CDY42101.1|  BnaA09g28590D                                          251   5e-77   Brassica napus [oilseed rape]
ref|NP_001031035.1|  protein phosphatase 2A subunit A3                  249   6e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973833.1|  hypothetical protein SELMODRAFT_232183             250   8e-77   
gb|AAG09551.1|AC011810_10  Putative protein phosphotase 2a 65kd r...    250   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172790.2|  protein phosphatase 2A subunit A3                     250   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769725.1|  predicted protein                                  246   4e-75   
emb|CAA66487.1|  protein phosphatase 2A                                 243   5e-74   Nicotiana tabacum [American tobacco]
emb|CDY03849.1|  BnaC07g10740D                                          233   1e-70   
ref|XP_002988290.1|  hypothetical protein SELMODRAFT_447252             226   1e-67   
ref|XP_002963887.1|  hypothetical protein SELMODRAFT_166330             226   1e-67   Selaginella moellendorffii
ref|XP_006367043.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-66   Solanum tuberosum [potatoes]
ref|XP_010319425.1|  PREDICTED: serine/threonine-protein phosphat...    221   7e-66   Solanum lycopersicum
ref|XP_004236962.1|  PREDICTED: serine/threonine-protein phosphat...    222   8e-66   Solanum lycopersicum
emb|CDX84993.1|  BnaC05g20620D                                          212   2e-63   
emb|CDY04182.1|  BnaA09g19600D                                          202   3e-63   
ref|XP_007142892.1|  hypothetical protein PHAVU_007G0258001g            204   1e-59   Phaseolus vulgaris [French bean]
ref|XP_005644559.1|  ARM repeat-containing protein                      203   6e-59   Coccomyxa subellipsoidea C-169
ref|XP_009764796.1|  PREDICTED: serine/threonine-protein phosphat...    202   2e-58   Nicotiana sylvestris
gb|ADV40147.1|  putative protein phosphatase 2A regulatory subunit A    191   8e-57   Latrodectus hesperus [black widow]
ref|XP_008479235.1|  PREDICTED: serine/threonine-protein phosphat...    194   9e-57   
gb|ELT97469.1|  hypothetical protein CAPTEDRAFT_152474                  197   1e-56   Capitella teleta
gb|KIY96952.1|  Serine/threonine-protein phosphatase 2A regulator...    197   1e-56   Monoraphidium neglectum
ref|XP_008217607.1|  PREDICTED: serine/threonine-protein phosphat...    196   4e-56   
ref|XP_001600229.1|  PREDICTED: serine/threonine-protein phosphat...    196   4e-56   Nasonia vitripennis
ref|XP_011266575.1|  PREDICTED: serine/threonine-protein phosphat...    196   6e-56   Camponotus floridanus
ref|XP_011266584.1|  PREDICTED: serine/threonine-protein phosphat...    195   7e-56   Camponotus floridanus
gb|EFN73589.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    195   9e-56   Camponotus floridanus
ref|XP_008479230.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    194   2e-55   
ref|XP_011144206.1|  PREDICTED: serine/threonine-protein phosphat...    194   2e-55   
ref|XP_011144205.1|  PREDICTED: serine/threonine-protein phosphat...    194   2e-55   
ref|XP_011336007.1|  PREDICTED: serine/threonine-protein phosphat...    194   2e-55   Ooceraea biroi
ref|XP_011336006.1|  PREDICTED: serine/threonine-protein phosphat...    194   2e-55   Ooceraea biroi
ref|XP_011062133.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-55   Acromyrmex echinatior
ref|XP_011166786.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-55   Solenopsis invicta [imported red fire ant]
gb|EFZ13522.1|  hypothetical protein SINV_04974                         194   3e-55   
ref|XP_011166784.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-55   Solenopsis invicta [imported red fire ant]
gb|EGI60796.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    194   3e-55   Acromyrmex echinatior
ref|XP_011062132.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-55   Acromyrmex echinatior
ref|XP_011449632.1|  PREDICTED: serine/threonine-protein phosphat...    193   4e-55   Crassostrea gigas
ref|XP_011449631.1|  PREDICTED: serine/threonine-protein phosphat...    193   4e-55   Crassostrea gigas
ref|XP_002406082.1|  protein phosphatase 2A regulatory subunit A,...    193   5e-55   Ixodes scapularis [blacklegged tick]
ref|XP_002613476.1|  hypothetical protein BRAFLDRAFT_119854             193   5e-55   Branchiostoma floridae
gb|KDR23265.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    193   7e-55   Zootermopsis nevadensis
gb|KIH42483.1|  HEAT repeat protein                                     182   8e-55   Ancylostoma duodenale
ref|XP_011501051.1|  PREDICTED: serine/threonine-protein phosphat...    192   1e-54   Ceratosolen solmsi marchali
ref|NP_001034525.1|  protein phosphatase 2, regulatory subunit A,...    192   1e-54   
ref|XP_006747287.1|  PREDICTED: serine/threonine-protein phosphat...    188   1e-54   Leptonychotes weddellii
gb|KHJ82027.1|  HEAT repeat protein                                     184   1e-54   Oesophagostomum dentatum [nodule worm]
dbj|BAN21528.1|  serine/threonine protein phosphatase 2a regulato...    189   2e-54   Riptortus pedestris
gb|ERE60505.1|  serine/threonine-protein phosphatase 2A regulator...    188   3e-54   Cricetulus griseus [Chinese hamsters]
ref|XP_009060863.1|  hypothetical protein LOTGIDRAFT_219170             191   3e-54   Lottia gigantea
ref|XP_001625764.1|  predicted protein                                  191   3e-54   Nematostella vectensis
ref|NP_001171792.1|  protein phosphatase 2, regulatory subunit A,...    191   4e-54   Saccoglossus kowalevskii
ref|XP_001120202.2|  PREDICTED: serine/threonine-protein phosphat...    191   5e-54   Apis mellifera [bee]
ref|XP_006562820.1|  PREDICTED: serine/threonine-protein phosphat...    190   5e-54   Apis mellifera [bee]
gb|ERL94150.1|  hypothetical protein D910_11432                         190   6e-54   Dendroctonus ponderosae
gb|AEE63553.1|  unknown                                                 190   6e-54   Dendroctonus ponderosae
gb|ENN75423.1|  hypothetical protein YQE_07974                          190   6e-54   Dendroctonus ponderosae
gb|EPQ16739.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    194   1e-53   Myotis brandtii
ref|XP_009015041.1|  hypothetical protein HELRODRAFT_191252             189   1e-53   Helobdella robusta
gb|AFL91512.1|  phosphatase-like protein                                189   1e-53   Panonychus citri [citrus fruit mite]
gb|EKC43171.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    192   1e-53   Crassostrea gigas
pdb|2PKG|A  Chain A, Structure Of A Complex Between The A Subunit...    189   1e-53   Macaca mulatta polyomavirus 1
gb|ELK18455.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    194   1e-53   Pteropus alecto
pdb|4I5L|A  Chain A, Structural Mechanism Of Trimeric Pp2a Holoen...    189   2e-53   Homo sapiens [man]
pdb|3DW8|A  Chain A, Structure Of A Protein Phosphatase 2a Holoen...    189   2e-53   Homo sapiens [man]
dbj|BAE87562.1|  unnamed protein product                                189   2e-53   Macaca fascicularis [crab eating macaque]
ref|XP_005095307.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   
gb|EFB14807.1|  hypothetical protein PANDA_017429                       189   2e-53   Ailuropoda melanoleuca
ref|XP_006157810.1|  PREDICTED: serine/threonine-protein phosphat...    188   2e-53   
dbj|BAF83282.1|  unnamed protein product                                189   2e-53   Homo sapiens [man]
emb|CAG29336.1|  PPP2R1A                                                189   2e-53   Homo sapiens [man]
gb|AAH52678.1|  Protein phosphatase 2 (formerly 2A), regulatory s...    189   2e-53   Mus musculus [mouse]
ref|NP_001080135.1|  protein phosphatase 2, regulatory subunit A,...    189   2e-53   Xenopus laevis [clawed frog]
dbj|BAH72359.1|  ACYPI002758                                            182   2e-53   Acyrthosiphon pisum
ref|XP_010584891.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Loxodonta africana [African bush elephant]
dbj|BAC40565.1|  unnamed protein product                                189   2e-53   Mus musculus [mouse]
ref|XP_005341840.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Ictidomys tridecemlineatus
ref|XP_005984732.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004415541.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Odobenus rosmarus divergens
ref|XP_004381783.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Trichechus manatus latirostris
ref|XP_010829830.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Bison bison bison
ref|XP_007955412.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Orycteropus afer afer
ref|XP_004619940.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Sorex araneus [Eurasian shrew]
ref|XP_005616279.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Canis lupus familiaris [dogs]
ref|XP_008845654.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Nannospalax galili
gb|AAA36399.1|  phosphatase 2A regulatory subunit                       189   2e-53   Homo sapiens [man]
gb|AAP36766.1|  Homo sapiens protein phosphatase 2 (formerly 2A),...    189   2e-53   synthetic construct
pdb|2NYL|A  Chain A, Crystal Structure Of Protein Phosphatase 2a ...    189   2e-53   Homo sapiens [man]
ref|NP_001032554.1|  serine/threonine-protein phosphatase 2A 65 k...    189   2e-53   Bos taurus [bovine]
ref|XP_006157809.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   
ref|XP_006905036.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Pteropus alecto
ref|NP_058587.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    189   2e-53   Mus musculus [mouse]
gb|EHH59859.1|  hypothetical protein EGM_10070                          189   2e-53   Macaca fascicularis [crab eating macaque]
ref|XP_008248017.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    189   2e-53   
ref|XP_007648156.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Cricetulus griseus [Chinese hamsters]
ref|XP_003225135.2|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   
pdb|1B3U|A  Chain A, Crystal Structure Of Constant Regulatory Dom...    189   2e-53   Homo sapiens [man]
ref|XP_007622229.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   
ref|XP_006772968.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Myotis davidii
ref|NP_055040.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    189   2e-53   Homo sapiens [man]
pdb|4I5N|A  Chain A, Structural Mechanism Of Trimeric Pp2a Holoen...    189   2e-53   Homo sapiens [man]
gb|ELW48894.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    189   2e-53   Tupaia chinensis
pdb|3FGA|A  Chain A, Structural Basis Of Pp2a And Sgo Interaction       189   2e-53   Homo sapiens [man]
ref|XP_006194471.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Camelus ferus
ref|XP_005880804.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-53   Myotis brandtii
ref|XP_007179922.1|  PREDICTED: serine/threonine-protein phosphat...    188   3e-53   Balaenoptera acutorostrata scammoni
gb|EFX90149.1|  hypothetical protein DAPPUDRAFT_300165                  188   3e-53   Daphnia pulex
ref|XP_011312304.1|  PREDICTED: serine/threonine-protein phosphat...    188   3e-53   Fopius arisanus
ref|NP_989405.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    188   3e-53   Xenopus tropicalis [western clawed frog]
ref|XP_011312305.1|  PREDICTED: serine/threonine-protein phosphat...    188   3e-53   Fopius arisanus
ref|XP_003738779.1|  PREDICTED: serine/threonine-protein phosphat...    188   4e-53   Galendromus occidentalis
ref|XP_003486616.1|  PREDICTED: serine/threonine-protein phosphat...    188   4e-53   
gb|ERG81286.1|  serine threonine-protein phosphatase 2a 65 kda re...    188   4e-53   
ref|XP_788240.3|  PREDICTED: serine/threonine-protein phosphatase...    187   4e-53   
gb|KFB35772.1|  hypothetical protein ZHAS_00002676                      191   5e-53   Anopheles sinensis
ref|XP_004439075.1|  PREDICTED: serine/threonine-protein phosphat...    188   5e-53   
ref|XP_003402717.1|  PREDICTED: serine/threonine-protein phosphat...    187   5e-53   
gb|AAM48413.1|  RE28669p                                                181   5e-53   
ref|XP_007441284.1|  PREDICTED: serine/threonine-protein phosphat...    187   6e-53   
ref|XP_004454702.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    188   6e-53   
ref|XP_008538780.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    188   6e-53   
ref|XP_008545083.1|  PREDICTED: serine/threonine-protein phosphat...    187   6e-53   
ref|XP_002111654.1|  expressed hypothetical protein                     187   6e-53   
ref|XP_006868185.1|  PREDICTED: serine/threonine-protein phosphat...    187   6e-53   
gb|EHB03786.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    189   6e-53   
gb|EPY73471.1|  serine/threonine-protein phosphatase 2A regulator...    188   7e-53   
ref|XP_007106439.1|  PREDICTED: serine/threonine-protein phosphat...    188   7e-53   
ref|XP_001496310.2|  PREDICTED: serine/threonine-protein phosphat...    188   7e-53   
ref|XP_008545088.1|  PREDICTED: serine/threonine-protein phosphat...    187   7e-53   
ref|XP_001894294.1|  protein phosphatase PP2A regulatory subunit        187   8e-53   
ref|NP_001081031.1|  protein phosphatase 2, regulatory subunit A,...    187   9e-53   
ref|XP_006833878.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-53   
ref|XP_004715719.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-53   
emb|CAA56713.1|  phosphorylase phosphatase                              187   9e-53   
gb|ETN60749.1|  serine/threonine protein phosphatase 2a regulator...    190   1e-52   
gb|ETE63053.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    186   1e-52   
gb|KHN76768.1|  putative serine/threonine-protein phosphatase PP2...    187   1e-52   
gb|EHJ67187.1|  protein phosphatase 2, regulatory subunit A, alph...    181   1e-52   
ref|XP_006833877.1|  PREDICTED: serine/threonine-protein phosphat...    187   1e-52   
ref|XP_002503918.1|  protein phosphatase 2a                             187   1e-52   
ref|XP_004344366.2|  protein phosphatase 2                              186   1e-52   
ref|XP_001652452.1|  AAEL006977-PA                                      186   2e-52   
ref|XP_002119919.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-52   
ref|XP_006034569.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-52   
