BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF014A22

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802424.1|  PREDICTED: ABC transporter G family member 1...    147   3e-38   Nicotiana sylvestris
ref|XP_011071699.1|  PREDICTED: ABC transporter G family member 1...    146   6e-38   Sesamum indicum [beniseed]
ref|XP_010324495.1|  PREDICTED: ABC transporter G family member 1...    145   2e-37   Solanum lycopersicum
ref|XP_009631041.1|  PREDICTED: ABC transporter G family member 1...    142   1e-36   Nicotiana tomentosiformis
ref|XP_006361228.1|  PREDICTED: ABC transporter G family member 1...    142   2e-36   Solanum tuberosum [potatoes]
ref|XP_006361227.1|  PREDICTED: ABC transporter G family member 1...    142   2e-36   Solanum tuberosum [potatoes]
emb|CDP07185.1|  unnamed protein product                                138   5e-35   Coffea canephora [robusta coffee]
ref|XP_002270533.2|  PREDICTED: ABC transporter G family member 14      136   3e-34   Vitis vinifera
ref|XP_004246010.1|  PREDICTED: ABC transporter G family member 14      134   1e-33   
ref|XP_011082193.1|  PREDICTED: ABC transporter G family member 1...    132   9e-33   Sesamum indicum [beniseed]
ref|XP_006359961.1|  PREDICTED: ABC transporter G family member 1...    131   2e-32   Solanum tuberosum [potatoes]
ref|XP_006385164.1|  ABC transporter family protein                     130   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002519942.1|  ATP-binding cassette transporter, putative         130   4e-32   Ricinus communis
ref|XP_011028515.1|  PREDICTED: ABC transporter G family member 1...    129   2e-31   Populus euphratica
gb|KDP37810.1|  hypothetical protein JCGZ_06712                         128   3e-31   Jatropha curcas
ref|XP_003548769.1|  PREDICTED: ABC transporter G family member 1...    126   1e-30   Glycine max [soybeans]
ref|XP_010540713.1|  PREDICTED: ABC transporter G family member 14      125   2e-30   Tarenaya hassleriana [spider flower]
emb|CAN70956.1|  hypothetical protein VITISV_028138                     124   7e-30   Vitis vinifera
ref|XP_010275138.1|  PREDICTED: ABC transporter G family member 14      124   8e-30   Nelumbo nucifera [Indian lotus]
ref|XP_011013139.1|  PREDICTED: ABC transporter G family member 1...    124   9e-30   Populus euphratica
ref|XP_007158067.1|  hypothetical protein PHAVU_002G121200g             123   2e-29   Phaseolus vulgaris [French bean]
ref|XP_002304113.2|  hypothetical protein POPTR_0003s03650g             123   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_007040852.1|  ATP-binding cassette 14                            122   3e-29   Theobroma cacao [chocolate]
ref|XP_003537708.1|  PREDICTED: ABC transporter G family member 1...    122   3e-29   Glycine max [soybeans]
gb|KHN28317.1|  ABC transporter G family member 14                      121   1e-28   Glycine soja [wild soybean]
ref|XP_003517105.2|  PREDICTED: ABC transporter G family member 1...    121   1e-28   Glycine max [soybeans]
ref|XP_007156346.1|  hypothetical protein PHAVU_003G278800g             121   1e-28   Phaseolus vulgaris [French bean]
ref|XP_004512314.1|  PREDICTED: ABC transporter G family member 1...    119   6e-28   Cicer arietinum [garbanzo]
ref|XP_003547739.1|  PREDICTED: ABC transporter G family member 1...    118   1e-27   Glycine max [soybeans]
gb|KJB25133.1|  hypothetical protein B456_004G178100                    117   2e-27   Gossypium raimondii
gb|KJB25132.1|  hypothetical protein B456_004G178100                    117   2e-27   Gossypium raimondii
ref|XP_008387860.1|  PREDICTED: ABC transporter G family member 14      116   5e-27   Malus domestica [apple tree]
ref|XP_010251517.1|  PREDICTED: ABC transporter G family member 1...    116   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010111780.1|  ABC transporter G family member 14                 115   8e-27   Morus notabilis
ref|XP_010463057.1|  PREDICTED: ABC transporter G family member 1...    114   1e-26   
gb|KHG16348.1|  ABC transporter G family member 14                      115   1e-26   Gossypium arboreum [tree cotton]
gb|KHG20314.1|  ABC transporter G family member 14                      114   2e-26   Gossypium arboreum [tree cotton]
ref|XP_010478591.1|  PREDICTED: ABC transporter G family member 14      114   4e-26   Camelina sativa [gold-of-pleasure]
gb|KJB51502.1|  hypothetical protein B456_008G219500                    114   4e-26   Gossypium raimondii
ref|XP_010499718.1|  PREDICTED: ABC transporter G family member 1...    114   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009114967.1|  PREDICTED: ABC transporter G family member 14      112   1e-25   Brassica rapa
emb|CDY12299.1|  BnaA09g24990D                                          112   1e-25   Brassica napus [oilseed rape]
ref|XP_009605917.1|  PREDICTED: ABC transporter G family member 1...    110   4e-25   Nicotiana tomentosiformis
ref|XP_010518955.1|  PREDICTED: ABC transporter G family member 14      110   7e-25   Tarenaya hassleriana [spider flower]
ref|XP_008347334.1|  PREDICTED: ABC transporter G family member 1...    110   9e-25   
ref|XP_008347335.1|  PREDICTED: ABC transporter G family member 1...    110   9e-25   
ref|XP_006303926.1|  hypothetical protein CARUB_v10008545mg             110   1e-24   Capsella rubella
ref|XP_006415305.1|  hypothetical protein EUTSA_v10007027mg             108   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_009757349.1|  PREDICTED: ABC transporter G family member 1...    108   3e-24   Nicotiana sylvestris
ref|XP_008221126.1|  PREDICTED: ABC transporter G family member 14      108   4e-24   Prunus mume [ume]
ref|NP_564383.1|  ABC transporter G family member 14                    107   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226971.1|  hypothetical protein PRUPE_ppa002442mg             107   1e-23   
emb|CDY47690.1|  BnaCnng15320D                                          106   2e-23   Brassica napus [oilseed rape]
ref|XP_009145231.1|  PREDICTED: ABC transporter G family member 1...    106   2e-23   Brassica rapa
ref|XP_004291249.1|  PREDICTED: ABC transporter G family member 14      106   2e-23   Fragaria vesca subsp. vesca
ref|XP_010054006.1|  PREDICTED: ABC transporter G family member 14      105   6e-23   Eucalyptus grandis [rose gum]
gb|EYU29117.1|  hypothetical protein MIMGU_mgv1a002688mg                104   6e-23   Erythranthe guttata [common monkey flower]
gb|ABB97034.1|  ABC transporter-like protein                            101   4e-22   Brassica rapa
ref|XP_002893685.1|  abc transporter family protein                     102   7e-22   
gb|KFK44944.1|  hypothetical protein AALP_AA1G323000                    101   1e-21   Arabis alpina [alpine rockcress]
gb|AAG50724.1|AC079041_17  ABC transporter, putative                  98.2    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324496.1|  PREDICTED: ABC transporter G family member 1...  97.8    2e-20   Solanum lycopersicum
ref|XP_006430907.1|  hypothetical protein CICLE_v10011273mg           96.7    5e-20   Citrus clementina [clementine]
ref|XP_003612480.1|  ABC transporter-like protein                     95.5    1e-19   
gb|KDO72270.1|  hypothetical protein CISIN_1g039221mg                 94.7    2e-19   Citrus sinensis [apfelsine]
ref|XP_006482405.1|  PREDICTED: ABC transporter G family member 1...  94.7    2e-19   Citrus sinensis [apfelsine]
gb|AES95438.2|  white-brown-complex ABC transporter family protein    94.0    4e-19   Medicago truncatula
ref|XP_009397435.1|  PREDICTED: ABC transporter G family member 14    90.9    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003520157.2|  PREDICTED: ABC transporter G family member 2...  90.5    8e-18   
ref|XP_009384518.1|  PREDICTED: ABC transporter G family member 1...  90.1    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006573283.1|  PREDICTED: ABC transporter G family member 2...  90.1    1e-17   Glycine max [soybeans]
ref|XP_010676724.1|  PREDICTED: ABC transporter G family member 14    89.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010066762.1|  PREDICTED: ABC transporter G family member 21    88.6    4e-17   Eucalyptus grandis [rose gum]
gb|KDP27020.1|  hypothetical protein JCGZ_20955                       85.9    2e-16   Jatropha curcas
gb|EPS63929.1|  hypothetical protein M569_10851                       85.9    2e-16   Genlisea aurea
ref|XP_007153314.1|  hypothetical protein PHAVU_003G024700g           85.5    4e-16   Phaseolus vulgaris [French bean]
ref|XP_002524381.1|  ATP-binding cassette transporter, putative       85.5    4e-16   
ref|XP_010265331.1|  PREDICTED: ABC transporter G family member 2...  85.1    6e-16   Nelumbo nucifera [Indian lotus]
gb|KEH19433.1|  white-brown-complex ABC transporter family protein    84.7    7e-16   Medicago truncatula
ref|XP_004297158.1|  PREDICTED: ABC transporter G family member 21    84.3    9e-16   Fragaria vesca subsp. vesca
ref|XP_010918656.1|  PREDICTED: ABC transporter G family member 1...  84.0    1e-15   
emb|CDP05875.1|  unnamed protein product                              84.0    1e-15   Coffea canephora [robusta coffee]
ref|XP_010910172.1|  PREDICTED: ABC transporter G family member 1...  84.0    1e-15   
ref|XP_011098341.1|  PREDICTED: ABC transporter G family member 9     83.6    2e-15   Sesamum indicum [beniseed]
ref|XP_004244204.1|  PREDICTED: ABC transporter G family member 9     83.2    2e-15   Solanum lycopersicum
ref|XP_010910173.1|  PREDICTED: ABC transporter G family member 1...  83.6    2e-15   
gb|KDP27016.1|  hypothetical protein JCGZ_20951                       83.2    3e-15   Jatropha curcas
ref|XP_008237669.1|  PREDICTED: ABC transporter G family member 9...  82.4    5e-15   Prunus mume [ume]
ref|XP_007199008.1|  hypothetical protein PRUPE_ppa017466mg           82.0    5e-15   
ref|XP_006286036.1|  hypothetical protein CARUB_v10007565mg           82.0    5e-15   Capsella rubella
ref|XP_002533914.1|  ATP-binding cassette transporter, putative       82.0    5e-15   Ricinus communis
ref|XP_008389336.1|  PREDICTED: ABC transporter G family member 2...  82.0    6e-15   
ref|XP_010918655.1|  PREDICTED: ABC transporter G family member 1...  82.0    7e-15   Elaeis guineensis
ref|XP_006413078.1|  hypothetical protein EUTSA_v10024656mg           82.0    7e-15   Eutrema salsugineum [saltwater cress]
ref|XP_008226675.1|  PREDICTED: ABC transporter G family member 9     81.6    7e-15   Prunus mume [ume]
ref|XP_007225163.1|  hypothetical protein PRUPE_ppa002351mg           81.6    7e-15   
ref|XP_010943389.1|  PREDICTED: ABC transporter G family member 1...  81.6    8e-15   Elaeis guineensis
ref|XP_008451875.1|  PREDICTED: ABC transporter G family member 14    81.6    8e-15   Cucumis melo [Oriental melon]
ref|XP_009395262.1|  PREDICTED: ABC transporter G family member 9...  81.6    9e-15   
ref|XP_010502440.1|  PREDICTED: ABC transporter G family member 2...  80.9    9e-15   
ref|XP_008243143.1|  PREDICTED: ABC transporter G family member 21    81.6    9e-15   Prunus mume [ume]
ref|XP_010425210.1|  PREDICTED: ABC transporter G family member 2...  80.9    1e-14   
ref|XP_004293103.1|  PREDICTED: ABC transporter G family member 9     81.3    1e-14   Fragaria vesca subsp. vesca
ref|XP_008339724.1|  PREDICTED: ABC transporter G family member 2...  81.3    1e-14   
ref|XP_008361741.1|  PREDICTED: ABC transporter G family member 2...  81.3    1e-14   
emb|CAN77762.1|  hypothetical protein VITISV_026760                   79.0    1e-14   Vitis vinifera
gb|AIU41651.1|  ABC transporter family protein                        81.3    1e-14   Hevea brasiliensis [jebe]
ref|XP_004147769.1|  PREDICTED: ABC transporter G family member 1...  80.9    1e-14   Cucumis sativus [cucumbers]
ref|XP_009768130.1|  PREDICTED: ABC transporter G family member 2...  80.9    1e-14   Nicotiana sylvestris
ref|XP_009792869.1|  PREDICTED: ABC transporter G family member 9...  80.9    1e-14   Nicotiana sylvestris
ref|XP_007214012.1|  hypothetical protein PRUPE_ppa014861mg           80.5    2e-14   Prunus persica
ref|XP_009336649.1|  PREDICTED: ABC transporter G family member 2...  80.5    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_009356025.1|  PREDICTED: ABC transporter G family member 2...  80.5    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_010648137.1|  PREDICTED: ABC transporter G family member 21    80.5    2e-14   Vitis vinifera
