BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014D08

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629251.1|  PREDICTED: fructokinase-1                        67.4    4e-10   Nicotiana tomentosiformis
emb|CDP06530.1|  unnamed protein product                              62.8    1e-08   Coffea canephora [robusta coffee]
ref|XP_009772599.1|  PREDICTED: probable fructokinase-4               59.7    1e-07   Nicotiana sylvestris
gb|ADI87414.1|  fructokinase-like protein 1                           59.7    2e-07   Nicotiana benthamiana
ref|XP_009358825.1|  PREDICTED: uncharacterized protein LOC103949435  57.8    9e-07   
ref|XP_008388106.1|  PREDICTED: probable fructokinase-4               57.0    1e-06   
ref|XP_010528657.1|  PREDICTED: fructokinase-like 1, chloroplastic    56.2    3e-06   
ref|NP_001275447.1|  fructokinase-like protein 1                      54.7    6e-06   Solanum tuberosum [potatoes]
ref|XP_008239829.1|  PREDICTED: uncharacterized protein LOC103338406  54.3    1e-05   
ref|XP_004246362.1|  PREDICTED: fructokinase-like 1, chloroplastic    53.9    1e-05   Solanum lycopersicum
ref|XP_007205056.1|  hypothetical protein PRUPE_ppa004431mg           53.5    1e-05   Prunus persica
ref|XP_011077603.1|  PREDICTED: fructokinase-like 1, chloroplastic    53.1    2e-05   Sesamum indicum [beniseed]
gb|KDP24506.1|  hypothetical protein JCGZ_25070                       51.2    1e-04   Jatropha curcas
ref|XP_010427076.1|  PREDICTED: fructokinase-like 1, chloroplastic    50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004302649.2|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...  50.4    2e-04   Fragaria vesca subsp. vesca
ref|XP_010515923.1|  PREDICTED: fructokinase-like 1, chloroplastic    49.7    3e-04   Camelina sativa [gold-of-pleasure]
gb|ADI87418.1|  fructokinase-like protein 1                           49.3    4e-04   Lactuca sativa [cultivated lettuce]
ref|XP_009421323.1|  PREDICTED: fructokinase-1-like                   49.3    4e-04   
ref|XP_007026821.1|  Fructokinase-like 1                              49.3    4e-04   
ref|XP_011009152.1|  PREDICTED: fructokinase-like 1, chloroplastic    48.9    6e-04   Populus euphratica
ref|XP_010256724.1|  PREDICTED: fructokinase-like 1, chloroplastic    48.5    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004156589.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...  48.5    7e-04   
ref|XP_004137741.1|  PREDICTED: fructokinase-2-like                   48.5    8e-04   
gb|EYU26634.1|  hypothetical protein MIMGU_mgv1a005440mg              48.5    8e-04   Erythranthe guttata [common monkey flower]
ref|XP_010504200.1|  PREDICTED: fructokinase-like 1, chloroplastic    48.1    8e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010928949.1|  PREDICTED: fructokinase-like 1, chloroplastic    48.1    8e-04   Elaeis guineensis



>ref|XP_009629251.1| PREDICTED: fructokinase-1 [Nicotiana tomentosiformis]
Length=487

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (52%), Gaps = 19/130 (15%)
 Frame = +2

Query  98   THFKVSTFLPKHRYVCHPNPPKSSSADDH-TTTQQPSKTSRRALKKTSPSSKPRGRPKKE  274
            THF  ST     +     NP ++SS +DH TTTQ+P K S R  KK+S ++K   +P+K+
Sbjct  20   THFNFSTIFFSSKLPHRKNPLRASSGNDHSTTTQEPPKPSPRGPKKSSRTAKKSSKPQKD  79

Query  275  PQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLIC  454
               ET  ++    ++    K      E+++  V+                FPY +PPL+ 
Sbjct  80   SNFET--NIEKSNTQMDFSKNADDKIEKYDDGVD----------------FPYPNPPLVI  121

Query  455  CFGAAQKEFV  484
            CFGAAQKEFV
Sbjct  122  CFGAAQKEFV  131



>emb|CDP06530.1| unnamed protein product [Coffea canephora]
Length=503

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 68/143 (48%), Gaps = 41/143 (29%)
 Frame = +2