ref|XP_003136199.1|  protein phosphatase PP2A regulatory subunit        187   2e-52   
ref|NP_001006775.1|  platelet-derived growth factor subunit B           186   2e-52   
gb|AAH44120.1|  LOC398563 protein                                       186   2e-52   
ref|NP_001082552.1|  serine/threonine-protein phosphatase 2A 65 k...    186   2e-52   
ref|XP_003055021.1|  protein phosphatase 2A regulatory subunit          186   2e-52   
gb|KHN80727.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    186   3e-52   
ref|XP_010967202.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-52   
ref|XP_010984268.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-52   
ref|XP_007934752.1|  PREDICTED: serine/threonine-protein phosphat...    185   3e-52   
ref|XP_001845172.1|  serine/threonine protein phosphatase 2a regu...    185   3e-52   
dbj|BAG57867.1|  unnamed protein product                                185   3e-52   
ref|XP_002432536.1|  serine/threonine-protein phosphatase PP2A 65...    185   3e-52   
ref|NP_001171033.1|  serine/threonine-protein phosphatase 2A 65 k...    185   3e-52   
ref|XP_008683000.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-52   
dbj|BAE00417.1|  unnamed protein product                                186   3e-52   
ref|XP_004666547.1|  PREDICTED: serine/threonine-protein phosphat...    185   3e-52   
gb|AAC63525.1|  protein phosphatase 2A regulatory subunit A, beta...    186   3e-52   
ref|XP_004626174.1|  PREDICTED: serine/threonine-protein phosphat...    185   3e-52   
gb|AAA35531.1|  medium tumor antigen-associated 61-kD protein           185   3e-52   
ref|XP_005347389.1|  PREDICTED: serine/threonine-protein phosphat...    185   3e-52   
ref|NP_002707.3|  serine/threonine-protein phosphatase 2A 65 kDa ...    186   4e-52   
ref|XP_007538537.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_004326179.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_004585107.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_004016061.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_002682119.1|  phosphoprotein phosphatase A                       185   4e-52   
ref|XP_005334304.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_008148378.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_006890831.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_010380631.1|  PREDICTED: serine/threonine-protein phosphat...    186   4e-52   
ref|XP_003583134.1|  PREDICTED: serine/threonine-protein phosphat...    186   4e-52   
ref|XP_005579657.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_008259779.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_005347388.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_005901603.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_010593753.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_007464722.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_008148377.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_003705692.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_008831023.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
gb|EGW03807.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    185   4e-52   
ref|XP_006833876.1|  PREDICTED: serine/threonine-protein phosphat...    186   4e-52   
ref|XP_010861232.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_010593752.1|  PREDICTED: serine/threonine-protein phosphat...    186   4e-52   
ref|XP_004273470.1|  PREDICTED: serine/threonine-protein phosphat...    184   4e-52   
ref|XP_004016059.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_007538479.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_005579656.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-52   
ref|XP_004413637.1|  PREDICTED: serine/threonine-protein phosphat...    184   5e-52   
ref|XP_004666546.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|XP_007128319.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|XP_007934750.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|XP_004626172.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|XP_004585106.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|NP_082890.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    185   5e-52   
ref|XP_003794777.1|  PREDICTED: serine/threonine-protein phosphat...    184   5e-52   
ref|XP_005901602.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|XP_005334303.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|XP_004326177.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|XP_004273468.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-52   
ref|NP_001080408.1|  protein phosphatase 2, regulatory subunit A,...    185   5e-52   
ref|XP_005069580.1|  PREDICTED: serine/threonine-protein phosphat...    184   5e-52   
ref|XP_010380630.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_004382551.1|  PREDICTED: serine/threonine-protein phosphat...    184   6e-52   
ref|XP_007464720.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_010380632.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_005533983.1|  PREDICTED: serine/threonine-protein phosphat...    184   6e-52   
ref|XP_006890830.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_001371292.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_005005046.1|  PREDICTED: serine/threonine-protein phosphat...    184   6e-52   
ref|XP_006065329.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_008381507.1|  PREDICTED: serine/threonine-protein phosphat...    172   6e-52   
gb|KFO36517.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    188   6e-52   
ref|XP_004413636.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_004382550.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_003472884.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_011363717.1|  PREDICTED: serine/threonine-protein phosphat...    185   6e-52   
ref|XP_005005045.1|  PREDICTED: serine/threonine-protein phosphat...    185   7e-52   
ref|XP_002822526.1|  PREDICTED: serine/threonine-protein phosphat...    185   7e-52   
ref|XP_003794775.1|  PREDICTED: serine/threonine-protein phosphat...    185   7e-52   
ref|XP_006912906.1|  PREDICTED: serine/threonine-protein phosphat...    184   7e-52   
ref|XP_005069579.1|  PREDICTED: serine/threonine-protein phosphat...    185   7e-52   
emb|CAA56715.1|  phosphorylase phosphatase                              184   7e-52   
ref|NP_001020589.1|  serine/threonine-protein phosphatase 2A 65 k...    184   7e-52   
ref|XP_003357333.1|  PREDICTED: serine/threonine-protein phosphat...    184   7e-52   
sp|P54613.1|2AAB_PIG  RecName: Full=Serine/threonine-protein phos...    184   8e-52   
gb|ETN68324.1|  HEAT repeat protein                                     184   8e-52   
ref|XP_006897448.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-52   
ref|XP_004791695.1|  PREDICTED: serine/threonine-protein phosphat...    185   8e-52   
ref|XP_007934748.1|  PREDICTED: serine/threonine-protein phosphat...    185   8e-52   
ref|XP_006151039.1|  PREDICTED: serine/threonine-protein phosphat...    184   9e-52   
ref|XP_005667374.1|  PREDICTED: serine/threonine-protein phosphat...    184   9e-52   
ref|NP_001126285.1|  serine/threonine-protein phosphatase 2A 65 k...    184   9e-52   
ref|XP_008575838.1|  PREDICTED: serine/threonine-protein phosphat...    184   9e-52   
ref|XP_003415736.1|  PREDICTED: serine/threonine-protein phosphat...    185   9e-52   
ref|XP_008259769.1|  PREDICTED: serine/threonine-protein phosphat...    185   9e-52   
ref|XP_005347385.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_006151037.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_008259765.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_010380629.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
gb|ELR52221.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    185   1e-51   
ref|XP_006972392.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_009616233.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_006151038.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_007627348.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    185   1e-51   
ref|XP_002708504.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004585105.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004856606.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|NP_859050.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    185   1e-51   
ref|XP_006972396.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_005579655.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|NP_001267102.1|  serine/threonine-protein phosphatase 2A 65 k...    185   1e-51   
dbj|BAF84964.1|  unnamed protein product                                185   1e-51   
ref|XP_004481189.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_005334299.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004626171.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_005334300.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004016062.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004326176.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_007538345.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_005987322.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_007464719.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_005901599.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_005619845.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
gb|EDL25767.1|  protein phosphatase 2 (formerly 2A), regulatory s...    185   1e-51   
gb|EDL25768.1|  protein phosphatase 2 (formerly 2A), regulatory s...    185   1e-51   
ref|XP_006972393.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|NP_001273482.1|  serine/threonine-protein phosphatase 2A 65 k...    185   1e-51   
gb|ERZ97088.1|  hypothetical protein GLOINDRAFT_340356                  184   1e-51   
ref|XP_010380628.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_005334301.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_005347386.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|NP_001029257.1|  serine/threonine-protein phosphatase 2A 65 k...    184   1e-51   
ref|XP_005194631.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
dbj|BAC36649.1|  unnamed protein product                                185   1e-51   
ref|XP_009422353.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004273467.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
gb|KFD57741.1|  hypothetical protein M513_01411                         184   1e-51   
gb|EDL95488.1|  protein phosphatase 2 (formerly 2A), regulatory s...    184   1e-51   
ref|XP_010821052.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004626170.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_004481188.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_007229440.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_002641277.1|  C. briggsae CBR-PAA-1 protein                      184   1e-51   
ref|XP_004749848.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_007538407.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_005901600.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_006739271.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004543776.1|  PREDICTED: serine/threonine-protein phosphat...    183   1e-51   
ref|XP_006065328.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_004413634.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_011363718.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-51   
ref|XP_004382548.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-51   
ref|XP_005069578.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_004052185.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    185   2e-51   
ref|XP_007128320.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
gb|EYB94291.1|  hypothetical protein Y032_0173g403                      184   2e-51   
ref|XP_005615295.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    184   2e-51   
ref|XP_003794776.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
gb|EYB94290.1|  hypothetical protein Y032_0173g403                      184   2e-51   
ref|XP_006718933.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
gb|AAH97118.1|  Protein phosphatase 2 (formerly 2A), regulatory s...    184   2e-51   
ref|XP_008052417.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|NP_001005590.1|  serine/threonine-protein phosphatase 2A 65 k...    184   2e-51   
emb|CAP25734.2|  Protein CBR-PAA-1                                      184   2e-51   
ref|XP_011363719.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_008575840.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_009422349.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_003357336.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_006718934.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_010793348.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-51   
ref|XP_008307967.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-51   
ref|XP_005804169.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-51   
ref|XP_007173031.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_004749846.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_003910728.2|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_009422350.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
emb|CDW58966.1|  serine:threonine protein phosphatase 2A 65 kDa         184   2e-51   
ref|XP_004075717.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-51   
ref|XP_006151036.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_006243095.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_004856603.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_005005044.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_010869843.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-51   
ref|XP_008575839.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_004909705.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
emb|CDQ59233.1|  unnamed protein product                                183   2e-51   
gb|KFO20731.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    184   2e-51   
ref|XP_010609029.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
ref|XP_006151040.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   
gb|ACN58704.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    183   2e-51   
ref|XP_008019008.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-51   