ref|XP_010943390.1|  PREDICTED: ABC transporter G family member 1...  80.5    2e-14   Elaeis guineensis
ref|XP_010668407.1|  PREDICTED: ABC transporter G family member 2...  78.6    2e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008389338.1|  PREDICTED: ABC transporter G family member 2...  79.7    2e-14   
emb|CAB43874.1|  putative protei                                      80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389337.1|  PREDICTED: ABC transporter G family member 2...  79.7    3e-14   
ref|NP_194472.3|  ABC transporter G family member 9                   80.1    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502439.1|  PREDICTED: ABC transporter G family member 2...  79.7    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009766511.1|  PREDICTED: ABC transporter G family member 9...  79.7    3e-14   Nicotiana sylvestris
ref|XP_010514180.1|  PREDICTED: ABC transporter G family member 2...  79.7    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010425209.1|  PREDICTED: ABC transporter G family member 2...  79.7    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009586692.1|  PREDICTED: ABC transporter G family member 2...  79.7    4e-14   Nicotiana tomentosiformis
ref|XP_006395639.1|  hypothetical protein EUTSA_v10003766mg           79.3    4e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010262410.1|  PREDICTED: ABC transporter G family member 2...  79.3    5e-14   Nelumbo nucifera [Indian lotus]
ref|XP_011077437.1|  PREDICTED: ABC transporter G family member 21    79.3    5e-14   Sesamum indicum [beniseed]
ref|XP_010556399.1|  PREDICTED: ABC transporter G family member 2...  79.3    5e-14   Tarenaya hassleriana [spider flower]
ref|XP_009129040.1|  PREDICTED: ABC transporter G family member 2...  79.3    5e-14   Brassica rapa
ref|XP_009607601.1|  PREDICTED: ABC transporter G family member 9...  79.3    6e-14   Nicotiana tomentosiformis
emb|CDY46506.1|  BnaA02g27560D                                        79.3    6e-14   Brassica napus [oilseed rape]
ref|XP_009139468.1|  PREDICTED: ABC transporter G family member 27    79.3    6e-14   Brassica rapa
gb|KDO70136.1|  hypothetical protein CISIN_1g005545mg                 79.0    6e-14   Citrus sinensis [apfelsine]
ref|XP_008805673.1|  PREDICTED: ABC transporter G family member 1...  79.0    6e-14   Phoenix dactylifera
ref|XP_006484387.1|  PREDICTED: ABC transporter G family member 2...  79.0    6e-14   Citrus sinensis [apfelsine]
ref|XP_004972751.1|  PREDICTED: ABC transporter G family member 1...  79.3    6e-14   Setaria italica
ref|XP_002876921.1|  hypothetical protein ARALYDRAFT_904727           79.0    7e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_003591854.1|  ABC transporter G family member                  79.0    7e-14   
ref|XP_006878615.1|  hypothetical protein AMTR_s00011p00258490        79.0    7e-14   Amborella trichopoda
ref|XP_007046353.1|  ABC-2 type transporter family protein            79.0    7e-14   
emb|CBI18157.3|  unnamed protein product                              79.0    7e-14   Vitis vinifera
emb|CDP00551.1|  unnamed protein product                              79.0    8e-14   Coffea canephora [robusta coffee]
ref|XP_002268373.1|  PREDICTED: ABC transporter G family member 25    79.0    8e-14   Vitis vinifera
emb|CDX92829.1|  BnaC07g40870D                                        78.6    8e-14   
ref|XP_004164431.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  78.6    8e-14   
ref|XP_009593646.1|  PREDICTED: ABC transporter G family member 21    78.6    8e-14   Nicotiana tomentosiformis
emb|CDX99764.1|  BnaC02g35560D                                        78.6    8e-14   
ref|XP_009605775.1|  PREDICTED: ABC transporter G family member 9     78.6    9e-14   Nicotiana tomentosiformis
gb|KDP29341.1|  hypothetical protein JCGZ_18262                       78.6    9e-14   Jatropha curcas
ref|XP_008457190.1|  PREDICTED: ABC transporter G family member 21    78.6    1e-13   Cucumis melo [Oriental melon]
gb|KCW50637.1|  hypothetical protein EUGRSUZ_J00337                   78.2    1e-13   Eucalyptus grandis [rose gum]
ref|XP_009378509.1|  PREDICTED: ABC transporter G family member 9     78.2    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_010034170.1|  PREDICTED: ABC transporter G family member 9     78.2    1e-13   Eucalyptus grandis [rose gum]
emb|CAN62390.1|  hypothetical protein VITISV_039480                   78.2    1e-13   Vitis vinifera
ref|XP_010675645.1|  PREDICTED: ABC transporter G family member 9     77.8    2e-13   
gb|EMT29518.1|  hypothetical protein F775_52365                       77.4    2e-13   
gb|KFK39853.1|  hypothetical protein AALP_AA3G297000                  77.8    2e-13   Arabis alpina [alpine rockcress]
ref|XP_008797958.1|  PREDICTED: ABC transporter G family member 1...  77.4    2e-13   Phoenix dactylifera
ref|XP_010921129.1|  PREDICTED: ABC transporter G family member 9     77.4    2e-13   Elaeis guineensis
emb|CDY23205.1|  BnaA04g05540D                                        77.4    2e-13   Brassica napus [oilseed rape]
emb|CDP08055.1|  unnamed protein product                              77.4    2e-13   Coffea canephora [robusta coffee]
gb|KFK29257.1|  hypothetical protein AALP_AA7G109600                  77.0    3e-13   Arabis alpina [alpine rockcress]
ref|XP_006437762.1|  hypothetical protein CICLE_v10030868mg           77.0    3e-13   Citrus clementina [clementine]
ref|XP_006451938.1|  hypothetical protein CICLE_v10007744mg           77.0    3e-13   Citrus clementina [clementine]
ref|XP_006464709.1|  PREDICTED: ABC transporter G family member 9...  77.0    3e-13   
ref|XP_008799253.1|  PREDICTED: ABC transporter G family member 9...  77.0    3e-13   Phoenix dactylifera
emb|CDY29304.1|  BnaC01g19560D                                        77.0    3e-13   Brassica napus [oilseed rape]
ref|XP_009383080.1|  PREDICTED: ABC transporter G family member 9     77.0    3e-13   
dbj|BAC99536.1|  putative ABC transporter AbcG1                       77.0    3e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ41641.1|  hypothetical protein OsJ_26175                        77.0    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010324497.1|  PREDICTED: ABC transporter G family member 1...  76.6    3e-13   
gb|KDO74147.1|  hypothetical protein CISIN_1g010509mg                 76.3    4e-13   Citrus sinensis [apfelsine]
ref|XP_008775311.1|  PREDICTED: ABC transporter G family member 9...  76.6    4e-13   
emb|CDX95330.1|  BnaC04g28280D                                        76.6    4e-13   
gb|EEC82957.1|  hypothetical protein OsI_27950                        76.6    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004139018.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  76.6    5e-13   
ref|XP_009143407.1|  PREDICTED: ABC transporter G family member 9     76.3    5e-13   Brassica rapa
gb|KGN61520.1|  hypothetical protein Csa_2G153580                     76.3    5e-13   Cucumis sativus [cucumbers]
ref|XP_004170842.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  76.3    5e-13   
gb|EYU28941.1|  hypothetical protein MIMGU_mgv1a002356mg              76.3    6e-13   Erythranthe guttata [common monkey flower]
gb|KHN37813.1|  ABC transporter G family member 21                    76.3    7e-13   Glycine soja [wild soybean]
ref|XP_006589394.1|  PREDICTED: ABC transporter G family member 2...  75.9    7e-13   Glycine max [soybeans]
ref|XP_002314895.1|  hypothetical protein POPTR_0010s14180g           75.9    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011008785.1|  PREDICTED: ABC transporter G family member 21    75.9    8e-13   Populus euphratica
ref|XP_004252105.1|  PREDICTED: ABC transporter G family member 9...  75.5    9e-13   Solanum lycopersicum
gb|KJB13426.1|  hypothetical protein B456_002G073600                  75.5    9e-13   Gossypium raimondii
ref|XP_009152126.1|  PREDICTED: ABC transporter G family member 21    75.5    9e-13   Brassica rapa
ref|XP_010433373.1|  PREDICTED: ABC transporter G family member 9...  75.5    9e-13   Camelina sativa [gold-of-pleasure]
gb|KHN07718.1|  ABC transporter G family member 21                    75.5    1e-12   Glycine soja [wild soybean]
emb|CDY51602.1|  BnaCnng21050D                                        75.5    1e-12   Brassica napus [oilseed rape]
ref|XP_010438619.1|  PREDICTED: ABC transporter G family member 9...  75.5    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010448138.1|  PREDICTED: ABC transporter G family member 9     75.5    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006359003.1|  PREDICTED: ABC transporter G family member 9...  75.5    1e-12   Solanum tuberosum [potatoes]
ref|XP_006376281.1|  hypothetical protein POPTR_0013s11630g           72.8    1e-12   
ref|XP_008386302.1|  PREDICTED: ABC transporter G family member 9...  75.1    1e-12   
gb|KJB50814.1|  hypothetical protein B456_008G188000                  75.1    1e-12   Gossypium raimondii
ref|XP_009137658.1|  PREDICTED: ABC transporter G family member 9...  75.1    1e-12   Brassica rapa
emb|CDY29837.1|  BnaA03g48580D                                        75.1    1e-12   Brassica napus [oilseed rape]
ref|XP_008237152.1|  PREDICTED: ABC transporter G family member 25    75.1    1e-12   Prunus mume [ume]
ref|XP_006290691.1|  hypothetical protein CARUB_v10016784mg           75.1    1e-12   Capsella rubella
ref|XP_010535206.1|  PREDICTED: ABC transporter G family member 2...  75.1    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_010528033.1|  PREDICTED: ABC transporter G family member 2...  75.1    1e-12   Tarenaya hassleriana [spider flower]
ref|NP_189190.2|  ABC transporter G family member 21                  74.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855537.1|  hypothetical protein AMTR_s00057p00214480        74.3    2e-12   
ref|NP_001189973.1|  ABC transporter G family member 21               74.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KHN00888.1|  ABC transporter G family member 21                    74.3    2e-12   Glycine soja [wild soybean]
ref|XP_002281949.1|  PREDICTED: ABC transporter G family member 9     74.3    2e-12   Vitis vinifera
ref|XP_003556255.1|  PREDICTED: ABC transporter G family member 2...  74.3    2e-12   Glycine max [soybeans]
emb|CAN62144.1|  hypothetical protein VITISV_007841                   74.3    3e-12   Vitis vinifera
emb|CDY48079.1|  BnaA06g33490D                                        74.3    3e-12   Brassica napus [oilseed rape]
ref|XP_010520902.1|  PREDICTED: ABC transporter G family member 9...  73.9    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_004496215.1|  PREDICTED: ABC transporter G family member 2...  73.9    4e-12   Cicer arietinum [garbanzo]
ref|XP_011095242.1|  PREDICTED: ABC transporter G family member 9...  73.6    4e-12   
ref|XP_011095241.1|  PREDICTED: ABC transporter G family member 9...  73.9    4e-12   Sesamum indicum [beniseed]
emb|CBI20349.3|  unnamed protein product                              73.6    4e-12   Vitis vinifera
ref|XP_007149612.1|  hypothetical protein PHAVU_005G084300g           73.6    4e-12   Phaseolus vulgaris [French bean]
dbj|BAJ95904.1|  predicted protein                                    73.6    5e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97566.1|  predicted protein                                    73.6    5e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325552.2|  ABC transporter family protein                   73.6    5e-12   Populus trichocarpa [western balsam poplar]
gb|KEH38788.1|  white-brown-complex ABC transporter family protein    73.2    5e-12   Medicago truncatula
ref|XP_003526081.1|  PREDICTED: ABC transporter G family member 9...  73.2    6e-12   Glycine max [soybeans]
ref|XP_004487681.1|  PREDICTED: ABC transporter G family member 9...  73.2    6e-12   Cicer arietinum [garbanzo]
ref|XP_010521140.1|  PREDICTED: ABC transporter G family member 2...  72.8    8e-12   Tarenaya hassleriana [spider flower]
ref|XP_003541854.2|  PREDICTED: ABC transporter G family member 9...  72.4    1e-11   Glycine max [soybeans]
ref|XP_007143780.1|  hypothetical protein PHAVU_007G100900g           72.4    1e-11   Phaseolus vulgaris [French bean]