Query  101  HFKVSTF----LPKHRYVCHPNPPKSSSADDHTTTQQPSKTSRRALKKT-----------  235
            HF++ST     +P+ R      PPKSSS DD  TT +P K SRR  KK            
Sbjct  30   HFQISTIWLVPIPEARTFHKLLPPKSSS-DDDPTTAEPPKPSRRGRKKARSTTTTSSSAT  88

Query  236  SPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddydd  415
            S + +PRG  K +PQ+   +          P  + Q + + ++  ++             
Sbjct  89   STTKRPRGPRKSQPQNTQNDV---------PVTDKQEELDYYDDGID-------------  126

Query  416  gvdFPYESPPLICCFGAAQKEFV  484
               FPYE PPLICCFGAAQKEFV
Sbjct  127  ---FPYEYPPLICCFGAAQKEFV  146



>ref|XP_009772599.1| PREDICTED: probable fructokinase-4 [Nicotiana sylvestris]
Length=486

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 18/111 (16%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPR  331
            N  K SS D  TTTQ+P K S R  KK+S ++K   +P+K+   ET  ++    ++    
Sbjct  38   NTLKCSSNDHSTTTQEPPKHSPRGPKKSSRTAKKTSKPQKDSNFET--NIEKSNTQMELS  95

Query  332  KETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            K      E+++  V+                FPY +PPL+ CFGAAQKEFV
Sbjct  96   KNADDKIEKYDDGVD----------------FPYPNPPLVICFGAAQKEFV  130



>gb|ADI87414.1| fructokinase-like protein 1 [Nicotiana benthamiana]
Length=486

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 57/111 (51%), Gaps = 18/111 (16%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPR  331
            NP KSSS D  +TTQ+P K S R  KK+S ++K   +P K+   ET  ++    +     
Sbjct  38   NPLKSSSNDHSSTTQEPPKHSPRGPKKSSRTAKKSSKPPKDSSFET--NIEKSNTHMEFS  95

Query  332  KETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            K      E+++  V+                FPY +PPL+ CFGAAQKEFV
Sbjct  96   KNADDRIEKYDDGVD----------------FPYPNPPLVICFGAAQKEFV  130



>ref|XP_009358825.1| PREDICTED: uncharacterized protein LOC103949435 [Pyrus x bretschneideri]
Length=655

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 19/113 (17%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKK--TSPSSKPRGRPKKEPQSETIESVATKRSRAR  325
            NPP++S+      + +PSK +RR  KK  TS SS+   +PK+  +SET+          +
Sbjct  204  NPPRASTNGADNGSIEPSKPTRRGRKKGPTSSSSEAPKKPKRSKKSETVNGAVEPELVIQ  263

Query  326  PRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            P +   S+ E+++  ++                FPY+ PPL+CCFGAAQKEFV
Sbjct  264  P-ENPDSELEDYDDGID----------------FPYDDPPLVCCFGAAQKEFV  299



>ref|XP_008388106.1| PREDICTED: probable fructokinase-4 [Malus domestica]
 ref|XP_008350508.1| PREDICTED: probable fructokinase-4 [Malus domestica]
Length=499

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 19/113 (17%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKK--TSPSSKPRGRPKKEPQSETIESVATKRSRAR  325
            NPP++S+      + +PSK +RR  KK  TS SS+   +PK+  +SET+          +
Sbjct  48   NPPRASTNGADNGSIEPSKPTRRGRKKGPTSSSSEAPKKPKRSKKSETVNGAVEPEPVIQ  107

Query  326  PRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            P +   S+ E+++  ++                FPY+ PPL+CCFGAAQKEFV
Sbjct  108  P-ENPDSELEDYDDGID----------------FPYDDPPLVCCFGAAQKEFV  143



>ref|XP_010528657.1| PREDICTED: fructokinase-like 1, chloroplastic [Tarenaya hassleriana]
Length=654

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 61/118 (52%), Gaps = 23/118 (19%)
 Frame = +2

Query  137  YVCHPNPPKSSSADDHTTTQQPS--KTSRRALKKTSPSSKPRGRPKKEPQSETIESVATK  310
            YVC    PK+S   D T    P   K SRR  KK  P+++ R + +    + +IE+    
Sbjct  202  YVC----PKASINGDITNGTAPETPKPSRRGRKKKQPATEERAKLETRMGNGSIETDPET  257