>ref|XP_009776620.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
 ref|XP_009776621.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=581

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HASVLLPPLEGLCSVE TCVREKAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_003637402.1| Protein phosphatase 2A regulatory subunit A [Medicago truncatula]
Length=258

 Score =   273 bits (697),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFL+ NNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLTENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HASVLLPPLE  CSVE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLPPLEAFCSVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KDO70006.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70007.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70008.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70009.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70010.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70011.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
Length=213

 Score =   269 bits (687),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  +IPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_009621929.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009621930.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
Length=581

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HASVLL PLEGLCSVE TCVREKAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLSPLEGLCSVEETCVREKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_006440947.1| hypothetical protein CICLE_v100194171mg, partial [Citrus clementina]
 gb|ESR54187.1| hypothetical protein CICLE_v100194171mg, partial [Citrus clementina]
Length=171

 Score =   265 bits (678),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D++  FIPL KRLAAG WFTARVSSCGLFH+AYP
Sbjct  121  DVIEHFIPLVKRLAAGEWFTARVSSCGLFHVAYP  154



>ref|XP_004241625.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum lycopersicum]
Length=581

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSAIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELG+FIPYVGG +HA VLLPPLEGLCSVE TCVREKAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGMFIPYVGGVEHARVLLPPLEGLCSVEETCVREKAVESLCKIGSQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLA G WFTARVSSCGLFHIAYP
Sbjct  121  DLVESFIPLVKRLATGEWFTARVSSCGLFHIAYP  154



>ref|XP_006354729.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=581

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSGIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELG+FIPYVGG +HA VLLPPLEGLCSVE TCVREKAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGMFIPYVGGVEHAHVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|KDO39435.1| hypothetical protein CISIN_1g039154mg [Citrus sinensis]
Length=211

 Score =   264 bits (674),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVL DEL N+DIQLRLNSIRRLSTIARALGEERT KELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLTDELKNDDIQLRLNSIRRLSTIARALGEERTPKELIPFLSANNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TC+R+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCMRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_010102836.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
 gb|EXB94196.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
Length=362

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSSVDDPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_009388386.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like, partial [Musa acuminata 
subsp. malaccensis]
Length=352

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFL  NNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLCENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG  HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGIQHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>emb|CDO98444.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVF+PYVGG +HA+VLLPPLEGLCSVE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEHANVLLPPLEGLCSVEETCVRDKAVESLCRIGSQMREA  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLLEFFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_006279157.1| hypothetical protein CARUB_v100079670mg, partial [Capsella rubella]
 gb|EOA12055.1| hypothetical protein CARUB_v100079670mg, partial [Capsella rubella]
Length=305

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F+PLAKRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFLPLAKRLAAGEWFTARVSACGIFHIAYP  154



>ref|XP_007036503.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
 gb|EOY21004.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
Length=432

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_008339694.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S++E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSVVEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KEH44250.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFL+ NNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLTENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HASVLLPPLE  CSVE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLPPLEAFCSVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_008361732.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S++E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSVVEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KJB39314.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39315.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39316.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=526

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S++E PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|EPS62738.1| hypothetical protein M569_12049 [Genlisea aurea]
Length=587

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDSFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_006583401.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006583402.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
Length=587

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG DHA+VLLPPLE LC+VE TCVR+K+VESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVDHANVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_002276180.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
 ref|XP_010663586.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
Length=587

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREP  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_007152779.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
 gb|ESW24773.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
Length=587

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA+VLLPPLE LC+VE TCVR+K+VESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKSVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_004135105.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cucumis sativus]
 ref|XP_004159301.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cucumis sativus]
 ref|XP_008446576.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Cucumis melo]
Length=587

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_006376763.1| hypothetical protein POPTR_0012s06210g [Populus trichocarpa]
 gb|ERP54560.1| hypothetical protein POPTR_0012s06210g [Populus trichocarpa]
Length=392

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ ++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MATIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA+ELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+K+VESLC IG+QM E 
Sbjct  61   DEVLLAMADELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKSVESLCRIGTQMIEQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|KHG03474.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=586

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S++E PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|KJB39317.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=584

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S++E PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_009356482.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_002529138.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF33251.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KJB39313.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=586

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S++E PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_011077133.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Sesamum indicum]
Length=587

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV + IPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDSVIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>emb|CBI15438.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  4    SYLSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNND  183
            S +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NND
Sbjct  54   SEMAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENND  113

Query  184  DDDEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMX  363
            DDDEVLLAMAEELGVFIPYVGG +HA+VLLPPLE LC+VE TCVR+KAVESLC IG+QM 
Sbjct  114  DDDEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMR  173

Query  364  ESDLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            E DLV +FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  174  EPDLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYP  209



>ref|XP_010044277.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 ref|XP_010044278.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 gb|KCW86343.1| hypothetical protein EUGRSUZ_B03031 [Eucalyptus grandis]
Length=587

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA+VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCAVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHI YP
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGLFHIVYP  154



>gb|KDP29385.1| hypothetical protein JCGZ_18306 [Jatropha curcas]
Length=587

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|AAG29594.1|AF196287_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
beta isoform [Medicago sativa subsp. x varia]
Length=587

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLA AEELGVF+PYVGG DHASVLLPPLE LC+VE TCVR+K+VESLC IG+QM E 
Sbjct  61   DEVLLATAEELGVFVPYVGGVDHASVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DLVEHFIPLVKRLASGEWFTARVSSCGLFHIAYP  154



>ref|XP_009336593.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
 ref|XP_009336594.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
Length=587

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_006854054.1| hypothetical protein AMTR_s00048p00082810 [Amborella trichopoda]
 gb|ERN15521.1| hypothetical protein AMTR_s00048p00082810 [Amborella trichopoda]
Length=587

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLASGEWFTARVSSCGLFHIAYP  154



>ref|XP_007225550.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 ref|XP_007225551.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26749.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26750.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
Length=587

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_009396282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Musa acuminata subsp. malaccensis]
Length=587

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ ++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MATIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F+PL KRLAAG WFTARVSSCGLFH+AYP
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSSCGLFHVAYP  154



>ref|XP_008243199.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Prunus mume]
Length=587

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_008350866.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>emb|CDY69424.1| BnaAnng30450D, partial [Brassica napus]
Length=531

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMTEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC +GSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSACGVFHIAYP  154



>ref|XP_004297127.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Fragaria vesca subsp. vesca]
Length=587

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_007036502.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
 gb|EOY21003.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
Length=587

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_010265183.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
 ref|XP_010265184.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
Length=587

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVF+PYVGG ++A++LLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEYANILLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|AAG29593.1|AF196286_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Medicago sativa subsp. x varia]
Length=585

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  22   EXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVL  201
            + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFL+ NNDDDDEVL
Sbjct  3    DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLTENNDDDDEVL  62

Query  202  LAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVX  381
            LAMAEELGVFIPYVGG +HASVLLPPLE  CSVE TCVR+KAVESLC IGSQM ESDLV 
Sbjct  63   LAMAEELGVFIPYVGGVEHASVLLPPLEAFCSVEETCVRDKAVESLCRIGSQMRESDLVE  122

Query  382  AFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
             FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  123  YFIPLVKRLAAGEWFTARVSACGLFHIAYP  152



>ref|XP_010094777.1| hypothetical protein L484_019987 [Morus notabilis]
 gb|EXB56942.1| hypothetical protein L484_019987 [Morus notabilis]
Length=579

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFI YVGG +HA+VLLPPLE LCSVE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFITYVGGVEHANVLLPPLETLCSVEETCVRDKAVESLCRIGSQMREK  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPMVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|AEQ75494.1| serine/threonine protein phosphatase 2a regulatory subunit A 
[Rosa multiflora]
Length=587

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVSWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_006437703.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 ref|XP_006437704.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50943.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50944.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
Length=587

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  +IPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_006484434.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Citrus sinensis]
 ref|XP_006484435.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Citrus sinensis]
Length=587

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  +IPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_002312385.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 ref|XP_002311444.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE89752.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 gb|EEE88811.2| phosphatase family protein [Populus trichocarpa]
Length=586

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTVEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG D+A VLLPPLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGVDYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_010681587.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
 ref|XP_010681588.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLL+MA+ELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLSMADELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDYFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KJB23733.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=504

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG  +A+VLLPPLE LC+VE TCVREKAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLF IAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYP  154



>gb|KDO41974.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=513

 Score =   267 bits (683),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRLAAG WFTARVSSCGLFH+AYP
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYP  154



>gb|KEH27050.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLA AEELGVF+PYVGG +HASVLLPPLE LC+VE TCVR+K+VESLC IG+QM E 
Sbjct  61   DEVLLATAEELGVFVPYVGGVEHASVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DLVEHFIPLVKRLASGEWFTARVSSCGLFHIAYP  154



>ref|XP_006660451.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Oryza brachyantha]
Length=587

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ M+ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MATMDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  F+P+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFVPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_004956390.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Setaria italica]
Length=583

 Score =   269 bits (687),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_004497109.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004497110.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Cicer arietinum]
Length=587

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTR+ELIPFL+ NNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRRELIPFLTENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA+ LLPPLE  CSVE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANALLPPLEAFCSVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_002314877.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 ref|XP_006378496.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
 gb|ABK94060.1| unknown [Populus trichocarpa]
 gb|EEF01048.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 gb|ERP56293.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
Length=587

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ME PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTMEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLA+AEELGVFIPYVGG ++A VLLPPLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLALAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFT+RVS+CGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTSRVSACGLFHIAYP  154



>ref|XP_009152111.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Brassica rapa]
Length=587

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMTDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC +GSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSACGVFHIAYP  154



>ref|XP_010263329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nelumbo nucifera]
Length=587

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_006660452.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Oryza brachyantha]
Length=583

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ M+ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MATMDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  F+P+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFVPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|KDO41973.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=536

 Score =   267 bits (683),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRLAAG WFTARVSSCGLFH+AYP
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYP  154



>ref|XP_004956389.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Setaria italica]
Length=587

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>emb|CDY13586.1| BnaA06g33370D [Brassica napus]
Length=595

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMTDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC +GSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSACGVFHIAYP  154



>gb|KJB52972.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52973.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52974.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
Length=588

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIR+LSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA+VLLPPLE LC VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCIVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEFFIPLLKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|NP_001062674.1| Os09g0249700 [Oryza sativa Japonica Group]
 emb|CAB51803.1| phosphatase 2A regulatory A subunit [Oryza sativa]
 emb|CAB51804.1| protein phosphatase 2A A subunit [Oryza sativa]
 dbj|BAD19910.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAD22212.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAF24588.1| Os09g0249700 [Oryza sativa Japonica Group]
 gb|EAZ43900.1| hypothetical protein OsJ_28521 [Oryza sativa Japonica Group]
 dbj|BAG91590.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84161.1| hypothetical protein OsI_30535 [Oryza sativa Indica Group]
Length=587

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ M+ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MASMDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  F+P+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFVPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_008648330.1| PREDICTED: LOC732740 isoform X1 [Zea mays]
 gb|AFW75380.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=587

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_002511958.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF50627.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ ++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MATVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA+VLLPPLE LC+VE TCVR+KAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAY
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAY  153



>ref|XP_006395624.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
 gb|ESQ32910.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC +GSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSAVEETCVREKAVESLCRVGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F+PL KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVVHFVPLVKRLAAGEWFTARVSACGVFHIAYP  154



>ref|XP_004972370.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Setaria italica]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIR+LSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMNES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_008659343.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Zea mays]
 gb|AFW86039.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|NP_001105839.1| LOC732740 [Zea mays]
 gb|AAY24685.1| protein phosphatase 2A regulatory subunit A [Zea mays]
 gb|AFW75381.1| protein phosphatase 2A regulatory subunit A [Zea mays]
Length=583

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_011008279.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008287.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008294.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ME PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSAMEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLA+AEELGVFIPYVGG ++A VLLPPLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLALAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFT+RVS+CGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAAGEWFTSRVSACGLFHIAYP  154



>gb|ACL54598.1| unknown [Zea mays]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|KJB23732.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23734.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23735.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=586

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG  +A+VLLPPLE LC+VE TCVREKAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLF IAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYP  154



>ref|XP_007046273.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
 gb|EOY02105.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIA ALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMAEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIACALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_008659344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X3 [Zea mays]
 gb|AFW86038.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=583

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_009606530.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
 ref|XP_009606531.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  F+PL KRLAAG WFTARVS+CGLFHIAY
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAY  153



>ref|XP_004238945.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Solanum lycopersicum]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  F+PL KRLAAG WFTARVS+CGLFHIAY
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAY  153



>ref|XP_006362557.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  F+PL KRLAAG WFTARVS+CGLFHIAY
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAY  153



>ref|XP_009766514.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana sylvestris]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  F+PL KRLAAG WFTARVS+CGLFHIAY
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAY  153



>ref|XP_006485775.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Citrus sinensis]
Length=587

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRLAAG WFTARVSSCGLFH+AYP
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYP  154



>ref|XP_010528048.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528049.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528050.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528051.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
Length=587

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DI LRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIHLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVREKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAY
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGLFHIAY  153