ref|XP_009793168.1|  PREDICTED: ABC transporter G family member 2...  72.4    1e-11   Nicotiana sylvestris
ref|XP_008382026.1|  PREDICTED: ABC transporter G family member 2...  72.4    1e-11   
ref|XP_011005152.1|  PREDICTED: ABC transporter G family member 2...  72.4    1e-11   Populus euphratica
ref|XP_006493205.1|  PREDICTED: ABC transporter G family member 9...  72.0    1e-11   Citrus sinensis [apfelsine]
ref|XP_009345933.1|  PREDICTED: ABC transporter G family member 2...  72.0    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_009796796.1|  PREDICTED: ABC transporter G family member 2...  71.6    2e-11   Nicotiana sylvestris
ref|XP_010912511.1|  PREDICTED: ABC transporter G family member 2...  71.6    2e-11   Elaeis guineensis
ref|XP_010557969.1|  PREDICTED: ABC transporter G family member 2...  71.6    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_010930786.1|  PREDICTED: ABC transporter G family member 25    71.6    2e-11   Elaeis guineensis
ref|XP_004236984.1|  PREDICTED: ABC transporter G family member 21    71.2    2e-11   Solanum lycopersicum
ref|XP_011094211.1|  PREDICTED: ABC transporter G family member 2...  71.2    3e-11   
ref|XP_004252106.1|  PREDICTED: ABC transporter G family member 9...  71.6    3e-11   
gb|KDO70711.1|  hypothetical protein CISIN_1g0045372mg                70.5    3e-11   Citrus sinensis [apfelsine]
ref|XP_006430002.1|  hypothetical protein CICLE_v10011143mg           71.2    3e-11   
ref|XP_006830203.1|  hypothetical protein AMTR_s01016p00008750        68.6    3e-11   
gb|KDO70708.1|  hypothetical protein CISIN_1g0045372mg                70.9    3e-11   Citrus sinensis [apfelsine]
ref|XP_006351917.1|  PREDICTED: ABC transporter G family member 2...  70.9    3e-11   
gb|KDO70709.1|  hypothetical protein CISIN_1g0045372mg                70.5    3e-11   Citrus sinensis [apfelsine]
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G family m...  70.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006481645.1|  PREDICTED: ABC transporter G family member 2...  70.9    4e-11   Citrus sinensis [apfelsine]
ref|XP_011001789.1|  PREDICTED: ABC transporter G family member 2...  70.9    4e-11   Populus euphratica
ref|XP_006430003.1|  hypothetical protein CICLE_v10011143mg           70.9    4e-11   Citrus clementina [clementine]
ref|XP_010515694.1|  PREDICTED: ABC transporter G family member 27    70.9    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010096709.1|  ABC transporter G family member 14               70.9    4e-11   
gb|KDO70707.1|  hypothetical protein CISIN_1g0045372mg                70.5    4e-11   Citrus sinensis [apfelsine]
gb|KDO70704.1|  hypothetical protein CISIN_1g0045372mg                70.5    4e-11   Citrus sinensis [apfelsine]
ref|XP_004497624.1|  PREDICTED: ABC transporter G family member 2...  70.9    5e-11   Cicer arietinum [garbanzo]
ref|XP_010277245.1|  PREDICTED: ABC transporter G family member 9...  70.9    5e-11   Nelumbo nucifera [Indian lotus]
ref|NP_190799.2|  ABC transporter G family member 27                  70.5    6e-11   
ref|XP_006370303.1|  hypothetical protein POPTR_0001s41450g           70.1    6e-11   
ref|XP_006366061.1|  PREDICTED: ABC transporter G family member 2...  70.5    6e-11   Solanum tuberosum [potatoes]
ref|XP_002876135.1|  abc transporter family protein                   70.5    6e-11   
ref|XP_004228604.1|  PREDICTED: ABC transporter G family member 2...  70.5    6e-11   Solanum lycopersicum
ref|XP_006348422.1|  PREDICTED: ABC transporter G family member 2...  70.5    6e-11   Solanum tuberosum [potatoes]
ref|XP_009622617.1|  PREDICTED: ABC transporter G family member 2...  70.5    6e-11   Nicotiana tomentosiformis
gb|KDP43365.1|  hypothetical protein JCGZ_25470                       70.1    6e-11   Jatropha curcas
ref|XP_006447786.1|  hypothetical protein CICLE_v10017645mg           70.1    7e-11   
ref|XP_009796795.1|  PREDICTED: ABC transporter G family member 2...  70.1    7e-11   Nicotiana sylvestris
ref|XP_011029437.1|  PREDICTED: ABC transporter G family member 9...  69.7    7e-11   Populus euphratica
ref|XP_003573439.1|  PREDICTED: ABC transporter G family member 14    70.1    8e-11   Brachypodium distachyon [annual false brome]
ref|XP_002867504.1|  abc transporter family protein                   69.7    8e-11   
ref|XP_007143640.1|  hypothetical protein PHAVU_007G088800g           69.7    9e-11   Phaseolus vulgaris [French bean]
ref|XP_011094213.1|  PREDICTED: ABC transporter G family member 2...  69.7    9e-11   
gb|KHG30511.1|  ABC transporter G family member 22                    69.7    1e-10   Gossypium arboreum [tree cotton]
ref|XP_002263430.1|  PREDICTED: ABC transporter G family member 2...  69.7    1e-10   Vitis vinifera
emb|CBI35490.3|  unnamed protein product                              69.7    1e-10   Vitis vinifera
ref|XP_007133073.1|  hypothetical protein PHAVU_011G149300g           69.3    1e-10   Phaseolus vulgaris [French bean]
gb|KJB36225.1|  hypothetical protein B456_006G147000                  69.7    1e-10   Gossypium raimondii
gb|KDO83898.1|  hypothetical protein CISIN_1g0057542mg                68.2    1e-10   Citrus sinensis [apfelsine]
ref|XP_010036577.1|  PREDICTED: ABC transporter G family member 2...  69.7    1e-10   Eucalyptus grandis [rose gum]
gb|KJB14995.1|  hypothetical protein B456_002G153900                  69.3    1e-10   Gossypium raimondii
ref|XP_010256405.1|  PREDICTED: ABC transporter G family member 25    69.3    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_011042498.1|  PREDICTED: ABC transporter G family member 9...  69.3    1e-10   Populus euphratica
gb|KJB62742.1|  hypothetical protein B456_009G433300                  69.3    1e-10   
gb|AAK92745.1|  putative ABC transporter protein                      69.3    1e-10   
ref|NP_565030.1|  ABC transporter G family member 25                  69.3    1e-10   
ref|XP_010503972.1|  PREDICTED: ABC transporter G family member 2...  69.3    1e-10   
ref|XP_010426848.1|  PREDICTED: ABC transporter G family member 2...  69.3    1e-10   
ref|XP_009604112.1|  PREDICTED: ABC transporter G family member 25    68.9    1e-10   
ref|XP_007021331.1|  White-brown-complex ABC transporter family       68.9    1e-10   
gb|KJB35860.1|  hypothetical protein B456_006G130900                  67.8    1e-10   
gb|KHG09588.1|  ABC transporter G family member 25                    68.9    2e-10   
gb|KJB16510.1|  hypothetical protein B456_002G233500                  68.9    2e-10   
ref|XP_008452272.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  68.9    2e-10   
ref|XP_010519981.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  68.9    2e-10   
gb|KJB14994.1|  hypothetical protein B456_002G153900                  68.9    2e-10   
ref|XP_006359002.1|  PREDICTED: ABC transporter G family member 9...  68.6    2e-10   
ref|XP_011042541.1|  PREDICTED: ABC transporter G family member 2...  68.9    2e-10   
gb|KJB14993.1|  hypothetical protein B456_002G153900                  68.9    2e-10   
gb|KJB16511.1|  hypothetical protein B456_002G233500                  68.6    2e-10   
ref|XP_011042537.1|  PREDICTED: ABC transporter G family member 2...  68.6    2e-10   
ref|XP_002316916.1|  ABC transporter family protein                   68.6    2e-10   
ref|XP_003519092.1|  PREDICTED: ABC transporter G family member 2...  68.6    2e-10   
ref|XP_008791161.1|  PREDICTED: ABC transporter G family member 2...  68.6    2e-10   
gb|KHN10345.1|  ABC transporter G family member 27                    68.6    2e-10   
gb|KJB16512.1|  hypothetical protein B456_002G233500                  68.6    2e-10   
emb|CDP16843.1|  unnamed protein product                              68.6    2e-10   
ref|XP_003535833.2|  PREDICTED: ABC transporter G family member 2...  68.6    2e-10   
ref|XP_006588894.1|  PREDICTED: ABC transporter G family member 2...  68.6    2e-10   
ref|XP_007145759.1|  hypothetical protein PHAVU_007G265300g           68.6    3e-10   
ref|NP_001061077.2|  Os08g0167000                                     67.0    3e-10   
gb|KJB16514.1|  hypothetical protein B456_002G233500                  68.2    3e-10   
ref|XP_008781545.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  68.2    3e-10   
ref|XP_008392009.1|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
gb|KHG09828.1|  ABC transporter G family member 22                    68.2    3e-10   
ref|XP_006575266.1|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
ref|XP_004161297.1|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
ref|XP_009348549.1|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
ref|XP_006403815.1|  hypothetical protein EUTSA_v10010138mg           68.2    3e-10   
ref|XP_011467164.1|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
ref|XP_010110448.1|  ABC transporter G family member 22               68.2    3e-10   
gb|KHG01243.1|  ABC transporter G family member 9                     68.2    3e-10   
ref|XP_006473186.1|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
ref|XP_004303381.2|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
emb|CDX68292.1|  BnaA07g23320D                                        68.2    3e-10   
ref|XP_006665124.1|  PREDICTED: ABC transporter G family member 1...  66.6    3e-10   
ref|XP_007140113.1|  hypothetical protein PHAVU_008G085200g           68.2    3e-10   
ref|XP_011077784.1|  PREDICTED: ABC transporter G family member 22    68.2    3e-10   
ref|XP_009405790.1|  PREDICTED: ABC transporter G family member 2...  68.2    3e-10   
gb|KJB35858.1|  hypothetical protein B456_006G130900                  67.8    3e-10   
ref|XP_008380991.1|  PREDICTED: ABC transporter G family member 25    67.8    4e-10   
ref|XP_010491223.1|  PREDICTED: ABC transporter G family member 2...  67.8    4e-10   
emb|CAN66426.1|  hypothetical protein VITISV_029010                   67.8    4e-10   
ref|XP_009769371.1|  PREDICTED: ABC transporter G family member 25    67.8    4e-10   
gb|EYU38702.1|  hypothetical protein MIMGU_mgv1a001826mg              67.8    4e-10   
ref|XP_010491222.1|  PREDICTED: ABC transporter G family member 2...  67.8    4e-10   
ref|XP_010677592.1|  PREDICTED: ABC transporter G family member 22    67.8    5e-10   
ref|XP_004250400.1|  PREDICTED: ABC transporter G family member 25    67.4    5e-10   
ref|XP_002300394.2|  ABC transporter family protein                   67.4    5e-10   
ref|XP_011038858.1|  PREDICTED: ABC transporter G family member 26    67.4    5e-10   
ref|XP_004136536.1|  PREDICTED: ABC transporter G family member 2...  67.4    6e-10   
gb|KEH43567.1|  white-brown-complex ABC transporter family protein    67.0    6e-10   
ref|XP_010423326.1|  PREDICTED: ABC transporter G family member 2...  67.0    7e-10   
ref|XP_007204637.1|  hypothetical protein PRUPE_ppa001882mg           67.0    7e-10   
gb|AIU41652.1|  ABC transporter family protein                        67.0    7e-10   
ref|XP_010452592.1|  PREDICTED: ABC transporter G family member 22    67.0    7e-10   
ref|XP_002888855.1|  hypothetical protein ARALYDRAFT_476326           67.0    7e-10   
ref|XP_009104883.1|  PREDICTED: ABC transporter G family member 2...  67.0    7e-10   
ref|XP_004134252.1|  PREDICTED: ABC transporter G family member 9...  67.0    8e-10   
gb|KJB60113.1|  hypothetical protein B456_009G290300                  67.0    8e-10   
ref|XP_009362642.1|  PREDICTED: ABC transporter G family member 2...  67.0    8e-10   
ref|XP_006434601.1|  hypothetical protein CICLE_v10003388mg           65.9    8e-10   
gb|KFK41612.1|  hypothetical protein AALP_AA2G151000                  66.6    9e-10   
ref|XP_010917903.1|  PREDICTED: ABC transporter G family member 2...  66.6    9e-10   
ref|XP_009412321.1|  PREDICTED: ABC transporter G family member 2...  66.6    9e-10   
ref|XP_006390723.1|  hypothetical protein EUTSA_v10018591mg           66.2    9e-10   
ref|XP_010917904.1|  PREDICTED: ABC transporter G family member 2...  66.6    9e-10   
ref|XP_007221425.1|  hypothetical protein PRUPE_ppa016652mg           64.7    1e-09   
ref|XP_009362643.1|  PREDICTED: ABC transporter G family member 2...  66.6    1e-09   
ref|XP_010415916.1|  PREDICTED: ABC transporter G family member 2...  66.2    1e-09   
gb|KDP36071.1|  hypothetical protein JCGZ_08715                       66.6    1e-09   