Query  311  RSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            RS+    ++ + D  E E Y             DDG+DFPY+ PPL+CCFG+ +KEFV
Sbjct  258  RSQ----QKEEGDESELEDY-------------DDGLDFPYDDPPLVCCFGSVRKEFV  298



>ref|NP_001275447.1| fructokinase-like protein 1 [Solanum tuberosum]
 gb|ADI87416.1| fructokinase-like protein 1 [Solanum tuberosum]
Length=479

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 65/123 (53%), Gaps = 26/123 (21%)
 Frame = +2

Query  119  FLPKHRYVCHPNPPKSSSADDHTTTQQPSKTSRRALKKTS-PSSKPRGRPKKEPQSETIE  295
            F    ++ C  NPPKS++ D  TTTQ+P   SR   KK+S P++  + R  K+   +   
Sbjct  26   FFSSSKFPCRTNPPKSTTNDHPTTTQEPPTPSRGGRKKSSTPTTSRKSRTPKDSNFDI--  83

Query  296  SVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQK  475
            ++A          E+ +  EE + Y +             GVDFPY +PPL+CCFGAAQK
Sbjct  84   NIA----------ESNTQMEEIDDYDD-------------GVDFPYPNPPLVCCFGAAQK  120

Query  476  EFV  484
            EFV
Sbjct  121  EFV  123



>ref|XP_008239829.1| PREDICTED: uncharacterized protein LOC103338406 [Prunus mume]
Length=661

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 30/121 (25%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKK----------TSPSSKPRGRPKKEPQSETIESV  301
            NPP++S   +   + + S+ +RR  KK          TSP  K +   K + ++ T+E+ 
Sbjct  205  NPPRASINGEDNGSIESSEPTRRGRKKGPTSSSSSSATSPLKKTKRLKKAQVENGTVET-  263

Query  302  ATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEF  481
                  A+P  +T++   E E Y             DDG+DFPY+ PPL+CCFGAAQKEF
Sbjct  264  ------AKPTIQTENPDSELEDY-------------DDGIDFPYDDPPLVCCFGAAQKEF  304

Query  482  V  484
            V
Sbjct  305  V  305



>ref|XP_004246362.1| PREDICTED: fructokinase-like 1, chloroplastic [Solanum lycopersicum]
Length=478

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 26/125 (21%)
 Frame = +2

Query  113  STFLPKHRYVCHPNPPKSSSADDHTTTQQPSKTSRRALKKTS-PSSKPRGRPKKEPQSET  289
            + F    ++    NPPKS++ D  TTTQ+P   SRR  KK+S P++  + R  K+   + 
Sbjct  23   TIFFSSSKFPYRTNPPKSTTNDHPTTTQEPPTPSRRGRKKSSTPTTSKKSRTPKDSNFDI  82

Query  290  IESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAA  469
              ++A          E+ +  EE + Y +             GVDFPY +PPL+CCFGAA
Sbjct  83   --NIA----------ESNTQMEEIDDYDD-------------GVDFPYPNPPLVCCFGAA  117

Query  470  QKEFV  484
            QKEFV
Sbjct  118  QKEFV  122



>ref|XP_007205056.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
 gb|EMJ06255.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
Length=510

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 16/114 (14%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGR---PKKEPQSETIESVATKRSRA  322
            NPP++S   +   + + S+ +RR  KK   SS        PK+  +SE  +        A
Sbjct  54   NPPRASINGEDNGSIESSEPTRRGRKKGHTSSSSSSATSPPKQTKRSEKAQVENGTVETA  113

Query  323  RPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            +P  +T++   E E Y +             G+DFPY+ PPL+CCFGAAQKEFV
Sbjct  114  KPTIQTENPDSELEDYDD-------------GIDFPYDDPPLVCCFGAAQKEFV  154



>ref|XP_011077603.1| PREDICTED: fructokinase-like 1, chloroplastic [Sesamum indicum]
Length=490

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 28/119 (24%)
 Frame = +2

Query  143  CHPNPP-KSSSADDHTTTQQPSKTSRRALKKTSPSSKPR--GRPKK--EPQSETIESVAT  307
            CH  PP + S+ DD  +T  P +  R+    +SP+S P+   RP K  EP +   E+V  
Sbjct  39   CHKLPPPRCSTTDDAPSTTTPRRRGRKK-STSSPTSAPKRSKRPTKRAEPSNSQNEAVIF  97