>ref|XP_003555890.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
 gb|KHN11434.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  22   EXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVL  201
            + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTR+ELIPFLS NNDDDDEVL
Sbjct  3    DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRRELIPFLSENNDDDDEVL  62

Query  202  LAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVX  381
            LAMAEELGVFIPYVGG +HASVLLPPLE LC+VE TCVR+KAVESLC IGSQM ESDLV 
Sbjct  63   LAMAEELGVFIPYVGGVEHASVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVE  122

Query  382  AFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
             +IPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  123  YYIPLVKRLAAGEWFTARVSACGLFHIAYP  152



>emb|CDP00596.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRL+TIARALGEERTRKELIPFLS NNDDD
Sbjct  48   MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLNTIARALGEERTRKELIPFLSENNDDD  107

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++ASVLLPPLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  108  DEVLLAMAEELGVFIPYVGGVEYASVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREN  167

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  168  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  201



>ref|XP_002876929.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53188.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE L SVE TCVREKAVESLC +GSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSSVEETCVREKAVESLCRVGSQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGVFHIAYP  154



>gb|KDO41972.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=587

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+KAVESLC IGSQM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRLAAG WFTARVSSCGLFH+AYP
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYP  154



>gb|KJB23730.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG  +A+VLLPPLE LC+VE TCVREKAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLF IAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYP  154



>gb|KJB23731.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG  +A+VLLPPLE LC+VE TCVREKAVESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +FIPL KRLAAG WFTARVSSCGLF IAYP
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYP  154



>ref|XP_007153361.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 ref|XP_007153362.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25355.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25356.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
Length=587

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIR+LSTIARALGEERTR+ELIPFL  NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRKLSTIARALGEERTRRELIPFLGENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVF+P+VGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFVPFVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|AFW75382.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=623

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_011070821.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Sesamum indicum]
Length=587

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S  + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSRADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAY
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAY  153



>ref|XP_006297363.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
 gb|EOA30261.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
Length=550

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F+PLAKRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFLPLAKRLAAGEWFTARVSACGIFHIAYP  154



>ref|XP_008374745.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++  LYPIAVLIDEL NEDI+LRLNSIRR+STIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDETLYPIAVLIDELKNEDIKLRLNSIRRISTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG DHA+VLLPPLE LC+VE TCVR+KAV+SLC IG QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVDHANVLLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|KGN52064.1| hypothetical protein Csa_5G608520 [Cucumis sativus]
Length=796

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  210  MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  269

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IGSQM ES
Sbjct  270  DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  329

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  330  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  363



>ref|XP_003536691.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006589702.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
 gb|KHN05580.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  22   EXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVL  201
            + PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTR+ELIPFLS NNDDDDEVL
Sbjct  3    DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRRELIPFLSENNDDDDEVL  62

Query  202  LAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVX  381
            LAMAEELGVFIPYVGG +HASVLLPPLE LC+VE TCVR+KA ESLC IGSQM ESDLV 
Sbjct  63   LAMAEELGVFIPYVGGVEHASVLLPPLETLCTVEETCVRDKAAESLCRIGSQMRESDLVE  122

Query  382  AFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
             +IPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  123  YYIPLVKRLAAGEWFTARVSACGLFHIAYP  152



>ref|XP_007210261.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
 gb|EMJ11460.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
Length=587

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSDNNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A++LLPPLE LC+VE TCVR+KAV+SLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANILLPPLETLCTVEETCVRDKAVDSLCRIGAQMREK  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFH+AYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHMAYP  154



>ref|XP_008659342.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Zea mays]
 gb|AFW86037.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=592

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_009347000.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++  LYPIAVLIDEL NEDI+LRLNSIRR+STIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDETLYPIAVLIDELKNEDIKLRLNSIRRVSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG DHA+VLLPPLE LC+VE TCVR+KAV+SLC IG QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVDHANVLLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_010551283.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
 ref|XP_010551284.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
Length=587

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLS N+DDD
Sbjct  1    MSAVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVREKAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGIEHAYVLLPPLEALCTVEETCVREKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +F+PL KRL+AG WF ARVS+CGLFH+AYP
Sbjct  121  DLVESFVPLVKRLSAGEWFAARVSACGLFHVAYP  154



>ref|XP_008240282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Prunus mume]
Length=587

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSDNNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A++LLPPLE LC+VE TCVR+KAV+SLC IG QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANILLPPLETLCTVEETCVRDKAVDSLCRIGVQMREK  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_010554238.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
 ref|XP_010554239.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
Length=586

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S ++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS +NDDD
Sbjct  1    MSTIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSESNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVF P+VGG +HA VLLPPLE LC+VE TCVREKAVESLC +GSQM E+
Sbjct  61   DEVLLAMAEELGVFTPFVGGVEHAHVLLPPLETLCTVEETCVREKAVESLCRVGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KJB50734.1| hypothetical protein B456_008G184500 [Gossypium raimondii]
Length=587

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E PLYPIA+LIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTVEEPLYPIALLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLL PLE LC+VE TCVR+KAV+SLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHARVLLAPLETLCTVEETCVRDKAVKSLCRIGSQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F+PL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_004512939.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cicer arietinum]
Length=587

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLA AEELGVF+PYVGG ++ASVLLPPLE LC+VE TCVR+K+VESLC IG+QM E 
Sbjct  61   DEVLLATAEELGVFVPYVGGVEYASVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DLVEHFIPLVKRLASGEWFTARVSSCGLFHIAYP  154



>ref|XP_008797605.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Phoenix dactylifera]
Length=587

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WFTARVSSCGLFHIAY
Sbjct  121  DLVDSFVPLVKRLAAGEWFTARVSSCGLFHIAY  153



>ref|XP_011021847.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021855.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021865.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E  LYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTVEERLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG D+A VLLPPLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGVDYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KJB80118.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=528

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTR ELIPFLS NNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRSELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLL PLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  F PL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLIEWFTPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_006307029.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
 gb|EOA39927.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
Length=610

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  24   MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  83

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  84   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMRET  143

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  144  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYP  177



>ref|XP_010495219.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSVIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYP  154



>ref|XP_010942275.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Elaeis guineensis]
Length=587

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  F+PL KRLAAG WFTARVSSCGLFHIAY
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSSCGLFHIAY  153



>ref|XP_010458784.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
2A 65 kDa regulatory subunit A gamma isoform-like [Camelina 
sativa]
Length=587

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYP  154



>ref|XP_010476329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYP  154



>gb|KJB80114.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80115.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80116.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=587

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTR ELIPFLS NNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRSELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLL PLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  F PL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLIEWFTPLVKRLAAGEWFTARVSACGLFHIAYP  154



>gb|KJB80117.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=589

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTR ELIPFLS NNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRSELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLL PLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  F PL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLIEWFTPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|NP_001030769.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 gb|AEE77070.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=544

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE L +VE TCVREKAVESLC +GSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FI L KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYP  154



>ref|XP_011006221.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ ++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MATIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA+ELGVFIPYVGG ++A+VLLPPLE LC+VE TCVR+K+VESLC IG+QM E 
Sbjct  61   DEVLLAMADELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKSVESLCRIGTQMIEQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVDHFSPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_010929062.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Elaeis guineensis]
Length=587

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
             LV  F+PL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  YLVDWFVPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_008393303.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   264 bits (675),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++  LYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMVDERLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA++LLPPLE LC+VE TCVR+KAV+SLC IG QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANILLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAY
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAY  153



>ref|XP_010677978.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA+E+G+FIPYVGG DHA+VLLPPLE LC+VE TCVR+KAV SLC I SQM ES
Sbjct  61   DEVLLAMAQEMGLFIPYVGGVDHATVLLPPLETLCTVEETCVRDKAVHSLCSIASQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV +F P+ KRLA+G WFTARVSSCGLF+IAYP
Sbjct  121  DLVQSFFPMLKRLASGEWFTARVSSCGLFYIAYP  154



>ref|XP_003534171.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA+VLLPPLE LC+VE T VR+K+VESLC IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETSVRDKSVESLCRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV   IPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYLIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>gb|KHN27183.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=587

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIR+LSTIARALGEERTR+ELIPFL  NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRKLSTIARALGEERTRRELIPFLGENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG QM ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGVEHAHVLLPPLEMLCTVEETCVRDKAVESLCRIGLQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLASGEWFTARVSSCGLFHIAYP  154



>ref|XP_003518674.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIR+LSTIARALGEERTR+ELIPFL  NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRKLSTIARALGEERTRRELIPFLGENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG QM ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGVEHAHVLLPPLEMLCTVEETCVRDKAVESLCRIGLQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DLVEYFIPLVKRLASGEWFTARVSSCGLFHIAYP  154



>emb|CAA57528.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
Length=587

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE L +VE TCVREKAVESLC +GSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FI L KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYP  154



>ref|NP_189208.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 sp|Q38950.2|2AAB_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A beta isoform; Short=AtA beta; Short=PP2A, 
subunit A, beta isoform [Arabidopsis thaliana]
 dbj|BAA95767.1| protein phosphotase 2a 65kd regulatory subunit [Arabidopsis thaliana]
 gb|AAO00848.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
 gb|AAP37715.1| At3g25800 [Arabidopsis thaliana]
 gb|AEE77069.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=587

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE L +VE TCVREKAVESLC +GSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FI L KRLAAG WFTARVS+CG+FHIAYP
Sbjct  121  DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYP  154



>gb|KHG15336.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=587

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGE+RTR ELIPFLS NNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRSELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVF+PYVGG +HA VLL PLE LC+VE TCVR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  F PL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  121  DLIERFTPLVKRLAAGEWFTARVSACGLFHIAYP  154



>ref|XP_010458785.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
 ref|XP_010458786.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ + PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+ G WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFFPLAKRLSGGEWFTARVSACGIFHIAYP  154



>ref|XP_006845686.1| hypothetical protein AMTR_s00019p00236090 [Amborella trichopoda]
 gb|ERN07361.1| hypothetical protein AMTR_s00019p00236090 [Amborella trichopoda]
Length=604

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  4    SYLSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNND  183
            +++++++ PLYPIA+LIDEL NED+QLRLNSIRRLSTIARALGEERTRKELIPFLS NND
Sbjct  17   NFMAMVDEPLYPIAILIDELKNEDLQLRLNSIRRLSTIARALGEERTRKELIPFLSENND  76

Query  184  DDDEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMX  363
            DDDEVL+AMAEELGVFIPYVGG +HA VLLPPLE LC+VE T VREK+VESLC IG QM 
Sbjct  77   DDDEVLVAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETFVREKSVESLCRIGVQMK  136

Query  364  ESDLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            ESD V  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  137  ESDQVDWFIPLVKRLAAGEWFTARVSACGLFHIAYP  172



>gb|KDP20104.1| hypothetical protein JCGZ_05873 [Jatropha curcas]
Length=587

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++ ++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MATIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG + A+VLLPPLE LC+VE TCVR+KAVESL  IG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEFANVLLPPLETLCTVEETCVRDKAVESLYRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DVVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_010495228.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+ + PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+ G WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFFPLAKRLSGGEWFTARVSACGIFHIAYP  154



>gb|EYU40874.1| hypothetical protein MIMGU_mgv1a003588mg [Erythranthe guttata]
Length=576

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  19   MEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEV  198
            ME PLYPIAVL+DEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFL  NNDD+DEV
Sbjct  3    MEEPLYPIAVLVDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLCENNDDEDEV  62

Query  199  LLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLV  378
            LLA AEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+K+VESLC IGSQM ESDLV
Sbjct  63   LLATAEELGVFIPYVGGMEHAHVLLPPLETLCTVEETCVRDKSVESLCRIGSQMRESDLV  122

Query  379  XAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
              FIPL KRLAAG WFTARVS+CGLFHIAY
Sbjct  123  DWFIPLVKRLAAGEWFTARVSACGLFHIAY  152



>ref|XP_009391301.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391302.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVF+PY+GG + A VLLPPLE LC V+ TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFVPYIGGVEFAYVLLPPLETLCIVDETCVRDKAVESLCRIGTQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRLA G WFTARVSSCGLFHIAYP
Sbjct  121  DIVEWFIPLVKRLAGGEWFTARVSSCGLFHIAYP  154



>gb|AEB40165.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40166.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40167.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|EMT17513.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Aegilops tauschii]
Length=587