ref|XP_008241114.1|  PREDICTED: ABC transporter G family member 2...  66.6    1e-09   
ref|XP_008241111.1|  PREDICTED: ABC transporter G family member 2...  66.6    1e-09   
ref|XP_008359521.1|  PREDICTED: ABC transporter G family member 2...  66.2    1e-09   
ref|XP_006594328.1|  PREDICTED: ABC transporter G family member 9...  66.2    1e-09   
ref|XP_009412322.1|  PREDICTED: ABC transporter G family member 2...  66.2    1e-09   
ref|XP_011047135.1|  PREDICTED: ABC transporter G family member 2...  66.2    1e-09   
ref|XP_008442971.1|  PREDICTED: ABC transporter G family member 2...  66.2    1e-09   
ref|XP_003541547.2|  PREDICTED: ABC transporter G family member 9...  66.2    1e-09   
emb|CDY14079.1|  BnaC02g01960D                                        66.2    1e-09   
ref|XP_008790027.1|  PREDICTED: ABC transporter G family member 2...  66.2    1e-09   
ref|XP_002309268.1|  ABC transporter family protein                   66.2    1e-09   
ref|XP_011047134.1|  PREDICTED: ABC transporter G family member 2...  66.2    2e-09   
ref|XP_011047133.1|  PREDICTED: ABC transporter G family member 2...  66.2    2e-09   
ref|XP_008442969.1|  PREDICTED: ABC transporter G family member 2...  66.2    2e-09   
ref|XP_006854611.1|  hypothetical protein AMTR_s00030p00144980        66.2    2e-09   
ref|XP_008797781.1|  PREDICTED: ABC transporter G family member 26    65.9    2e-09   
ref|XP_010471215.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
ref|XP_010244004.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
ref|XP_010244002.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
ref|XP_010244001.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
ref|XP_009125649.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
ref|XP_011101660.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
emb|CDY04991.1|  BnaAnng01730D                                        65.9    2e-09   
ref|XP_006287123.1|  hypothetical protein CARUB_v10000295mg           65.9    2e-09   
ref|XP_008790019.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
emb|CDY03668.1|  BnaA02g15690D                                        65.9    2e-09   
ref|XP_008790010.1|  PREDICTED: ABC transporter G family member 2...  65.9    2e-09   
gb|KHG11002.1|  ABC transporter G family member 25                    65.5    2e-09   
emb|CDX82199.1|  BnaC02g20910D                                        65.5    2e-09   
ref|XP_002873263.1|  abc transporter family protein                   65.5    2e-09   
ref|XP_009388615.1|  PREDICTED: ABC transporter G family member 2...  65.5    2e-09   
ref|XP_008461920.1|  PREDICTED: ABC transporter G family member 25    65.5    2e-09   
ref|XP_007142441.1|  hypothetical protein PHAVU_008G280800g           65.5    2e-09   
gb|KHN08925.1|  ABC transporter G family member 9                     65.5    2e-09   
gb|KHN17077.1|  ABC transporter G family member 25                    65.5    2e-09   
ref|XP_007163009.1|  hypothetical protein PHAVU_001G198400g           65.5    3e-09   
ref|XP_007019998.1|  ATP-binding casette family G25, putative         62.4    3e-09   
ref|XP_003553629.1|  PREDICTED: ABC transporter G family member 2...  65.5    3e-09   
ref|XP_006300374.1|  hypothetical protein CARUB_v10022459mg           63.9    3e-09   
ref|XP_006604670.1|  PREDICTED: ABC transporter G family member 2...  65.1    3e-09   
ref|XP_009388622.1|  PREDICTED: ABC transporter G family member 2...  65.5    3e-09   
ref|XP_002322764.1|  ABC transporter family protein                   65.1    3e-09   
ref|XP_006399125.1|  hypothetical protein EUTSA_v10012760mg           65.1    3e-09   
gb|KHN43592.1|  ABC transporter G family member 22                    65.1    3e-09   
ref|XP_006292375.1|  hypothetical protein CARUB_v10018588mg           65.1    3e-09   
gb|KEH41805.1|  white-brown-complex ABC transporter family protein    65.1    3e-09   
ref|XP_003535544.1|  PREDICTED: ABC transporter G family member 2...  65.1    3e-09   
ref|XP_003552990.1|  PREDICTED: ABC transporter G family member 2...  65.1    4e-09   
ref|XP_007019433.1|  White-brown-complex ABC transporter family       65.1    4e-09   
ref|XP_002524100.1|  ATP-binding cassette transporter, putative       64.7    4e-09   
gb|KHN31682.1|  ABC transporter G family member 26                    64.7    4e-09   
ref|XP_006373817.1|  hypothetical protein POPTR_0016s06620g           64.7    4e-09   
emb|CBI39105.3|  unnamed protein product                              64.7    4e-09   
ref|XP_010653238.1|  PREDICTED: ABC transporter G family member 2...  64.7    4e-09   
ref|XP_010653239.1|  PREDICTED: ABC transporter G family member 2...  64.7    4e-09   
ref|XP_004154501.1|  PREDICTED: ABC transporter G family member 2...  63.5    4e-09   
ref|XP_010428049.1|  PREDICTED: ABC transporter G family member 25    64.7    5e-09   
emb|CDP10560.1|  unnamed protein product                              64.7    5e-09   
ref|XP_002443920.1|  hypothetical protein SORBIDRAFT_07g004390        64.7    5e-09   
ref|XP_009414356.1|  PREDICTED: ABC transporter G family member 26    64.3    6e-09   
ref|XP_009127887.1|  PREDICTED: ABC transporter G family member 2...  64.3    6e-09   
ref|NP_001031843.1|  ABC transporter G family member 22               64.3    6e-09   
gb|KGN44483.1|  hypothetical protein Csa_7G307400                     64.3    6e-09   
gb|KFK40221.1|  hypothetical protein AALP_AA3G346400                  64.3    6e-09   
ref|NP_568169.1|  ABC transporter G family member 22                  64.3    6e-09   
emb|CDX96366.1|  BnaA07g29770D                                        63.2    7e-09   
ref|XP_003521505.1|  PREDICTED: ABC transporter G family member 2...  63.9    7e-09   
ref|XP_003555426.1|  PREDICTED: ABC transporter G family member 2...  63.9    7e-09   
ref|XP_003617868.1|  ABC transporter G family member                  63.9    8e-09   
ref|XP_006441201.1|  hypothetical protein CICLE_v10023692mg           63.5    9e-09   
gb|AET00827.2|  white-brown-complex ABC transporter family protein    63.5    9e-09   
ref|XP_010064794.1|  PREDICTED: ABC transporter G family member 25    63.9    9e-09   
ref|XP_004496375.1|  PREDICTED: ABC transporter G family member 2...  63.5    9e-09   
gb|KDO59196.1|  hypothetical protein CISIN_1g044602mg                 63.5    1e-08   
ref|XP_006474829.1|  PREDICTED: ABC transporter G family member 2...  63.5    1e-08   
ref|XP_006452648.1|  hypothetical protein CICLE_v10010223mg           63.5    1e-08   
ref|XP_011094212.1|  PREDICTED: ABC transporter G family member 2...  63.5    1e-08   
ref|XP_009105860.1|  PREDICTED: ABC transporter G family member 25    63.5    1e-08   
dbj|BAB11402.1|  ABC transporter-like protein                         63.2    1e-08   
ref|XP_007019995.1|  ATP-binding casette family G25                   63.5    1e-08   
ref|XP_010942700.1|  PREDICTED: ABC transporter G family member 26    63.2    1e-08   
ref|XP_004494279.1|  PREDICTED: ABC transporter G family member 2...  63.2    1e-08   
ref|XP_009416919.1|  PREDICTED: ABC transporter G family member 2...  63.2    1e-08   
emb|CDY36670.1|  BnaCnng07720D                                        62.0    2e-08   
ref|XP_004494278.1|  PREDICTED: ABC transporter G family member 2...  63.2    2e-08   
gb|KJB36224.1|  hypothetical protein B456_006G147000                  62.8    2e-08   
ref|XP_009348556.1|  PREDICTED: ABC transporter G family member 2...  62.8    2e-08   
gb|KJB19215.1|  hypothetical protein B456_003G089800                  62.4    2e-08   
ref|XP_008373573.1|  PREDICTED: ABC transporter G family member 2...  62.4    2e-08   
ref|XP_009383524.1|  PREDICTED: ABC transporter G family member 2...  62.4    2e-08   
emb|CDX72849.1|  BnaC06g32970D                                        62.4    2e-08   
gb|KJB19216.1|  hypothetical protein B456_003G089800                  62.4    2e-08   
gb|KJB19217.1|  hypothetical protein B456_003G089800                  62.4    2e-08   
gb|KHN46331.1|  ABC transporter G family member 9                     62.4    2e-08   
gb|KEH41808.1|  white-brown-complex ABC transporter family protein    62.4    2e-08   
ref|XP_010911944.1|  PREDICTED: ABC transporter G family member 2...  62.4    2e-08   
ref|XP_004498150.1|  PREDICTED: ABC transporter G family member 2...  62.4    2e-08   
ref|XP_007028066.1|  White-brown-complex ABC transporter family i...  62.4    3e-08   
ref|XP_002884953.1|  abc transporter family protein                   62.4    3e-08   
ref|XP_006836136.1|  hypothetical protein AMTR_s02272p00009060        57.8    3e-08   
ref|XP_011096967.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  62.0    3e-08   
ref|XP_010105155.1|  ABC transporter G family member 25               62.0    3e-08   
emb|CDX98933.1|  BnaC09g49020D                                        62.0    3e-08   
ref|XP_007028065.1|  White-brown-complex ABC transporter family i...  62.0    3e-08   
ref|NP_187928.2|  ABC transporter G family member 26                  62.0    3e-08   
ref|XP_010465139.1|  PREDICTED: ABC transporter G family member 26    62.0    3e-08   
dbj|BAB01414.1|  ABC transporter-like protein                         62.0    3e-08   
ref|XP_009799082.1|  PREDICTED: ABC transporter G family member 2...  62.0    4e-08   
ref|XP_010542512.1|  PREDICTED: ABC transporter G family member 2...  62.0    4e-08   
ref|XP_010542511.1|  PREDICTED: ABC transporter G family member 2...  62.0    4e-08   
ref|XP_009122263.1|  PREDICTED: ABC transporter G family member 2...  62.0    4e-08   
emb|CDX70095.1|  BnaA10g24440D                                        62.0    4e-08   
ref|XP_010678675.1|  PREDICTED: ABC transporter G family member 25    61.6    4e-08   
ref|XP_009122262.1|  PREDICTED: ABC transporter G family member 2...  62.0    4e-08   
ref|XP_009415591.1|  PREDICTED: ABC transporter G family member 2...  61.6    4e-08   
gb|AFK44306.1|  unknown                                               61.2    4e-08   
ref|XP_007200734.1|  hypothetical protein PRUPE_ppa021401mg           61.6    4e-08   
gb|KJB16513.1|  hypothetical protein B456_002G233500                  61.6    4e-08   
ref|XP_006300234.1|  hypothetical protein CARUB_v10016471mg           61.6    4e-08   
ref|XP_010426847.1|  PREDICTED: ABC transporter G family member 2...  61.6    4e-08   
ref|XP_011458535.1|  PREDICTED: ABC transporter G family member 2...  61.6    4e-08   
ref|XP_010247278.1|  PREDICTED: ABC transporter G family member 2...  61.6    4e-08   
ref|XP_008664829.1|  PREDICTED: uncharacterized protein LOC100216...  61.6    4e-08   
ref|XP_009799080.1|  PREDICTED: ABC transporter G family member 2...  61.6    5e-08   
ref|XP_009599779.1|  PREDICTED: ABC transporter G family member 2...  61.6    5e-08   
ref|XP_010500190.1|  PREDICTED: ABC transporter G family member 2...  61.6    5e-08   
ref|XP_009406087.1|  PREDICTED: ABC transporter G family member 2...  61.2    5e-08   
ref|XP_009360789.1|  PREDICTED: ABC transporter G family member 2...  61.6    5e-08   
gb|ABR17189.1|  unknown                                               61.6    5e-08   
ref|XP_008664823.1|  PREDICTED: uncharacterized protein LOC100216...  61.2    5e-08   
gb|KJB35859.1|  hypothetical protein B456_006G130900                  60.8    6e-08   
gb|KEH24294.1|  white-brown-complex ABC transporter family protein    61.2    6e-08   
ref|XP_002465834.1|  hypothetical protein SORBIDRAFT_01g046620        61.2    6e-08   
ref|XP_009406088.1|  PREDICTED: ABC transporter G family member 2...  60.8    7e-08   
ref|XP_006656226.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  60.8    7e-08   
ref|XP_002522797.1|  ATP-binding cassette transporter, putative       60.8    7e-08   
ref|XP_010487069.1|  PREDICTED: ABC transporter G family member 2...  60.8    7e-08   
ref|XP_008349497.1|  PREDICTED: ABC transporter G family member 2...  60.8    8e-08   
ref|XP_006841289.1|  hypothetical protein AMTR_s00134p00069640        60.8    8e-08   
ref|XP_008237629.1|  PREDICTED: ABC transporter G family member 2...  60.8    8e-08   
ref|XP_010320061.1|  PREDICTED: ABC transporter G family member 2...  60.5    1e-07   
ref|XP_004237766.1|  PREDICTED: ABC transporter G family member 2...  60.5    1e-07   
ref|XP_008662280.1|  PREDICTED: hypothetical protein isoform X1       60.5    1e-07   