Query  308  KRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            K S      +   +  +F+  +E                FPYE PPL+CCFGA QKEF+
Sbjct  98   KES------DHVEELFDFDDGIE----------------FPYEDPPLVCCFGAVQKEFL  134



>gb|KDP24506.1| hypothetical protein JCGZ_25070 [Jatropha curcas]
Length=504

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 27/120 (23%)
 Frame = +2

Query  155  PPKSSSADDHTTTQ-QPSKTSRRA---------LKKTSPSSKPRGRPKKEPQSETIESVA  304
            PP++S   D T    + SK SRR              +P+S  + +  K+ ++E++ ++ 
Sbjct  46   PPQASINGDSTNGAIESSKPSRRGRKKKSTSPSSSAVAPTSAKKTKRSKKIEAESV-NIH  104

Query  305  TKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
            T   +     E   + E+++  ++                FPY+ PPLICCFGAAQKEFV
Sbjct  105  TNSGKQTSVVELDEEIEDYDDGID----------------FPYDYPPLICCFGAAQKEFV  148



>ref|XP_010427076.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 37/77 (48%), Gaps = 16/77 (21%)
 Frame = +2

Query  254  RGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPY  433
            +GR KK+  S  IE   T+        E   + E+++  +E                +PY
Sbjct  59   KGRKKKQQTSTVIEKDDTENITIETDAELNPELEDYDDGIE----------------YPY  102

Query  434  ESPPLICCFGAAQKEFV  484
            + PPL+CCFGA QKEFV
Sbjct  103  DDPPLVCCFGAVQKEFV  119



>ref|XP_004302649.2| PREDICTED: LOW QUALITY PROTEIN: fructokinase-like 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=647

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 56/109 (51%), Gaps = 21/109 (19%)
 Frame = +2

Query  158  PKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKE  337
            P  +S +D+ + ++P + +RR  KK+S S+     P K+ Q       A K        E
Sbjct  204  PLRASGEDNGSIEEPKQPARRGRKKSSTSASSS--PPKKTQR------AKKAQVENGPVE  255

Query  338  TQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
             +SD  E E Y +             G+DFPY+ PPL+CCFGAAQKEFV
Sbjct  256  PESDDSELEDYDD-------------GIDFPYDDPPLVCCFGAAQKEFV  291



>ref|XP_010515923.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 39/78 (50%), Gaps = 17/78 (22%)
 Frame = +2

Query  254  RGRPKKEPQSETIESVATKRSRA-RPRKETQSDTEEFESYVEPPvnadevddyddgvdFP  430
            +GR KK+  S  IE   T+ + A     E   + E+++  +E                FP
Sbjct  58   KGRKKKQQTSTVIEKDDTEENGAIETDAELNPELEDYDDGIE----------------FP  101

Query  431  YESPPLICCFGAAQKEFV  484
            Y+ PPL+CCFGA QKEFV
Sbjct  102  YDDPPLVCCFGAVQKEFV  119



>gb|ADI87418.1| fructokinase-like protein 1 [Lactuca sativa]
Length=469

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 52/113 (46%), Gaps = 33/113 (29%)
 Frame = +2

Query  158  PKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARP---  328
            P++S   DHT +             T+P    RGR K    + T  + ++ R +      
Sbjct  28   PRASINGDHTVS-------------TAPQPARRGRKKSTSTTTTTPTKSSSRMKKSESEV  74

Query  329  -RKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
             R E + D ++F++ ++                FPYE PPLICCFGAAQK+FV
Sbjct  75   NRIEKEEDLQDFDNGID----------------FPYEDPPLICCFGAAQKQFV  111



>ref|XP_009421323.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 12/87 (14%)
 Frame = +2

Query  254  RGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFES----------YVEPPvnadevd  403
            RGR KK   S     V  KR+R R +K+T  D    E            V  PV  +E +
Sbjct  82   RGRKKKSADSSPATPV--KRTRRRSQKKTPEDEAAAEGPRMPEEAKAPTVAAPVEEEEEE  139

Query  404  dyddgvdFPYESPPLICCFGAAQKEFV  484
            D+DDG+DFPYESPPL+CCFGAA++EFV
Sbjct  140  DFDDGMDFPYESPPLVCCFGAARREFV  166