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FI + KRLAAG WFTARVSSCGLFHIAYP
Sbjct  121  DIVDYFIAVVKRLAAGEWFTARVSSCGLFHIAYP  154



>ref|XP_009415447.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++  + PLYPIAVLIDEL NEDIQLRLNSIR+LSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAATDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG  +A VLLPPLE LC+VE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVGYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PL KRLA G WFT+RVSSCGLFHIAYP
Sbjct  121  DLVGWFAPLVKRLATGEWFTSRVSSCGLFHIAYP  154



>ref|XP_002893420.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69679.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
Length=588

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG ++A VLLPPLE LC+VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVESLCKIGSQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CG+FH+AY
Sbjct  121  DLVESFVPLVKRLAAGEWFAARVSACGIFHVAY  153



>ref|XP_010477897.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Camelina sativa]
Length=588

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG ++A VLLPPLE LC+VE TCVREKAV+SLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVDSLCKIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CG+FH+AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAY  153



>ref|XP_002892742.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69001.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE L +VE TCVREKAV+SLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVDSLCRIGAQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYP  154



>ref|XP_006307078.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
 gb|EOA39976.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
Length=588

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG ++A VLLPPLE LC+VE TCVREKAV+SLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVDSLCKIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CG+FH+AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAY  153



>ref|XP_010476330.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S  + PLYPIAVLI+EL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSTADEPLYPIAVLIEELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSNVEETCVREKAVESLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+ G WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFFPLAKRLSGGEWFTARVSACGIFHIAYP  154



>ref|XP_004300534.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
 ref|XP_011465404.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
Length=586

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIR+LSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVF+PYVGG ++A++LLPPLE LC+VE TCVR+KAVESL  IG+QM E 
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEYANILLPPLETLCTVEETCVRDKAVESLGRIGAQMREQ  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  FIPL KRLAAG WFTARVSSCGLFHIAY
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAY  153



>ref|XP_003577085.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Brachypodium distachyon]
Length=587

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FI + KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYP  154



>ref|XP_010237336.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Brachypodium distachyon]
Length=583

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE L +VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FI + KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYP  154



>emb|CDY51132.1| BnaA07g37150D [Brassica napus]
Length=586

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA ELGVFIP+VGG +HA VLLPPLE LC+VE TCVREKAV+SLC IGS+M ES
Sbjct  61   DEVLLAMAGELGVFIPFVGGVEHAHVLLPPLESLCTVEETCVREKAVDSLCKIGSEMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CGLFH+AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFHVAY  153



>ref|XP_002282096.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
 ref|XP_010647838.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
Length=587

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N DIQLRLNSIRRLSTIARALGEERTR ELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAM EELGVFIPYVGG +HA VLLPPLE LC+VE T VR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  FIPL KRLA+G WFTARVS+CGLFHIAYP
Sbjct  121  DLINWFIPLVKRLASGEWFTARVSACGLFHIAYP  154



>ref|XP_010499103.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG ++A VLLPPLE LC+VE TCVREKAV+SLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVDSLCKIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CG+FH+AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAY  153



>ref|XP_009103071.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Brassica rapa]
Length=586

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA ELGVFIP+VGG +HA VLLPPLE LC+VE TCVREKAV+SLC IGS+M ES
Sbjct  61   DEVLLAMAGELGVFIPFVGGVEHAHVLLPPLESLCTVEETCVREKAVDSLCKIGSEMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CGLFH+AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFHVAY  153



>ref|NP_001150156.1| LOC100283785 [Zea mays]
 gb|ACG38064.1| serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
Abeta isoform [Zea mays]
 gb|ACR36218.1| unknown [Zea mays]
 gb|AFW87186.1| Serine/threonine-protein phosphatase regulatory subunit Abeta 
isoform [Zea mays]
Length=587

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NEDIQLRLNSI++LSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIKKLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCQIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  F  + KRLA G WFTARVSSCGLFHIAYP
Sbjct  121  DIVDWFAHVVKRLAVGEWFTARVSSCGLFHIAYP  154



>emb|CBI27044.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N DIQLRLNSIRRLSTIARALGEERTR ELIPFLS NNDDD
Sbjct  50   MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD  109

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAM EELGVFIPYVGG +HA VLLPPLE LC+VE T VR+KAVESLC IGSQM E+
Sbjct  110  DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN  169

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  FIPL KRLA+G WFTARVS+CGLFHIAYP
Sbjct  170  DLINWFIPLVKRLASGEWFTARVSACGLFHIAYP  203



>emb|CAN68660.1| hypothetical protein VITISV_002162 [Vitis vinifera]
Length=582

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N DIQLRLNSIRRLSTIARALGEERTR ELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAM EELGVFIPYVGG +HA VLLPPLE LC+VE T VR+KAVESLC IGSQM E+
Sbjct  61   DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  FIPL KRLA+G WFTARVS+CGLFHIAYP
Sbjct  121  DLINWFIPLVKRLASGEWFTARVSACGLFHIAYP  154



>ref|XP_008783038.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783039.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783040.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
Length=587

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A+VLLPPLE LC+VE T VR+KAVESLC IG+QM ++
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETFVRDKAVESLCRIGAQMKKN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  FIPL KRLAA  WFT RVSSCGLFHIAYP
Sbjct  121  DLVDWFIPLVKRLAACEWFTGRVSSCGLFHIAYP  154



>emb|CDY36104.1| BnaA08g19440D [Brassica napus]
Length=588

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIALLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG +HA V+LPPLE LC+VE T VREKAV+SLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEHAHVILPPLESLCTVEETTVREKAVDSLCKIGSQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CGLFH+AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFHVAY  153



>ref|XP_010460344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG ++A VLLPPLE LC+VE TCVREKA++SLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKALDSLCKIGSQMRET  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CG+FH+AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAY  153



>ref|XP_006417131.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 ref|XP_006417132.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35484.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35485.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
Length=587

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQLRLNSIRRLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG +HA+VLLPPLE L +VE T VREKAV+SLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEHANVLLPPLETLSTVEETIVREKAVDSLCRIGSQMREN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV  FIPLAKRL+AG WFTARVS+CG+FH+AY
Sbjct  121  DLVDHFIPLAKRLSAGEWFTARVSACGIFHVAY  153



>gb|AAB60713.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis thaliana]
Length=590

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG + A VLLPPLE LC+VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEFAHVLLPPLESLCTVEETCVREKAVESLCKIGSQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLA G WF ARVS+CG+FH+AY
Sbjct  121  DLVESFVPLVKRLAGGEWFAARVSACGIFHVAY  153



>ref|NP_173920.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
 sp|Q38845.1|2AAA_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A alpha isoform; Short=AtA alpha; Short=PP2A, 
subunit A, alpha isoform; Short=PR-65 A; AltName: Full=Protein 
ROOTS CURL IN NAPHTHYLPHTHALAMIC ACID 1; AltName: Full=Protein 
enhancer of ethylene-response 1 [Arabidopsis thaliana]
 gb|AAG50801.1|AC079281_3 phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAC49255.1| phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAM53315.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAN15427.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AEE30632.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
Length=588

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG + A VLLPPLE LC+VE TCVREKAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEFAHVLLPPLESLCTVEETCVREKAVESLCKIGSQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLA G WF ARVS+CG+FH+AY
Sbjct  121  DLVESFVPLVKRLAGGEWFAARVSACGIFHVAY  153



>ref|XP_009109883.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
 ref|XP_009109885.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
Length=588

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIALLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG +HA ++LPPLE LC+VE T VREKAV+SLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEHAHMILPPLESLCTVEETTVREKAVDSLCKIGSQMKES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CGLFH+AY
Sbjct  121  DLVDSFVPLVKRLAAGKWFAARVSACGLFHVAY  153



>ref|XP_009396657.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=992

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL NED+QLRLNSIR+LSTIARALGEERTRKELIPFLS NNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDVQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG ++A VLLPPLE LCSVE TCVR+KAVESLC IG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLEILCSVEETCVRDKAVESLCRIGAQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
             LV  F PL KRLAAG WFT+RVSSCGLFHIAYP
Sbjct  121  SLVDWFAPLVKRLAAGEWFTSRVSSCGLFHIAYP  154



>ref|XP_010237331.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Brachypodium 
distachyon]
Length=583

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++ + PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMADEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLL PLE L +VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLSPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FI + KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYP  154



>ref|XP_003577041.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Brachypodium 
distachyon]
Length=587

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++ + PLYPIAVLIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDD+
Sbjct  1    MAMADEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLL PLE L +VE TCVR+KAVESLC IG+QM E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLSPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FI + KRLA+G WFTARVSSCGLFHIAYP
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYP  154



>emb|CAA57527.1| 65 kDa regulatory subunit of protein phosphatase 2A [Arabidopsis 
thaliana]
Length=590

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIP+VGG + A VLLPPLE LC+VE TCVR KAVESLC IGSQM E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEFAHVLLPPLESLCTVEETCVRGKAVESLCKIGSQMKEN  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLA G WF ARVS+CG+FH+AY
Sbjct  121  DLVESFVPLVKRLAGGEWFAARVSACGIFHVAY  153



>ref|XP_006415878.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
 dbj|BAJ33743.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34231.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
Length=588

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA ELGVFIPYVGG +HA VLL PLE LC+VE TCVREKAV+SLC IGSQM ES
Sbjct  61   DEVLLAMAGELGVFIPYVGGIEHAHVLLSPLESLCTVEETCVREKAVDSLCKIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL KRLAAG WF ARVS+CGLF +AY
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFPVAY  153



>ref|XP_006441864.1| hypothetical protein CICLE_v10022447mg [Citrus clementina]
 gb|ESR55104.1| hypothetical protein CICLE_v10022447mg [Citrus clementina]
Length=185

 Score =   242 bits (617),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIAVLIDEL N+DIQLRLNSIRRLSTIARALGEERT KELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTPKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TC+R+KAVESLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCMRDKAVESLCRIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSS  444
            DLV  FIPL KRLAAG WFTARVS+
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSA  145



>ref|XP_010036877.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036878.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036879.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 gb|KCW48540.1| hypothetical protein EUGRSUZ_K02214 [Eucalyptus grandis]
Length=588

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            ++++E PLYPIA+LIDEL NEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS NNDDD
Sbjct  2    MAVIEEPLYPIALLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  61

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELG F+PYVGG  HA+VLL PLE LC+VE T VR+KAV SLC IG QM E 
Sbjct  62   DEVLLAMAEELGAFLPYVGGVGHANVLLTPLETLCTVEETRVRDKAVASLCRIGDQMREQ  121

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIP+ KRLAAG WFTARVS+CGLFH+AYP
Sbjct  122  DVVDYFIPMMKRLAAGEWFTARVSACGLFHVAYP  155



>ref|XP_001775815.1| predicted protein [Physcomitrella patens]
 gb|EDQ59354.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL N+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  4    MAMVDEPLYPIAILIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  63

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA+ELG FIPYVGG D+A VLL PLE LC+VE T VR+K+VESLC IGSQM E 
Sbjct  64   DEVLLAMADELGGFIPYVGGVDYAHVLLSPLESLCTVEETVVRDKSVESLCKIGSQMKER  123

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRL AG WFTARVS+CGLFH+AYP
Sbjct  124  DVVEWFIPLVKRLGAGEWFTARVSACGLFHVAYP  157



>ref|XP_001777048.1| predicted protein [Physcomitrella patens]
 gb|EDQ58162.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL N+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLS NNDDD
Sbjct  4    MAMVDEPLYPIAILIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  63

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA+ELG FI +VGG D+A VLLPPLE LC+VE T VR+KAVESLC IGSQM E 
Sbjct  64   DEVLLAMADELGGFIAHVGGVDYAHVLLPPLESLCTVEETVVRDKAVESLCKIGSQMKER  123

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRL AG WFTARVS+CGLFHIAYP
Sbjct  124  DVVEWFIPLVKRLGAGEWFTARVSACGLFHIAYP  157