>ref|XP_009802424.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=658

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPA-DAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            +APKPEN   +     AA TN P      D  CLA+P+Q N+QSF QRALYPI LKFEEI
Sbjct  6    IAPKPENSGTEVM---AAPTNLPNPSELHDMSCLAFPVQINSQSFSQRALYPITLKFEEI  62

Query  311  VYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            VYK+  E +G CC G S+ +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  63   VYKIRQETQGMCCGGTSNTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTA  116



>ref|XP_011071699.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 85/114 (75%), Gaps = 6/114 (5%)
 Frame = +2

Query  131  SVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            SVAPK EN +           N+P   A +   LAYP+Q N+QSFLQR LYPI LKFEEI
Sbjct  5    SVAPKLENGTELV----TGLPNRPE--ACNTAYLAYPIQRNSQSFLQRILYPITLKFEEI  58

Query  311  VYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            VYKV  E KG+CC G SS +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  59   VYKVNSERKGTCCGGTSSTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  112



>ref|XP_010324495.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum lycopersicum]
Length=671

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ-SFLQRALYPIVLKF  301
            LH V PKPEN   D  + +A+T +  +    DK CLA P+Q  +Q S+LQ+A+YPI LKF
Sbjct  3    LHGVTPKPENGGTD--LMEASTNSPNSSKQYDKSCLALPVQIKSQQSYLQKAMYPITLKF  60

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            EEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTA
Sbjct  61   EEIVYKISQENKGMCCGGSSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTA  117



>ref|XP_009631041.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=660

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 91/121 (75%), Gaps = 6/121 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQP-ADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP ++ V+PKPEN   +     AA TN P +    D  CLA+P+Q N+QSF QRALYPI 
Sbjct  1    MP-VNCVSPKPENGGTELM---AAPTNLPDSSELHDMSCLAFPVQFNSQSFAQRALYPIT  56

Query  293  LKFEEIVYKVGGEDKGSCC-TGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
            LKFEEIVYK+  E +G CC  G S+ +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLT
Sbjct  57   LKFEEIVYKIRQETQGMCCGDGASNTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLT  116

Query  470  A  472
            A
Sbjct  117  A  117



>ref|XP_006361228.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum tuberosum]
Length=659

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ-SFLQRALYPIVLKF  301
            LH VAP PE    D  + +A+T +  +    DK CL +P+Q  +Q SFLQ+A+YPI LKF
Sbjct  3    LHCVAPNPEKGGTD--LMEASTNSPNSSKQYDKSCLGFPVQIKSQQSFLQKAMYPITLKF  60

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            EEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTA
Sbjct  61   EEIVYKISQENKGMCCGGPSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTA  117



>ref|XP_006361227.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum tuberosum]
Length=662

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ-SFLQRALYPIVLKF  301
            LH VAP PE    D  + +A+T +  +    DK CL +P+Q  +Q SFLQ+A+YPI LKF
Sbjct  3    LHCVAPNPEKGGTD--LMEASTNSPNSSKQYDKSCLGFPVQIKSQQSFLQKAMYPITLKF  60

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            EEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTA
Sbjct  61   EEIVYKISQENKGMCCGGPSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTA  117



>emb|CDP07185.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+SVAPKPEN S  Q M     +++  D     P LAYP+Q  TQSFLQ    PI L
Sbjct  1    MP-LNSVAPKPENPSI-QLMGGLPISSESCD----NPYLAYPIQARTQSFLQMTSNPITL  54

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEEIVYKV  E KG CC    S++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  55   KFEEIVYKVRIETKGMCCGQTLSSKEKTILNGLTGMVCPGEILAMLGPSGSGKTTLLTA  113



>ref|XP_002270533.2| PREDICTED: ABC transporter G family member 14 [Vitis vinifera]
 emb|CBI29188.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ +APKPEN   +  M+  + T++  ++A     L YP+QTN+QS LQ  LY I L
Sbjct  1    MP-LNCIAPKPEN-QGNIPMEGLSRTSESDNSA----VLTYPMQTNSQSILQHTLYSINL  54

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEE+VYKV  E KG C  G  S R+KTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  55   KFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  113



>ref|XP_004246010.1| PREDICTED: ABC transporter G family member 14 [Solanum lycopersicum]
Length=646

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 84/119 (71%), Gaps = 15/119 (13%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPKPEN   +              AAP  P  + P   N++SF+QRAL+PI L
Sbjct  1    MP-LHCVAPKPENFGTELM------------AAP--PNSSKPEMNNSESFIQRALFPITL  45

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEE+VYK+  E KG CC G SS +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  46   KFEEVVYKIKQETKGMCCGGPSSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTA  104



>ref|XP_011082193.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 87/124 (70%), Gaps = 15/124 (12%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKP-----CLAYPLQTNTQSFLQRAL  280
            MP L SVAPK EN       D   T    A++ P +P      LAYP+Q +++SFLQR L
Sbjct  1    MP-LGSVAPKLEN-------DVDGTV--LANSTPHRPESCDTALAYPVQNSSRSFLQRTL  50

Query  281  YPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTT  460
            YPI LKFEEIVYKV  E K SC    +SA+EKTILNG+TGMV PGEILAMLGPSGSGKTT
Sbjct  51   YPITLKFEEIVYKVYYERKRSCGGTSTSAKEKTILNGITGMVSPGEILAMLGPSGSGKTT  110

Query  461  LLTA  472
            LLTA
Sbjct  111  LLTA  114



>ref|XP_006359961.1| PREDICTED: ABC transporter G family member 14-like [Solanum tuberosum]
Length=646