>ref|XP_007026821.1| Fructokinase-like 1 [Theobroma cacao]
 gb|EOY07323.1| Fructokinase-like 1 [Theobroma cacao]
Length=647

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/20 (95%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +2

Query  425  FPYESPPLICCFGAAQKEFV  484
            FPYE PPLICCFGAAQKEFV
Sbjct  271  FPYEEPPLICCFGAAQKEFV  290



>ref|XP_011009152.1| PREDICTED: fructokinase-like 1, chloroplastic [Populus euphratica]
Length=485

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 57/116 (49%), Gaps = 31/116 (27%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGRPKKEPQSETI----ESVATKRSR  319
            NPPK+S+ +       PS+               RGR KK   + T     +  ATKRS+
Sbjct  39   NPPKASATNGAVDAPPPSR---------------RGRKKKPATTPTTDTATKGTATKRSK  83

Query  320  -ARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
                   + SDTE  +            +DYDDG+DFPYE PPL+CCFGA QKEFV
Sbjct  84   KTEAENGSVSDTELLDG-----------EDYDDGIDFPYEYPPLVCCFGAVQKEFV  128



>ref|XP_010256724.1| PREDICTED: fructokinase-like 1, chloroplastic [Nelumbo nucifera]
Length=541

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/20 (95%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +2

Query  425  FPYESPPLICCFGAAQKEFV  484
            FPYE PPLICCFGAAQKEFV
Sbjct  166  FPYEYPPLICCFGAAQKEFV  185



>ref|XP_004156589.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-2-like [Cucumis 
sativus]
Length=511

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 10/111 (9%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPR  331
            NPP++S+ D+     +    +RR  KK + S       +K+ +      +  + + A P 
Sbjct  55   NPPRASANDEGNGVVETPGPTRRGRKKGTASPSSSTSAQKKTKRSKEPQITDRITVANPF  114

Query  332  KETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
                 D E  +S  +         +YDDG+D PYE PPLICCFGAAQKEFV
Sbjct  115  VHISED-ESIDSIAD---------NYDDGMDIPYEDPPLICCFGAAQKEFV  155



>ref|XP_004137741.1| PREDICTED: fructokinase-2-like [Cucumis sativus]
 gb|KGN58805.1| hypothetical protein Csa_3G732620 [Cucumis sativus]
Length=511

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 10/111 (9%)
 Frame = +2

Query  152  NPPKSSSADDHTTTQQPSKTSRRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPR  331
            NPP++S+ D+     +    +RR  KK + S       +K+ +      +  + + A P 
Sbjct  55   NPPRASANDEGNGVVETPGPTRRGRKKGTASPSSSTSAQKKTKRSKEPQITDRITVANPF  114

Query  332  KETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
                 D E  +S  +         +YDDG+D PYE PPLICCFGAAQKEFV
Sbjct  115  VHISED-ESIDSIAD---------NYDDGMDIPYEDPPLICCFGAAQKEFV  155



>gb|EYU26634.1| hypothetical protein MIMGU_mgv1a005440mg [Erythranthe guttata]
Length=483

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +2

Query  425  FPYESPPLICCFGAAQKEFV  484
            FPYE PPL+CCFGAAQKEFV
Sbjct  108  FPYEDPPLVCCFGAAQKEFV  127



>ref|XP_010504200.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=471

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 8/101 (8%)
 Frame = +2

Query  203  SKTSRRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQS-------DTEEF  361
            S   RR +     S KPR +    P++      A K SR   +K+ Q+       DTEE 
Sbjct  16   SSLGRREILVARNSPKPR-QFLLSPRASINGETAVKPSRKGRKKKQQTSTVIEKDDTEEN  74

Query  362  ESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  484
             +    P    E++DYDDG++FPY+ PPL+CCFGA QKEFV
Sbjct  75   GTIETEPELNPELEDYDDGIEFPYDDPPLVCCFGAVQKEFV  115



>ref|XP_010928949.1| PREDICTED: fructokinase-like 1, chloroplastic [Elaeis guineensis]
Length=519

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +2

Query  425  FPYESPPLICCFGAAQKEFV  484
            FPY+SPPLICCFGAAQ+EFV
Sbjct  140  FPYQSPPLICCFGAAQREFV  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550