>emb|CDY42101.1| BnaA09g28590D [Brassica napus]
Length=589

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL N+DIQLRLNSIRRLSTI+RALGEERTRKELIPFLS N+DDD
Sbjct  1    MAMVDEPLYPIALLIDELKNDDIQLRLNSIRRLSTISRALGEERTRKELIPFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFI YVGG +HA VLLPPLE LC+VE T VREKAV+SLC IGSQM ES
Sbjct  61   DEVLLAMAEELGVFILYVGGLEHAHVLLPPLESLCTVEETSVREKAVDSLCKIGSQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL K LAAG WF ARVS+CGLFH+AY
Sbjct  121  DLVDSFVPLVKILAAGEWFAARVSACGLFHVAY  153



>ref|NP_001031035.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE28999.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=537

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQ RLNSI+RLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQRRLNSIKRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELG FI YVGG ++A VLLPPLE L +VE TCVREKAV+SLC IG+QM ES
Sbjct  61   DEVLLAMAEELGGFILYVGGVEYAYVLLPPLETLSTVEETCVREKAVDSLCRIGAQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYP  154



>ref|XP_002973833.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
 ref|XP_002983557.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ15458.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ24788.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
Length=580

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +1

Query  16   IMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDE  195
            +++ PLYPIA+LIDEL NEDI LRLNSIRRLSTIARALGEERTRKELIPFLS NNDDDDE
Sbjct  1    MVDEPLYPIAILIDELKNEDIHLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDE  60

Query  196  VLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDL  375
            VLLAMAEELG FIPYVGG D+A VLLPPLE LC+V+ T VREKAVESLC IGSQM E DL
Sbjct  61   VLLAMAEELGAFIPYVGGVDYAYVLLPPLETLCTVDETIVREKAVESLCRIGSQMKEKDL  120

Query  376  VXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            V  FIPL KRL A  WFT+R+S+C LFH+AYP
Sbjct  121  VDWFIPLVKRLGADEWFTSRISACCLFHVAYP  152



>gb|AAG09551.1|AC011810_10 Putative protein phosphotase 2a 65kd regulatory subunit [Arabidopsis 
thaliana]
Length=591

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQ RLNSI+RLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQRRLNSIKRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELG FI YVGG ++A VLLPPLE L +VE TCVREKAV+SLC IG+QM ES
Sbjct  61   DEVLLAMAEELGGFILYVGGVEYAYVLLPPLETLSTVEETCVREKAVDSLCRIGAQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYP  154



>ref|NP_172790.2| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 ref|NP_001184981.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 sp|Q38951.2|2AAG_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A gamma isoform; Short=AtA gamma; Short=PP2A, 
subunit A, gamma isoform [Arabidopsis thaliana]
 gb|AAM20611.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AAO00961.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AEE28998.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE29000.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=587

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+++ PLYPIAVLIDEL N+DIQ RLNSI+RLS IARALGEERTRKELIPFLS NNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQRRLNSIKRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELG FI YVGG ++A VLLPPLE L +VE TCVREKAV+SLC IG+QM ES
Sbjct  61   DEVLLAMAEELGGFILYVGGVEYAYVLLPPLETLSTVEETCVREKAVDSLCRIGAQMRES  120

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DLV  F PLAKRL+AG WFTARVS+CG+FHIAYP
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYP  154



>ref|XP_001769725.1| predicted protein [Physcomitrella patens]
 gb|EDQ65526.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPIA+LIDEL ++DIQLRLNSIRRLSTIARALGE+RTRKELIPFL  NNDDD
Sbjct  4    MAMVDEPLYPIAILIDELKSDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLCENNDDD  63

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA+ELG FI Y+GG ++A VLLPPLE LC+VE T VR+KAVESLC IG+QM E 
Sbjct  64   DEVLLAMADELGGFISYIGGVEYAHVLLPPLENLCTVEETVVRDKAVESLCKIGAQMKER  123

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            D+V  FIPL KRL AG WFTARVS+CGLFHIAYP
Sbjct  124  DVVEWFIPLVKRLGAGEWFTARVSACGLFHIAYP  157



>emb|CAA66487.1| protein phosphatase 2A [Nicotiana tabacum]
Length=586

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            + +++ PLYPI VLID+L  ++ QLRLNSIRRLSTIARALGEE+TRKELIPFLS NNDDD
Sbjct  1    MPMVDDPLYPIPVLIDDLKTDEKQLRLNSIRRLSTIARALGEEKTRKELIPFLSENNDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
             EVLLAMAEELGVFIPYVGG +HA VLLPPLE LC+VE TCVR+K VESLC IGSQM ES
Sbjct  61   -EVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKPVESLCRIGSQMRES  119

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
             LV  F+PL KRLAAG WFTARVS+CGLFHIAY
Sbjct  120  GLVDWFVPLVKRLAAGEWFTARVSACGLFHIAY  152



>emb|CDY03849.1| BnaC07g10740D [Brassica napus]
Length=529

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +++++ PLYPI VLIDEL N+DIQLRLN I RLSTIARALGEERTRKELI FLS N+DDD
Sbjct  1    MAMVDEPLYPIDVLIDELKNDDIQLRLNFICRLSTIARALGEERTRKELIHFLSENSDDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMA EL VFIP+VGG +HA VLLPPLE LC+VE TCVREK V+SLC IGS+M ES
Sbjct  61   DEVLLAMAGELVVFIPFVGGVEHAHVLLPPLESLCTVEETCVREKVVDSLCKIGSEMRES  120

Query  370  DLVXAFIPLAK--RLAAGXWFTARVSSCGLFHIAY  468
            DLV +F+PL K  +LAAG WF ARVS+CGLFH+ Y
Sbjct  121  DLVDSFVPLVKVRQLAAGEWFAARVSACGLFHVPY  155



>ref|XP_002988290.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
 gb|EFJ10709.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
Length=584

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            +++E PLYPIAVLIDEL N+D+QLR+NS+RRLSTIARALGE+RTR+ELIPFL+  +DDD+
Sbjct  3    AMVEEPLYPIAVLIDELKNDDVQLRINSVRRLSTIARALGEDRTRRELIPFLADGSDDDE  62

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLAMAEELG  +PYVGG ++A  LLPPLE LC VE + VREKAV SLC I S M E D
Sbjct  63   EVLLAMAEELGNLVPYVGGVEYAHSLLPPLEALCDVEESAVREKAVASLCKIASVMNERD  122

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            LV  F P+ KRLAAG WFTARVS CGL HI YP
Sbjct  123  LVEWFAPVVKRLAAGEWFTARVSVCGLLHIVYP  155



>ref|XP_002963887.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
 gb|EFJ35758.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
Length=587

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            +++E PLYPIAVLIDEL N+D+QLR+NS+RRLSTIARALGE+RTR+ELIPFL+  +DDD+
Sbjct  3    AMVEEPLYPIAVLIDELKNDDVQLRINSVRRLSTIARALGEDRTRRELIPFLADGSDDDE  62

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLAMAEELG  +PYVGG ++A  LLPPLE LC VE + VREKAV SLC I S M E D
Sbjct  63   EVLLAMAEELGNLVPYVGGVEYAHSLLPPLEALCDVEESAVREKAVASLCKIASVMNERD  122

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            LV  F P+ KRLAAG WFTARVS CGL HI YP
Sbjct  123  LVEWFAPVVKRLAAGEWFTARVSVCGLLHIVYP  155



>ref|XP_006367043.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=585

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S+    LYP+  ++DEL N+DIQLRLNSIRRLS+IA  LGE+RTR+ELIPFL  N DD+
Sbjct  1    MSMAHLLLYPM--VLDELKNDDIQLRLNSIRRLSSIACQLGEDRTRRELIPFLCRNTDDE  58

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAM+EELG FIPYVGG +HA VLLP L  LC+VE  CVR+KAVESLC IGSQM ES
Sbjct  59   DEVLLAMSEELGGFIPYVGGVEHAHVLLPLLGTLCTVEEICVRDKAVESLCRIGSQMRES  118

Query  370  DLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            DL+  F+ L KRLAAG WFTARVS+CGLFHIAYP
Sbjct  119  DLIDRFVSLVKRLAAGEWFTARVSACGLFHIAYP  152



>ref|XP_010319425.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Solanum lycopersicum]
Length=549

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYP+  ++DEL N+DIQLRLNS+RRLS+IA  LGE+RTR+ELIPFL  N DD+DEVLLAM
Sbjct  6    LYPM--ILDELKNDDIQLRLNSVRRLSSIACQLGEDRTRRELIPFLCRNTDDEDEVLLAM  63

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            +EELG FIPYVGG +HA VLLP L  LC+VE  CVR+KAVESLC IGSQM ESDL+  F+
Sbjct  64   SEELGGFIPYVGGVEHAHVLLPLLGTLCTVEEICVRDKAVESLCRIGSQMRESDLIDWFV  123

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
             L KRLAAG WFTARVS+CGLFHIAYP
Sbjct  124  SLVKRLAAGEWFTARVSACGLFHIAYP  150



>ref|XP_004236962.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Solanum lycopersicum]
Length=583

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYP+  ++DEL N+DIQLRLNS+RRLS+IA  LGE+RTR+ELIPFL  N DD+DEVLLAM
Sbjct  6    LYPM--ILDELKNDDIQLRLNSVRRLSSIACQLGEDRTRRELIPFLCRNTDDEDEVLLAM  63

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            +EELG FIPYVGG +HA VLLP L  LC+VE  CVR+KAVESLC IGSQM ESDL+  F+
Sbjct  64   SEELGGFIPYVGGVEHAHVLLPLLGTLCTVEEICVRDKAVESLCRIGSQMRESDLIDWFV  123

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
             L KRLAAG WFTARVS+CGLFHIAYP
Sbjct  124  SLVKRLAAGEWFTARVSACGLFHIAYP  150



>emb|CDX84993.1| BnaC05g20620D [Brassica napus]
Length=422

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   LRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAMAEELGVFIPYVGGXDHA  261
            LRLNSI RLSTI+RALGEERTRKELIPFLS N+ D+DEVLLAMAEELGVFIPYVGG +HA
Sbjct  67   LRLNSIHRLSTISRALGEERTRKELIPFLSENSGDNDEVLLAMAEELGVFIPYVGGVEHA  126

Query  262  SVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFIPLAKRLAAGXWFTARVS  441
             VLLPPLE LC+VE T VREKAV+SLC IG QM ESDLV +F+PL KRLA G WF ARVS
Sbjct  127  HVLLPPLESLCTVEETSVREKAVDSLCKIGFQMRESDLVDSFVPLVKRLAVGEWFAARVS  186

Query  442  SCGLFHIAY  468
            +CGLFH+ Y
Sbjct  187  ACGLFHVLY  195



>emb|CDY04182.1| BnaA09g19600D [Brassica napus]
Length=130

 Score =   202 bits (513),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 5/135 (4%)
 Frame = +1

Query  10   LSIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDD  189
            +S +E PLYPI VLIDEL N+DIQLRLNSIRRLSTIARALGEE+TRKELIPFLS NN+DD
Sbjct  1    MSTIEEPLYPIVVLIDELKNDDIQLRLNSIRRLSTIARALGEEKTRKELIPFLSENNEDD  60

Query  190  DEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXES  369
            DEVLLAMAEELGVFIPY GG +HA+ LLPPLE L +VE     EKAVESLC +G+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYAGGVEHANDLLPPLETLSTVE-----EKAVESLCRVGTQMRES  115

Query  370  DLVXAFIPLAKRLAA  414
            +LV  F+PL KRLAA
Sbjct  116  ELVDHFLPLVKRLAA  130



>ref|XP_007142892.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
 gb|ESW14886.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
Length=545

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +1

Query  136  ERTRKELIPFLSXNNDDDDEVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCV  315
            ERTR+ELIPFLS NNDDDDEVLLAMAEELGVFIPYVGG +HASVLLPPLE LC+VE TCV
Sbjct  1    ERTRRELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVEHASVLLPPLETLCTVEETCV  60

Query  316  REKAVESLCXIGSQMXESDLVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            R+KAVESLC IGSQM ESDLV  FIPL KRLAAG WFTARVS+CGLFHIAYP
Sbjct  61   RDKAVESLCRIGSQMRESDLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYP  112



>ref|XP_005644559.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20015.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
Length=589