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 83/119 (70%), Gaps = 15/119 (13%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPKPEN   +               AP  P  + P   N++SF+QRAL+PI L
Sbjct  1    MP-LHCVAPKPENFGTEL-------------MAPP-PNSSKPEMKNSESFIQRALFPITL  45

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEE+VYK+  E KG CC G SS +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  46   KFEEVVYKIKQETKGMCCGGPSSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTA  104



>ref|XP_006385164.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP62961.1| ABC transporter family protein [Populus trichocarpa]
Length=656

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 84/120 (70%), Gaps = 9/120 (8%)
 Frame = +2

Query  116  MPALHSVAPKPE-NCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L+ V PKP+ N +P + +     TN       ++  L+YP Q N+QS LQ  +YP  
Sbjct  1    MP-LNYVVPKPDHNSAPTEGLPRMPETN-------NRAVLSYPGQANSQSVLQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV  + KG C  G  S+REKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKLDQKGLCWGGTWSSREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  112



>ref|XP_002519942.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF42546.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=634

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVT  397
             +  LAYP+Q N QS LQ  +YPI LKFEE+VYKV  E KGSCC G  + +EKTILNG+T
Sbjct  6    HETVLAYPVQPNQQSVLQLTVYPITLKFEEVVYKVKLEQKGSCCGGTWATKEKTILNGIT  65

Query  398  GMVCPGEILAMLGPSGSGKTTLLTA  472
            GMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  66   GMVCPGEILAMLGPSGSGKTTLLTA  90



>ref|XP_011028515.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = +2

Query  116  MPALHSVAPKPE-NCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L  V PKP+ N +P + +     TN       ++  L+YP Q N+QS LQ  +YP  
Sbjct  1    MP-LSYVVPKPDHNSAPTEGLPKMPETN-------NRAVLSYPGQANSQSVLQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV    KG C  G  S REKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKLNQKGLCWGGAWSTREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  112



>gb|KDP37810.1| hypothetical protein JCGZ_06712 [Jatropha curcas]
Length=669

 Score =   128 bits (322),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 6/104 (6%)
 Frame = +2

Query  167  QRMDDAATTN--QPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKG  340
            Q++  A   N  +P D A     LAYP+Q N+QS L+ ++YPI LKFEE+VYKV  E KG
Sbjct  41   QQVQSARQRNMSEPNDGA----VLAYPVQPNSQSVLRLSIYPITLKFEEVVYKVKLEQKG  96

Query  341  SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             C  G    +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  97   VCWGGTWGTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  140



>ref|XP_003548769.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN30742.1| ABC transporter G family member 14 [Glycine soja]
Length=651

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PENC   +   + + T  P +  P+      P+QTN QSF + A+YPI LKFEE+VYKV 
Sbjct  2    PENCIAPK--SEHSNTTHPEEGPPEMTQTVLPIQTNKQSFPKLAMYPITLKFEELVYKVK  59

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             E KG C     S +EKTIL GVTGMVCPGEI+AMLGPSGSGKTTLLTA
Sbjct  60   IEQKGVCWGSTRSCKEKTILKGVTGMVCPGEIMAMLGPSGSGKTTLLTA  108



>ref|XP_010540713.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=649

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +2

Query  146  PENC---SPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC    P++     A          DK  LA+P+  N+Q   Q+ LYPI LKFEEIVY
Sbjct  2    PQNCIAPRPEENGGGLAQGQADKSEMQDKAVLAFPIMANSQPGFQQTLYPITLKFEEIVY  61

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E KGSC  G  S++EK ILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  62   KVKIEQKGSCW-GTWSSKEKRILNGITGMVCPGEILAMLGPSGSGKTTLLSA  112



>emb|CAN70956.1| hypothetical protein VITISV_028138 [Vitis vinifera]
Length=677

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 87/139 (63%), Gaps = 26/139 (19%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ +APKPEN   +  M+  + T++  ++A     L YP+QTN+QS LQ  LY I L
Sbjct  1    MP-LNCIAPKPEN-QGNIPMEGLSRTSESDNSA----VLTYPMQTNSQSILQHTLYSINL  54

Query  296  K--------------------FEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPG  415
            K                    FEE+VYKV  E KG C  G  S R+KTILNG+TGMVCPG
Sbjct  55   KVCLLFILGPVPYIIFTHYNMFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPG  114

Query  416  EILAMLGPSGSGKTTLLTA  472
            EILAMLGPSGSGKTTLLTA
Sbjct  115  EILAMLGPSGSGKTTLLTA  133



>ref|XP_010275138.1| PREDICTED: ABC transporter G family member 14 [Nelumbo nucifera]
Length=654

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 78/113 (69%), Gaps = 9/113 (8%)
 Frame = +2

Query  140  PKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNT-QSFLQRALYPIVLKFEEIVY  316
            P+ +  S    M D   TN       +   +AYP+  N  +S L+ AL+PI LKFEE+VY
Sbjct  2    PENQQQSASSNMSDQQQTN-------NTTVVAYPVHPNNPRSVLRLALFPITLKFEEVVY  54

Query  317  KVGGEDKGSCCTG-KSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E K SCC G K S+REKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  55   KVKLEQKESCCWGGKWSSREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  107



>ref|XP_011013139.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
 ref|XP_011015812.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 82/120 (68%), Gaps = 9/120 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCS-PDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L+S+ PKP++ S P + +   +  N       ++  +AYP Q N+QS  Q  +YP  
Sbjct  1    MP-LNSIVPKPDHKSAPVEGLRKMSEIN-------NRAVVAYPGQANSQSVHQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV  + KG C  G  + REKTILN VTGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKQDQKGLCWGGTWTTREKTILNEVTGMVCPGEILAMLGPSGSGKTTLLTA  112



>ref|XP_007158067.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
 gb|ESW30061.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
Length=658

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 6/115 (5%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS--FLQRALYPIVLKFEE  307
            +APKPE C+    ++      +P ++      L++P+QTN Q   F +  +YPI LKFEE
Sbjct  6    IAPKPEYCNSHHSVEGPQEMTEPHNST----VLSHPMQTNEQQQPFPKLIMYPITLKFEE  61

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  62   LVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTA  116



>ref|XP_002304113.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
 gb|EEE79092.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
Length=656

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 82/120 (68%), Gaps = 9/120 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCS-PDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L+S+ PKP++ S P + +   +  N+ A        +AYP Q N+QS  Q  +YP  
Sbjct  1    MP-LNSIVPKPDHKSVPMEGLPKMSEINKRA-------VVAYPGQANSQSVHQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV  + KG C  G  + REKTILN +TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKQDQKGLCWGGTWTTREKTILNEITGMVCPGEILAMLGPSGSGKTTLLTA  112



>ref|XP_007040852.1| ATP-binding cassette 14 [Theobroma cacao]
 gb|EOY25353.1| ATP-binding cassette 14 [Theobroma cacao]
Length=656

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (72%), Gaps = 10/121 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCS--PDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPI  289
            MP L+ +APKPE+ S  P + + + ++ +       ++  LA+P+Q N+Q  ++  LYPI
Sbjct  1    MP-LNCIAPKPEHGSSGPVEALSETSSESH------NRAVLAFPIQHNSQPPVRVTLYPI  53

Query  290  VLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
             LKFE++VYKV  E KGSC  G    REKTILNG+TG+VCPGEILAMLGPSGSGKTTLLT
Sbjct  54   TLKFEKVVYKVKLEQKGSCW-GAWITREKTILNGITGVVCPGEILAMLGPSGSGKTTLLT  112

Query  470  A  472
            A
Sbjct  113  A  113



>ref|XP_003537708.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN41781.1| ABC transporter G family member 14 [Glycine soja]
Length=660

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 80/117 (68%), Gaps = 8/117 (7%)
 Frame = +2

Query  134  VAPKPENC-SPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS---FLQRALYPIVLKF  301
            +APKPE C S    +++     +P D+      ++YP+QTN Q    F +  +YPI LKF
Sbjct  6    IAPKPEYCNSTHHSVEEPPEMTEPHDST----VISYPMQTNEQQQQPFPKLIMYPITLKF  61

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            EE+VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  62   EELVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTA  118



>gb|KHN28317.1| ABC transporter G family member 14 [Glycine soja]
Length=659

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 7/116 (6%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS---FLQRALYPIVLKFE  304
            +APKPE C+    ++      +P ++      L+YP+Q N Q    F +  +YPI LKFE
Sbjct  6    IAPKPEFCNSHNSVEGPPEMTEPHNST----VLSYPMQANEQQQQPFPKLIMYPITLKFE  61

Query  305  EIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            E+VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  62   ELVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTA  117



>ref|XP_003517105.2| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=659

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 7/116 (6%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS---FLQRALYPIVLKFE  304
            +APKPE C+    ++      +P ++      L+YP+Q N Q    F +  +YPI LKFE
Sbjct  6    IAPKPEFCNSHNSVEGPPEMTEPHNST----VLSYPMQANEQQQQPFPKLIMYPITLKFE  61

Query  305  EIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            E+VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  62   ELVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTA  117



>ref|XP_007156346.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
 gb|ESW28340.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
Length=648

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            LQTN QSFL+ A+YPI LKFEE+VYKV  E KG C     S+REKTIL GVTGMVCPGEI
Sbjct  29   LQTNEQSFLKLAVYPITLKFEELVYKVKVEQKGMCWGSTGSSREKTILKGVTGMVCPGEI  88

Query  422  LAMLGPSGSGKTTLLTA  472
            +AMLGPSGSGKTTLLTA
Sbjct  89   MAMLGPSGSGKTTLLTA  105



>ref|XP_004512314.1| PREDICTED: ABC transporter G family member 14-like [Cicer arietinum]
Length=661

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 78/117 (67%), Gaps = 8/117 (7%)
 Frame = +2

Query  146  PENC---SPDQRMDDAATTNQP---ADAAPDKPCLAYPLQTNTQSFL-QRALYPIVLKFE  304
            P+NC    P++ +   +    P   AD       L YP+ TN QS + +  +YPI LKFE
Sbjct  2    PQNCIAPKPEEYLSSLSVEASPPNMADTQTTSTVLTYPISTNEQSLVPKLIMYPITLKFE  61

Query  305  EIVYKVGGEDKGSCCTG-KSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +++YKV  E KG  C G K S +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  62   DLIYKVKLEQKGGTCWGSKWSYKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTA  118



>ref|XP_003547739.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=656

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PENC   +   +   T  P +  P+      P++TN QSF + A++PI LKFEE+VY V 
Sbjct  2    PENCIAPKPEHNNNNTTHPEEGPPEMTETVLPIKTNEQSFPKLAMFPITLKFEELVYNVK  61

Query  326  GEDKGSCCTGKS-SAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             E KG  C G + S +EKTIL GVTGMV PGEI+AMLGPSGSGKTTLLTA
Sbjct  62   IEHKGGLCWGSTRSCKEKTILKGVTGMVSPGEIMAMLGPSGSGKTTLLTA  111



>gb|KJB25133.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=644

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (71%), Gaps = 9/119 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ VAPKPE+   + R++   + +Q       K  LA+P+Q N+Q   +  L+ I L
Sbjct  1    MP-LNCVAPKPEHAC-NGRVESETSKSQ------KKAALAFPIQHNSQPPPRLTLFHITL  52

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEE+VYKV  E+KG+C  G    REKT+LNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   KFEEVVYKVKLEEKGTCW-GSWITREKTVLNGITGVVCPGEILAMLGPSGSGKTTLLTA  110



>gb|KJB25132.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=653

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (71%), Gaps = 9/119 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ VAPKPE+   + R++   + +Q       K  LA+P+Q N+Q   +  L+ I L
Sbjct  1    MP-LNCVAPKPEHAC-NGRVESETSKSQ------KKAALAFPIQHNSQPPPRLTLFHITL  52

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEE+VYKV  E+KG+C  G    REKT+LNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   KFEEVVYKVKLEEKGTCW-GSWITREKTVLNGITGVVCPGEILAMLGPSGSGKTTLLTA  110



>ref|XP_008387860.1| PREDICTED: ABC transporter G family member 14 [Malus domestica]
Length=668

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 81/122 (66%), Gaps = 12/122 (10%)
 Frame = +2

Query  122  ALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPC-----LAYPLQTNTQSFLQRALYP  286
            +L S+ PKP         D + TT    + +P+ P       A   Q N+Q+FLQ  LYP
Sbjct  2    SLSSIVPKPAEYGGS---DSSCTTT--VEVSPEMPAGTQNKAAPATQVNSQAFLQLTLYP  56

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            I LKFEE+ YKV  E KGS   G+S +REK+IL+G+TGMVCPGEILAMLGPSGSGKTTLL
Sbjct  57   ITLKFEEVFYKVKVEQKGS--RGRSRSREKSILSGITGMVCPGEILAMLGPSGSGKTTLL  114

Query  467  TA  472
            T+
Sbjct  115  TS  116



>ref|XP_010251517.1| PREDICTED: ABC transporter G family member 14-like [Nelumbo nucifera]
Length=650

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PEN    Q+      + QP +       +AYP+  N  S LQ A++PI LKFEE+VYKV 
Sbjct  2    PEN---PQQFASLNMSEQPNNTT----IVAYPVHPNPPSVLQLAVFPITLKFEEVVYKVK  54

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             E+KG    G  + +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  55   LEEKGFWWGGTWNTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  103



>ref|XP_010111780.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXC31694.1| ABC transporter G family member 14 [Morus notabilis]
Length=666

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 70/97 (72%), Gaps = 14/97 (14%)
 Frame = +2

Query  224  PCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGED---KGSCCTGKSS----------  364
            P LAYPLQ N+ S LQ +L+PI LKFEE+VYKV  ++   KG  C G +S          
Sbjct  17   PVLAYPLQLNSPSLLQLSLFPITLKFEEVVYKVKVDELHEKGGWCWGNNSSTSASSSSWP  76

Query  365  -AREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
              REK+ILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  77   STREKSILNGITGMVCPGEILAMLGPSGSGKTTLLTA  113



>ref|XP_010463057.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=574

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLRDMSETQSKSVLAFPIVT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E   S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  61   KVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  112



>gb|KHG16348.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=653

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 80/120 (67%), Gaps = 11/120 (9%)
 Frame = +2

Query  116  MPALHSVAPKPEN-CSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L+ VAPKPE+ C+                 +  K  LA+P+Q N+Q   +  L+ I 
Sbjct  1    MP-LNCVAPKPEHACN--------GLVESETSKSQKKAALAFPIQHNSQPPPRLTLFHIT  51

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV  E+KGSC  G    REKTILNG+TG+VCPGEILAMLGPSGSGKTTLL+A
Sbjct  52   LKFEEVVYKVKLEEKGSCW-GSWITREKTILNGITGVVCPGEILAMLGPSGSGKTTLLSA  110



>gb|KHG20314.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=657

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQ-RALYPIV  292
            MP L+ +A KPE+      ++  + T +P ++A     LA+P+Q N+Q  ++   LYPI 
Sbjct  1    MP-LNLIATKPEHGMSSGPLEALSETPEPHNSA----MLAFPIQRNSQPPVRLTTLYPIT  55

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEEIVYKV  E KGSC  G  + REKTILNG++G+V PGEILAMLGPSGSGKTTLLTA
Sbjct  56   LKFEEIVYKVKLEQKGSCWGGWIT-REKTILNGISGVVYPGEILAMLGPSGSGKTTLLTA  114



>ref|XP_010478591.1| PREDICTED: ABC transporter G family member 14 [Camelina sativa]
Length=649

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLPDMSETQSKSVLAFPMVT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E   S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  61   KVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  112



>gb|KJB51502.1| hypothetical protein B456_008G219500 [Gossypium raimondii]
Length=657

 Score =   114 bits (285),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQ-RALYPIV  292
            MP L+ +A KPE+      ++  + T +P ++A     LA+P+Q N+Q  ++   LYPI 
Sbjct  1    MP-LNLIATKPEHGISSGPLEALSETPEPHNSA----MLAFPIQRNSQPPVRLTTLYPIT  55

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +KFEEIVYKV  E KGSC  G  + REKTILNG++G+V PGEILAMLGPSGSGKTTLLTA
Sbjct  56   MKFEEIVYKVKLEQKGSCWGGWIT-REKTILNGISGVVYPGEILAMLGPSGSGKTTLLTA  114



>ref|XP_010499718.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=649

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLPDMSETQSKSVLAFPIVT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E   S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  61   KVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  112



>ref|XP_009114967.1| PREDICTED: ABC transporter G family member 14 [Brassica rapa]
 emb|CDY49155.1| BnaA09g25160D [Brassica napus]
Length=649

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 77/115 (67%), Gaps = 11/115 (10%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            +AP+PE        +  AT     D +    KP LA+P+ T +Q  LQ ++YPI LKFEE
Sbjct  6    IAPRPEE-------NGEATVQGLTDMSETQGKPVLAFPVAT-SQPGLQLSMYPITLKFEE  57

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            + YKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  58   VEYKVKIEHTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  111



>emb|CDY12299.1| BnaA09g24990D [Brassica napus]
Length=712

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 77/115 (67%), Gaps = 11/115 (10%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            +AP+PE        +  AT     D +    KP LA+P+ T +Q  LQ ++Y I LKFEE
Sbjct  6    IAPRPEE-------NGEATVQGLTDMSETQGKPVLAFPVAT-SQPGLQLSMYSITLKFEE  57

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +VYKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  58   VVYKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  111



>ref|XP_009605917.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=633

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 78/119 (66%), Gaps = 28/119 (24%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPKPEN   +              AAP  P  + P + N++SF QRAL+PI L
Sbjct  1    MP-LHCVAPKPENFGTELM------------AAP--PNSSMP-EMNSESFTQRALFPITL  44

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEEIVYK+            +S +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  45   KFEEIVYKI------------TSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTA  91



>ref|XP_010518955.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=631

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            +Q+ALY I LKFEEIVYKV  E KGSC  G  S++EKTILNGVTGMVCPGEILAMLGPSG
Sbjct  27   MQKALYSITLKFEEIVYKVKIEQKGSCW-GTWSSKEKTILNGVTGMVCPGEILAMLGPSG  85

Query  446  SGKTTLLTA  472
            SGKTTLL+A
Sbjct  86   SGKTTLLSA  94



>ref|XP_008347334.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Malus domestica]
Length=771

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = +2

Query  86   TQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSF  265
            TQTF   + AM +L S+ PKP                 P   A ++   A   Q N+Q+F
Sbjct  81   TQTF---NFAM-SLSSIVPKPAEYGGSDSTCATTVEGSPEMPAGNQNKAAPATQVNSQAF  136

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            LQ  LYPI LKFEE+ YKV  + KGS     S +REK+IL+G+TGMV PGEILAMLGPSG
Sbjct  137  LQLTLYPITLKFEEVFYKVKVDQKGS--RDSSRSREKSILSGITGMVXPGEILAMLGPSG  194

Query  446  SGKTTLLTA  472
            SGKTTLLTA
Sbjct  195  SGKTTLLTA  203



>ref|XP_008347335.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Malus domestica]
Length=755

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = +2

Query  86   TQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSF  265
            TQTF   + AM +L S+ PKP                 P   A ++   A   Q N+Q+F
Sbjct  81   TQTF---NFAM-SLSSIVPKPAEYGGSDSTCATTVEGSPEMPAGNQNKAAPATQVNSQAF  136

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            LQ  LYPI LKFEE+ YKV  + KGS     S +REK+IL+G+TGMV PGEILAMLGPSG
Sbjct  137  LQLTLYPITLKFEEVFYKVKVDQKGS--RDSSRSREKSILSGITGMVXPGEILAMLGPSG  194

Query  446  SGKTTLLTA  472
            SGKTTLLTA
Sbjct  195  SGKTTLLTA  203



>ref|XP_006303926.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
 gb|EOA36824.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
Length=648

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLTDMSETQSKSVLAFPIVT-SQPGLQLSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E + S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  61   KVKIE-QTSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  111



>ref|XP_006415305.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
 gb|ESQ33658.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
Length=648

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 11/115 (10%)
 Frame = +2

Query  134  VAPKPENCSPD--QRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            +AP+PE       Q + D + T         K  +A+P+ T +Q  LQ ++YPI LKFEE
Sbjct  6    IAPRPEENGQVMVQGLTDMSETQ-------SKSVIAFPVVT-SQPGLQLSMYPITLKFEE  57

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +VYKV  E    C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  58   VVYKVKIEQTNQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  111



>ref|XP_009757349.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=630

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 75/119 (63%), Gaps = 31/119 (26%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPK EN   +  +D           +P+          N++SF QRAL+PI L
Sbjct  1    MP-LHCVAPKAENFGTELMVD-----------SPNS-------SMNSESFTQRALFPITL  41

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFEEIVYK+            +S +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  42   KFEEIVYKI------------TSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTA  88



>ref|XP_008221126.1| PREDICTED: ABC transporter G family member 14 [Prunus mume]
Length=675

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = +2

Query  122  ALHSVAPKP-ENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLK  298
            +L S+ PKP E    D    +        D+       A   Q N+QSFLQ  +YPI LK
Sbjct  2    SLSSIVPKPAEYGGSDSATVEGTPEMSETDSKAVVAYPAAAAQVNSQSFLQLTMYPITLK  61

Query  299  FEEIVYKVGGEDKG----SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            FEE+ YKV  E KG    S     +S+REK+IL+G+TG VCPGEILAMLGPSGSGKTTLL
Sbjct  62   FEEVFYKVKMEQKGGGGVSWWGTNTSSREKSILSGITGTVCPGEILAMLGPSGSGKTTLL  121

Query  467  TA  472
            TA
Sbjct  122  TA  123



>ref|NP_564383.1| ABC transporter G family member 14 [Arabidopsis thaliana]
 sp|Q9C6W5.1|AB14G_ARATH RecName: Full=ABC transporter G family member 14; Short=ABC transporter 
ABCG.14; Short=AtABCG14; AltName: Full=White-brown 
complex homolog protein 14; Short=AtWBC14 [Arabidopsis thaliana]
 gb|AAG60152.1|AC074360_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAM67104.1| ABC transporter, putative [Arabidopsis thaliana]
 dbj|BAC42192.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31390.1| ABC transporter G family member 14 [Arabidopsis thaliana]
Length=648

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPD---KPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC   +  +D     Q      D   K  LA+P  T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGVMVQGLPDMSDTQSKSVLAFPTIT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E + S C G   ++EKTILNG+TGMVCPGE LAMLGPSGSGKTTLL+A
Sbjct  61   KVKIE-QTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTLLSA  111



>ref|XP_007226971.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
 gb|EMJ28170.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
Length=672

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 75/123 (61%), Gaps = 6/123 (5%)
 Frame = +2

Query  122  ALHSVAPKP-ENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLK  298
            +L S+ PKP E    D    +         +       A   Q N+QSFLQ A+YPI LK
Sbjct  2    SLSSIVPKPAEYGGSDSATVEGTPEMSETHSKAVVAYPAAAAQVNSQSFLQLAMYPITLK  61