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+ LRLNS+RRLSTIA ALGEERTR+ELIPF+S +NDD+DEVLLA+
Sbjct  10   LYPIAVLIDELKNEDVALRLNSVRRLSTIALALGEERTRRELIPFVSESNDDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AEELG FIPYVGG ++  VLL PLE LC+VE T VR+KAV+SL  I S++    +   F+
Sbjct  70   AEELGRFIPYVGGPEYGHVLLSPLENLCTVEETVVRDKAVQSLAAIASELPTKSVSEYFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAY  468
            PL KRLA G WFT+R+S CGL  +A+
Sbjct  130  PLVKRLAGGEWFTSRISCCGLLPVAH  155



>ref|XP_009764796.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=601

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 3/144 (2%)
 Frame = +1

Query  46   VLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDD--DDEVLLAMAEE  219
            VLIDEL NED  LRLNS+R+LSTIARALG ERTR E I ++  N DD  D+EVLL MA++
Sbjct  13   VLIDELMNEDSDLRLNSMRQLSTIARALGVERTRTEFIQYIRENFDDEYDEEVLLKMAQQ  72

Query  220  LGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFIPLA  399
            LGVFIPYVGG ++A+VLLPPLEGLC V  TCVR+KAVESLC IGSQM E DL+ +FIPL 
Sbjct  73   LGVFIPYVGGVEYATVLLPPLEGLCRVGETCVRDKAVESLCKIGSQMREPDLIESFIPLL  132

Query  400  KRLAAGXWFTARVSSCGLFHIAYP  471
            K+LA   W TA+ SSCGLFHIAYP
Sbjct  133  KKLADKEW-TAQSSSCGLFHIAYP  155



>gb|ADV40147.1| putative protein phosphatase 2A regulatory subunit A [Latrodectus 
hesperus]
Length=302

 Score =   191 bits (485),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I  Q   +DL   F+
Sbjct  72   AEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNISQQHSAADLEQHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAY  468
            PL KRLA+G WFT+R S+CGLF + Y
Sbjct  132  PLVKRLASGDWFTSRTSACGLFSVCY  157



>ref|XP_008479235.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like, partial [Diaphorina citri]
Length=420

 Score =   194 bits (493),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG+ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I +Q    DL   F+
Sbjct  72   AEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>gb|ELT97469.1| hypothetical protein CAPTEDRAFT_152474 [Capitella teleta]
Length=591

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++L TIA ALG ERTRKELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELRNEDVQLRLNSIKKLGTIALALGVERTRKELIPFLTDTIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG DH   LLPPLE L +VE T VR+KAV+SL  I +Q   +DL   F+
Sbjct  72   AEQLGTFTPLVGGSDHVHCLLPPLESLATVEETVVRDKAVDSLRIIATQHSTADLENHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRL++G WFT+R S+CGLF + YP
Sbjct  132  PLVKRLSSGDWFTSRTSACGLFSVCYP  158



>gb|KIY96952.1| Serine/threonine-protein phosphatase 2A regulatory subunit A 
beta isoform [Monoraphidium neglectum]
Length=546

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            L PIA+LIDEL N++   RLNSI+RLSTIA ALGEERTR ELIPFL+ +NDD+DEVLLAM
Sbjct  11   LLPIAILIDELKNDEAVRRLNSIQRLSTIALALGEERTRTELIPFLTESNDDEDEVLLAM  70

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AEELG F+PYVGG   A  LLPPLE L  VE T VR+KAVESLC +G ++ +  +    +
Sbjct  71   AEELGKFVPYVGGPAFAHHLLPPLENLSQVEETVVRDKAVESLCKVGEKLPDQSVAEYLV  130

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAY  468
            PL KRLA G WFT+RVSSCGLF +AY
Sbjct  131  PLIKRLAQGEWFTSRVSSCGLFTVAY  156



>ref|XP_008217607.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Nasonia vitripennis]
Length=590

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    STADDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRTELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG D+   LLPPLE L +VE T VR+KAVESL  I SQ   SD
Sbjct  66   EVLLALAEQLGTFTPLVGGPDYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPSD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            L   F+PL +RLA+G WFT+R S+CGLF + Y
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCY  157



>ref|XP_001600229.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Nasonia vitripennis]
Length=590

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    STADDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRTELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG D+   LLPPLE L +VE T VR+KAVESL  I SQ   SD
Sbjct  66   EVLLALAEQLGTFTPLVGGPDYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPSD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
            L   F+PL +RLA+G WFT+R S+CGLF + Y
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCY  157



>ref|XP_011266575.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Camponotus floridanus]
Length=590

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL +RLA+G WFT+R S+CGLF + YP
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011266584.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Camponotus floridanus]
Length=590

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL +RLA+G WFT+R S+CGLF + YP
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYP  158



>gb|EFN73589.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Camponotus floridanus]
Length=601

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL +RLA+G WFT+R S+CGLF + YP
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_008479230.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
2A 65 kDa regulatory subunit A alpha isoform-like [Diaphorina 
citri]
Length=593

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG+ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I +Q    DL   F+
Sbjct  72   AEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011144206.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Harpegnathos saltator]
 gb|EFN81456.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Harpegnathos saltator]
Length=590

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I SQ    D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPVD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL +RLA+G WFT+R S+CGLF + YP
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011144205.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Harpegnathos saltator]
Length=590

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I SQ    D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPVD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL +RLA+G WFT+R S+CGLF + YP
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011336007.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Cerapachys biroi]
Length=590

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    SATDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIAAQHSPAD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL +RLA+G WFT+R S+CGLF + YP
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011336006.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Cerapachys biroi]
 gb|EZA56198.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Cerapachys biroi]
Length=590

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+D
Sbjct  6    SATDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIAAQHSPAD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL +RLA+G WFT+R S+CGLF + YP
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011062133.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Acromyrmex echinatior]
Length=590

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +    LLPPLE L +VE T VR+KAVESL  I SQ   +DL   F+
Sbjct  72   AEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPADLEEHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011166786.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Solenopsis invicta]
Length=590

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +    LLPPLE L +VE T VR+KAVESL  I SQ   +DL   F+
Sbjct  72   AEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPADLEEHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>gb|EFZ13522.1| hypothetical protein SINV_04974 [Solenopsis invicta]
Length=589

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +    LLPPLE L +VE T VR+KAVESL  I SQ   +DL   F+
Sbjct  72   AEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPADLEEHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011166784.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Solenopsis invicta]
Length=590

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +    LLPPLE L +VE T VR+KAVESL  I SQ   +DL   F+
Sbjct  72   AEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPADLEEHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>gb|EGI60796.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Acromyrmex echinatior]
Length=603

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +    LLPPLE L +VE T VR+KAVESL  I SQ   +DL   F+
Sbjct  72   AEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPADLEEHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011062132.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Acromyrmex echinatior]
Length=590

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +    LLPPLE L +VE T VR+KAVESL  I SQ   +DL   F+
Sbjct  72   AEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPADLEEHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_011449632.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Crassostrea 
gigas]
Length=588

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  11   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVLLAL  70

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I +Q   +DL   F+
Sbjct  71   AEQLGNFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIATQHSPADLENHFV  130

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRL+AG WFT+R S+CGLF + YP
Sbjct  131  PLVKRLSAGDWFTSRTSACGLFAVCYP  157



>ref|XP_011449631.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Crassostrea 
gigas]
Length=590

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  11   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVLLAL  70

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I +Q   +DL   F+
Sbjct  71   AEQLGNFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIATQHSPADLENHFV  130

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRL+AG WFT+R S+CGLF + YP
Sbjct  131  PLVKRLSAGDWFTSRTSACGLFAVCYP  157



>ref|XP_002406082.1| protein phosphatase 2A regulatory subunit A, putative [Ixodes 
scapularis]
 gb|EEC03446.1| protein phosphatase 2A regulatory subunit A, putative [Ixodes 
scapularis]
Length=597

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  22   EXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVL  201
            E  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVL
Sbjct  9    EDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVL  68

Query  202  LAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVX  381
            LA+AE+LG F P VGG +    LLPPLE L +VE T VR+KAVESL  I  Q   SDL  
Sbjct  69   LALAEQLGNFTPLVGGSEFVHCLLPPLESLATVEETVVRDKAVESLRHISQQHSPSDLEQ  128

Query  382  AFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
             F+PL KRLA+G WFT+R S+CGLF + YP
Sbjct  129  YFVPLVKRLASGDWFTSRTSACGLFSVCYP  158



>ref|XP_002613476.1| hypothetical protein BRAFLDRAFT_119854 [Branchiostoma floridae]
 gb|EEN69485.1| hypothetical protein BRAFLDRAFT_119854 [Branchiostoma floridae]
Length=598

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +H   LLPPLE L +VE T VR+KAVESL  I      +DL   F+
Sbjct  70   AEQLGNFTPLVGGQEHVHCLLPPLESLATVEETVVRDKAVESLRKIAGDHSSADLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAQGDWFTSRTSACGLFSVPYP  156



>gb|KDR23265.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Zootermopsis nevadensis]
Length=591

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG DH   LLPPLE L +VE T VR+KAV+SL  I  Q    DL   F+
Sbjct  72   AEQLGSFTPLVGGSDHVHCLLPPLESLATVEETVVRDKAVDSLRAISGQHSPGDLEAHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAY  468
            PL +RLA+G WFT+R S+CGLF + Y
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCY  157



>gb|KIH42483.1| HEAT repeat protein [Ancylostoma duodenale]
Length=174

 Score =   182 bits (461),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+ LRLNSIR+LSTIA ALG ERTR ELI FL+    D+DEVLL +
Sbjct  16   LYPIAVLIDELRNEDVHLRLNSIRKLSTIALALGVERTRNELIQFLTDTIYDEDEVLLIL  75

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  +  ++    L   FI
Sbjct  76   AEQLGNFTPLVGGPEYVHCLLPPLENLATVEETVVRDKAVESLRKLADKLSTPALEEYFI  135

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            P+ KRLA G WFT+R S+CGLF +AYP
Sbjct  136  PMLKRLATGDWFTSRTSACGLFSVAYP  162



>ref|XP_011501051.1| PREDICTED: serine/threonine-protein phosphatase PP2A 65 kDa regulatory 
subunit [Ceratosolen solmsi marchali]
Length=590

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG D    LLPPLE L +VE T VR+KAVESL  I +Q   +DL   F+
Sbjct  72   AEQLGNFTPLVGGPDFVHSLLPPLEQLAAVEETVVRDKAVESLRNIAAQHSAADLEEHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RLA+G WFT+R S+CGLF + YP
Sbjct  132  PLVQRLASGDWFTSRTSACGLFSVCYP  158



>ref|NP_001034525.1| protein phosphatase 2, regulatory subunit A, alpha isoform [Tribolium 
castaneum]
 emb|CAI45288.1| phosphatase [Tribolium castaneum]
 gb|EFA10293.1| hypothetical protein TcasGA2_TC012508 [Tribolium castaneum]
Length=590

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG FI  VGG ++A  LLPPLE L +VE T VR+KAVESL  +  Q   +DL   F+
Sbjct  72   AEQLGSFITLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLENHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RL+AG WFT+R S+CGLF + YP
Sbjct  132  PLVQRLSAGDWFTSRTSACGLFSVCYP  158



>ref|XP_006747287.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Leptonychotes weddellii]
Length=407

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>gb|KHJ82027.1| HEAT repeat protein, partial [Oesophagostomum dentatum]
Length=274

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+ LRLNSIR+LSTIA ALG ERTR ELI FL+    D+DEVLL +
Sbjct  13   LYPIAVLIDELRNEDVHLRLNSIRKLSTIALALGVERTRNELIQFLTDTIYDEDEVLLIL  72

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG D+   LLPPLE L +VE T VR+KAVESL  I  +   + L   FI
Sbjct  73   AEQLGNFTPLVGGPDYVHCLLPPLENLATVEETVVRDKAVESLRKIADKHSTAALEEYFI  132

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            P+ KRLA G WFT+R S+CGLF +AYP
Sbjct  133  PMLKRLATGDWFTSRTSACGLFSVAYP  159



>dbj|BAN21528.1| serine/threonine protein phosphatase 2a regulatory subunit a, 
partial [Riptortus pedestris]
Length=464

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTI+ ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTISLALGVERTRSELIPFLTDTIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I SQ   SDL   F+
Sbjct  72   AEQLGQFTPLVGGPEYVYCLLPPLESLATVEETVVRDKAVESLRYISSQHSVSDLENRFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAY  468
            PL  RLA+G WFT+R S+CGLF + Y
Sbjct  132  PLVTRLASGDWFTSRTSACGLFSVCY  157



>gb|ERE60505.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
beta isoform-like isoform 1, partial [Cricetulus griseus]
Length=454

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_009060863.1| hypothetical protein LOTGIDRAFT_219170 [Lottia gigantea]
 gb|ESO88455.1| hypothetical protein LOTGIDRAFT_219170 [Lottia gigantea]
Length=590

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG+ERTR ELIPFL+    D+DEVLLA+
Sbjct  11   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGDERTRSELIPFLTDTIYDEDEVLLAL  70

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +H   LLPPLE L +VE T VR+KAV+SL  I +Q  ++DL   F+
Sbjct  71   AEQLGNFTPLVGGPEHVICLLPPLESLATVEETVVRDKAVDSLRLIAAQHSQADLENHFV  130

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAY  468
            PL KRL+ G WFT+R S+CGLF + Y
Sbjct  131  PLVKRLSLGDWFTSRTSACGLFAVCY  156



>ref|XP_001625764.1| predicted protein [Nematostella vectensis]
 gb|EDO33664.1| predicted protein [Nematostella vectensis]
Length=586

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERT+ ELIPFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTKTELIPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            A +LG F P VGG +HA  LLPPLE L +VE T VR+KAVESL  I + +   DL   F+
Sbjct  70   ASQLGTFTPLVGGPEHAHCLLPPLENLATVEETVVRDKAVESLRLISADLSTQDLENHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRL+ G WFT R S+CGLF + YP
Sbjct  130  PLLKRLSQGDWFTLRTSACGLFSVCYP  156



>ref|NP_001171792.1| protein phosphatase 2, regulatory subunit A, alpha [Saccoglossus 
kowalevskii]
Length=590

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  11   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVLLAL  70

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG  H   LLPPLE L +VE T VR+KAV+SL  I  +   SDL   F+
Sbjct  71   AEQLGSFTPLVGGPAHVHCLLPPLESLATVEETVVRDKAVDSLRNISEEHSASDLESHFV  130

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRL+ G WFT+R S+CGLF + YP
Sbjct  131  PLVKRLSGGDWFTSRTSACGLFSVCYP  157



>ref|XP_001120202.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Apis mellifera]
 ref|XP_003690652.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Apis florea]
 ref|XP_006610479.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Apis dorsata]
Length=590

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+ +  D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTESMYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LL PLE L +VE T VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGQFTPLVGGPEYVHCLLKPLESLATVEETVVRDKAVESLRTIAAQHSSTD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL  RLA G WFT+R S+CGLF + YP
Sbjct  126  LEEQFVPLIHRLATGDWFTSRTSACGLFSVCYP  158



>ref|XP_006562820.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Apis mellifera]
 ref|XP_006610478.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Apis dorsata]
Length=590

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = +1

Query  13   SIMEXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDD  192
            S  +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+ +  D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTESMYDED  65

Query  193  EVLLAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESD  372
            EVLLA+AE+LG F P VGG ++   LL PLE L +VE T VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGQFTPLVGGPEYVHCLLKPLESLATVEETVVRDKAVESLRTIAAQHSSTD  125

Query  373  LVXAFIPLAKRLAAGXWFTARVSSCGLFHIAYP  471
            L   F+PL  RLA G WFT+R S+CGLF + YP
Sbjct  126  LEEQFVPLIHRLATGDWFTSRTSACGLFSVCYP  158



>gb|ERL94150.1| hypothetical protein D910_11432 [Dendroctonus ponderosae]
Length=588

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGLERTRIELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG FIP VGG ++A  LLPPLE L +VE T VR+KAVESL  +  Q   +DL   F+
Sbjct  72   AEQLGQFIPLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLETHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RL++G WFT+R S CGLF   YP
Sbjct  132  PLVERLSSGDWFTSRTSGCGLFAACYP  158



>gb|AEE63553.1| unknown [Dendroctonus ponderosae]
Length=600

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGLERTRIELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG FIP VGG ++A  LLPPLE L +VE T VR+KAVESL  +  Q   +DL   F+
Sbjct  72   AEQLGQFIPLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLETHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RL++G WFT+R S CGLF   YP
Sbjct  132  PLVERLSSGDWFTSRTSGCGLFAACYP  158



>gb|ENN75423.1| hypothetical protein YQE_07974, partial [Dendroctonus ponderosae]
Length=592

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGLERTRIELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG FIP VGG ++A  LLPPLE L +VE T VR+KAVESL  +  Q   +DL   F+
Sbjct  72   AEQLGQFIPLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLETHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RL++G WFT+R S CGLF   YP
Sbjct  132  PLVERLSSGDWFTSRTSGCGLFAACYP  158



>gb|EPQ16739.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Myotis brandtii]
Length=1604

 Score =   194 bits (494),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_009015041.1| hypothetical protein HELRODRAFT_191252 [Helobdella robusta]
 gb|ESO06945.1| hypothetical protein HELRODRAFT_191252 [Helobdella robusta]
Length=603

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTRKELIPFL+    D+DEVLLA+
Sbjct  13   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRKELIPFLTDTIYDEDEVLLAL  72

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LL PLE L +VE T VREKAVESL  I +Q  + DL   F+
Sbjct  73   AEQLGQFADLVGGPEYVHTLLLPLESLATVEETVVREKAVESLRLISAQHSQDDLEKHFV  132

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R+S CGLF + YP
Sbjct  133  PLVKRLAVGDWFTSRMSVCGLFSVCYP  159



>gb|AFL91512.1| phosphatase-like protein, partial [Panonychus citri]
Length=585

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+Q+RLNSI++LSTI+ ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  12   LYPIAVLIDELRNEDVQIRLNSIKKLSTISLALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++ + LLPPLE L +VE T VREKAV+SL  I  Q    DL   F+
Sbjct  72   AEQLGNFTPLVGGVEYVNCLLPPLESLATVEETIVREKAVDSLRNISQQHSPQDLETHFV  131

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL +RL++G WFT R S+CGLF + YP
Sbjct  132  PLVRRLSSGDWFTTRTSACGLFSVCYP  158



>gb|EKC43171.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Crassostrea gigas]
Length=1039

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  11   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVLLAL  70

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG ++   LLPPLE L +VE T VR+KAVESL  I +Q   +DL   F+
Sbjct  71   AEQLGNFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIATQHSPADLENHFV  130

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRL+AG WFT+R S+CGLF + YP
Sbjct  131  PLVKRLSAGDWFTSRTSACGLFAVCYP  157



>pdb|2PKG|A Chain A, Structure Of A Complex Between The A Subunit Of Protein 
Phosphatase 2a And The Small T Antigen Of Sv40
 pdb|2PKG|B Chain B, Structure Of A Complex Between The A Subunit Of Protein 
Phosphatase 2a And The Small T Antigen Of Sv40
Length=580

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  1    LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  60

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  61   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  120

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  121  PLVKRLAGGDWFTSRTSACGLFSVCYP  147



>gb|ELK18455.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Pteropus alecto]
Length=2470

 Score =   194 bits (494),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31    LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
             LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  1340  LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  1399

Query  211   AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
             AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  1400  AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  1459

Query  391   PLAKRLAAGXWFTARVSSCGLFHIAYP  471
             PL KRLA G WFT+R S+CGLF + YP
Sbjct  1460  PLVKRLAGGDWFTSRTSACGLFSVCYP  1486



>pdb|4I5L|A Chain A, Structural Mechanism Of Trimeric Pp2a Holoenzyme Involving 
Pr70: Insight For Cdc6 Dephosphorylation
 pdb|4I5L|D Chain D, Structural Mechanism Of Trimeric Pp2a Holoenzyme Involving 
Pr70: Insight For Cdc6 Dephosphorylation
Length=584

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  5    LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  64

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  65   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  124

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  125  PLVKRLAGGDWFTSRTSACGLFSVCYP  151



>pdb|3DW8|A Chain A, Structure Of A Protein Phosphatase 2a Holoenzyme With 
B55 Subunit
 pdb|3DW8|D Chain D, Structure Of A Protein Phosphatase 2a Holoenzyme With 
B55 Subunit
Length=582

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  3    LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  62

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  63   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  122

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  123  PLVKRLAGGDWFTSRTSACGLFSVCYP  149



>dbj|BAE87562.1| unnamed protein product [Macaca fascicularis]
Length=590

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_005095307.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Aplysia californica]
Length=604

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++L TIA ALG ERTR ELIPFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLGTIALALGVERTRSELIPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F P VGG +H   LLPPLE L +VE T VR+KAV+SL  I  Q  ++DL   F+
Sbjct  70   AEQLGSFTPLVGGPEHVHCLLPPLESLATVEETVVRDKAVDSLRIIADQHSQADLENFFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAY  468
            P+ KRLA G WFT+R S+CGLF + Y
Sbjct  130  PMVKRLAGGDWFTSRTSACGLFSVCY  155



>gb|EFB14807.1| hypothetical protein PANDA_017429 [Ailuropoda melanoleuca]
Length=584

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_006157810.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Tupaia chinensis]
Length=554

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>dbj|BAF83282.1| unnamed protein product [Homo sapiens]
Length=589

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>emb|CAG29336.1| PPP2R1A [Homo sapiens]
Length=589

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>gb|AAH52678.1| Protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 
65), alpha isoform [Mus musculus]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|NP_001080135.1| protein phosphatase 2, regulatory subunit A, alpha [Xenopus laevis]
 gb|AAH46723.1| Ppp2r1a-prov protein [Xenopus laevis]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG + A  LLPPLE L +VE T VR++AVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEFAHCLLPPLESLATVEETVVRDRAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA+G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLASGDWFTSRTSACGLFSVCYP  156



>dbj|BAH72359.1| ACYPI002758 [Acyrthosiphon pisum]
Length=280

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = +1

Query  22   EXPLYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVL  201
            +  LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR ELIPFL+    D+DEVL
Sbjct  15   DTSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRVELIPFLTETIYDEDEVL  74

Query  202  LAMAEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVX  381
            LA+AE+LG F  YVGG D A  LLPPLE L +VE T VR+KAVESL  I      +DL  
Sbjct  75   LALAEQLGNFTNYVGGPDFAYTLLPPLESLATVEETVVRDKAVESLRQIAVLHSPTDLEN  134

Query  382  AFIPLAKRLAAGXWFTARVSSCGLFHIAY  468
             F+ L  RLA+G WFT+R S+CGLF + Y
Sbjct  135  HFVSLVIRLASGDWFTSRTSACGLFSVCY  163



>ref|XP_010584891.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Loxodonta africana]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>dbj|BAC40565.1| unnamed protein product [Mus musculus]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_005341840.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Ictidomys tridecemlineatus]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_005984732.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Pantholops 
hodgsonii]
 ref|XP_006065122.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Bubalus bubalis]
 gb|ABQ12932.1| alpha isoform of regulatory subunit A, protein phosphatase 2 
[Bos taurus]
 tpg|DAA19476.1| TPA: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Bos taurus]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_004415541.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Odobenus rosmarus divergens]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_004381783.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform 1 [Trichechus manatus 
latirostris]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_010829830.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Bison bison bison]
 ref|XP_010829831.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Bison bison bison]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_007955412.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Orycteropus afer afer]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_004619940.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Sorex araneus]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTALVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_005616279.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X3 [Canis lupus familiaris]
 ref|XP_011233483.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Ailuropoda melanoleuca]
Length=590

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>ref|XP_008845654.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Nannospalax galili]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



>gb|AAA36399.1| phosphatase 2A regulatory subunit [Homo sapiens]
Length=589

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  31   LYPIAVLIDELXNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSXNNDDDDEVLLAM  210
            LYPIAVLIDEL NED+QLRLNSI++LSTIA ALG ERTR EL+PFL+    D+DEVLLA+
Sbjct  10   LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLAL  69

Query  211  AEELGVFIPYVGGXDHASVLLPPLEGLCSVEXTCVREKAVESLCXIGSQMXESDLVXAFI  390
            AE+LG F   VGG ++   LLPPLE L +VE T VR+KAVESL  I  +   SDL   F+
Sbjct  70   AEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFV  129

Query  391  PLAKRLAAGXWFTARVSSCGLFHIAYP  471
            PL KRLA G WFT+R S+CGLF + YP
Sbjct  130  PLVKRLAGGDWFTSRTSACGLFSVCYP  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180