Query  299  FEEIVYKVGGEDKG-----SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            FEE+ YKV  E KG     S     +S+REK+IL+G+TG VCPGEILAMLGPSGSGKTTL
Sbjct  62   FEEVFYKVKMEQKGGRGGVSWWGTNTSSREKSILSGITGTVCPGEILAMLGPSGSGKTTL  121

Query  464  LTA  472
            LTA
Sbjct  122  LTA  124



>emb|CDY47690.1| BnaCnng15320D [Brassica napus]
Length=641

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 69/113 (61%), Gaps = 14/113 (12%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIV  313
            +AP+PE     + M    T                  Q+ +   LQ ++YPI LKFEE+V
Sbjct  6    IAPRPEESGSGEAMVQGLTDMSET-------------QSKSVQGLQLSMYPITLKFEEVV  52

Query  314  YKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            YKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  53   YKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  104



>ref|XP_009145231.1| PREDICTED: ABC transporter G family member 14-like [Brassica 
rapa]
 emb|CDY50951.1| BnaA05g36020D [Brassica napus]
Length=641

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 69/113 (61%), Gaps = 14/113 (12%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIV  313
            +AP+PE     + M    T                  Q+ +   LQ ++YPI LKFEE+V
Sbjct  6    IAPRPEESGSGEAMVQGLTDMSET-------------QSKSVQGLQLSMYPITLKFEEVV  52

Query  314  YKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            YKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+A
Sbjct  53   YKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSA  104



>ref|XP_004291249.1| PREDICTED: ABC transporter G family member 14 [Fragaria vesca 
subsp. vesca]
Length=660

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 64/89 (72%), Gaps = 8/89 (9%)
 Frame = +2

Query  230  LAYP---LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAR-----EKTIL  385
            LAYP    Q N QSFLQ A+YPI LKFEE+ YKV  + K       SS+      EK+IL
Sbjct  20   LAYPSAAAQVNAQSFLQLAMYPITLKFEEVFYKVKMDHKAGLVPWPSSSSNKLTSEKSIL  79

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            NG++G+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  80   NGISGVVCPGEILAMLGPSGSGKTTLLTA  108



>ref|XP_010054006.1| PREDICTED: ABC transporter G family member 14 [Eucalyptus grandis]
 gb|KCW78389.1| hypothetical protein EUGRSUZ_D02559 [Eucalyptus grandis]
Length=653

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 67/93 (72%), Gaps = 12/93 (13%)
 Frame = +2

Query  200  PADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGK--SSARE  373
            P D+  ++  LAYP+Q          L+PI LKFEE+VYK+  + K SC  G   SS RE
Sbjct  33   PCDS--NEAVLAYPVQVT--------LFPITLKFEEVVYKIKLDQKQSCWGGTWTSSTRE  82

Query  374  KTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KTILNGV+G+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  83   KTILNGVSGVVCPGEILAMLGPSGSGKTTLLTA  115



>gb|EYU29117.1| hypothetical protein MIMGU_mgv1a002688mg [Erythranthe guttata]
Length=646

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 78/122 (64%), Gaps = 21/122 (17%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L SVAPKPEN                 D       L  P    +QSF QRALYPI L
Sbjct  1    MP-LCSVAPKPEN-----------------DGTELAIGLPNPAHKISQSFRQRALYPITL  42

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAR---EKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            KFEEIVYKV G  +GSCC G  ++    EKTILNGVTGMVCPGE+LAMLGPSGSGKTTLL
Sbjct  43   KFEEIVYKVNGGREGSCCGGGGASTATGEKTILNGVTGMVCPGELLAMLGPSGSGKTTLL  102

Query  467  TA  472
            TA
Sbjct  103  TA  104



>gb|ABB97034.1| ABC transporter-like protein [Brassica rapa]
Length=450

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKT  457
            +YPI LKFEE+VYKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKT
Sbjct  1    MYPITLKFEEVVYKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKT  59

Query  458  TLLTA  472
            TLL+A
Sbjct  60   TLLSA  64



>ref|XP_002893685.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69944.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=640

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 7/109 (6%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P+NC   +  +D     Q     PD   ++     + Q  LQ ++YPI LKFEE+VYKV 
Sbjct  2    PQNCIAPRPEEDGGVMVQ---GLPD---MSETQSKSVQPGLQMSMYPITLKFEEVVYKVK  55

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             E + S C G   ++EKTILNG+TGMVCPGE LAMLGPSGSGKTTLL+A
Sbjct  56   IE-QTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTLLSA  103



>gb|KFK44944.1| hypothetical protein AALP_AA1G323000 [Arabis alpina]
Length=640

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 71/109 (65%), Gaps = 7/109 (6%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P+NC   +  ++     Q       +  L       +QS  Q ++YPI LKFEE++YKV 
Sbjct  2    PQNCIAPRPEENGEVLVQDLSETQSRSVL------TSQSGFQLSMYPITLKFEEVMYKVK  55

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             + + S C G  S++EKTILNG++GM+CPGEILAMLGPSGSGKTTLL+A
Sbjct  56   IK-QTSQCFGSWSSKEKTILNGISGMICPGEILAMLGPSGSGKTTLLSA  103



>gb|AAG50724.1|AC079041_17 ABC transporter, putative [Arabidopsis thaliana]
Length=646

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 72/112 (64%), Gaps = 7/112 (6%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPD---KPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC   +  +D     Q      D   K  LA+P  T +Q  LQ ++YPI LK  E+VY
Sbjct  2    PQNCIAPRPEEDGGVMVQGLPDMSDTQSKSVLAFPTIT-SQPGLQMSMYPITLK--EVVY  58

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KV  E + S C G   ++EKTILNG+TGMVCPGE LAMLGPSGSGKTTLL+A
Sbjct  59   KVKIE-QTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTLLSA  109



>ref|XP_010324496.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum lycopersicum]
Length=639

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +FEEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTA
Sbjct  27   EFEEIVYKISQENKGMCCGGSSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTA  85



>ref|XP_006430907.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
 gb|ESR44147.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
Length=637

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSS--AREKTIL  385
            +KP LA  +Q  +Q     Q  L PI LKFE++VYKV  E     CTG  +  A+EKTIL
Sbjct  7    NKPALAVAVQPKSQLAGLHQLILSPITLKFEDVVYKVKLEQPIGFCTGTGTWGAKEKTIL  66

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             G+TGMVCPGE+LAMLGPSGSGKTTLL+A
Sbjct  67   KGITGMVCPGELLAMLGPSGSGKTTLLSA  95



>ref|XP_003612480.1| ABC transporter-like protein [Medicago truncatula]
Length=652

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 70/119 (59%), Gaps = 24/119 (20%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP  + +APKPE  +    ++ +     P  +             N QS  +  +YPI L
Sbjct  1    MPQ-NCIAPKPEYFNSTLSLEGSPHMTDPHSS------------NNEQSLPKLIMYPITL  47

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFE++VYKV           K + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  48   KFEDLVYKV-----------KVNQKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTA  95



>gb|KDO72270.1| hypothetical protein CISIN_1g039221mg [Citrus sinensis]
Length=637

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSA--REKTIL  385
            +KP LA  +Q  +Q     Q  L PI LKFE++VYKV  E     CTG  +   +EKTIL
Sbjct  7    NKPALAVAVQPKSQLAGLHQLILSPITLKFEDVVYKVKLEQPIGFCTGTGTWGDKEKTIL  66

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             G+TGMVCPGE+LAMLGPSGSGKTTLL+A
Sbjct  67   KGITGMVCPGELLAMLGPSGSGKTTLLSA  95



>ref|XP_006482405.1| PREDICTED: ABC transporter G family member 14-like [Citrus sinensis]
Length=637

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSA--REKTIL  385
            +KP LA  +Q  +Q     Q  L PI LKFE++VYKV  E     CTG  +   +EKTIL
Sbjct  7    NKPALAVAVQPKSQLAGLHQLILSPITLKFEDVVYKVKLEQPIGFCTGTGTWGDKEKTIL  66

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             G+TGMVCPGE+LAMLGPSGSGKTTLL+A
Sbjct  67   KGITGMVCPGELLAMLGPSGSGKTTLLSA  95



>gb|AES95438.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=638

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 23/113 (20%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIV  313
            +APKPE  +    ++ +     P  +             N QS  +  +YPI LKFE++V
Sbjct  6    IAPKPEYFNSTLSLEGSPHMTDPHSS------------NNEQSLPKLIMYPITLKFEDLV  53

Query  314  YKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            YKV           K + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  54   YKV-----------KVNQKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTA  95



>ref|XP_009397435.1| PREDICTED: ABC transporter G family member 14 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 54/68 (79%), Gaps = 5/68 (7%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKV--GGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGS  448
            A++PI LKFEE+VYKV  GG   G      SS  EKTILNG+TG+VCPGE+LAMLGPSGS
Sbjct  44   AVFPITLKFEEVVYKVKVGG---GGWWRRSSSPAEKTILNGITGVVCPGEMLAMLGPSGS  100

Query  449  GKTTLLTA  472
            GKTTLLTA
Sbjct  101  GKTTLLTA  108



>ref|XP_003520157.2| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=680

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 13/111 (12%)
 Frame = +2

Query  143  KPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKV  322
            KP   S D   ++++  +Q A +AP              S LQ++L P+ LKFE++ Y +
Sbjct  39   KPTFTSNDIHNNNSSQHHQAAPSAP------------RFSVLQQSLRPVTLKFEDVSYSI  86

Query  323  G-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
              G DK  C + +     KT+LNGVTGMV P E++AMLGPSGSGKTTLLTA
Sbjct  87   TFGRDKNGCVSSQKPKHTKTVLNGVTGMVGPREVMAMLGPSGSGKTTLLTA  137



>ref|XP_009384518.1| PREDICTED: ABC transporter G family member 14-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 65/109 (60%), Gaps = 14/109 (13%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P    PD         N+P     +   +AYP Q         A+ PI LKFEE+VYKV 
Sbjct  3    PRETEPD---SGGGHANRPIG---NSTVVAYPSQAA-------AVLPITLKFEEVVYKVK  49

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
               KG   +  S A EKTIL+G+TG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  50   RGAKGWWPSSSSPA-EKTILDGITGVVCPGELLAMLGPSGSGKTTLLTA  97



>ref|XP_006573283.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=678

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 60/159 (38%), Positives = 78/159 (49%), Gaps = 40/159 (25%)
 Frame = +2

Query  44   LPPHSSTTKTPISITQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAAT-----------  190
            +PP   T     SIT         +PA   +  +PEN S       +AT           
Sbjct  2    MPPQQET-----SITSN-------IPA---ITNRPENSSAHAEPPGSATNDIKPTFTIND  46

Query  191  ----TNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTG  355
                T+Q    AP  P           S LQ++L P+ LKFE++ Y +  G D   C + 
Sbjct  47   IHNHTSQNHQVAPSAPRF---------SILQQSLRPVTLKFEDVSYSITFGRDNNGCVSP  97

Query  356  KSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +     +T+LNGVTGMV PGE++AMLGPSGSGKTTLLTA
Sbjct  98   QKPKHTRTVLNGVTGMVGPGEVMAMLGPSGSGKTTLLTA  136



>ref|XP_010676724.1| PREDICTED: ABC transporter G family member 14 [Beta vulgaris 
subsp. vulgaris]
Length=634

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/116 (45%), Positives = 64/116 (55%), Gaps = 33/116 (28%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFE  304
            ++ + PKPEN   +  + D  T  +P                         ++PI LKFE
Sbjct  3    INCIMPKPENQGCNNTLQDLPTMLEP-------------------------IFPITLKFE  37

Query  305  EIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            E+VYKV  ED           +EKTILNGV+GMV PGEILAMLGPSGSGKTTLL+A
Sbjct  38   EVVYKVKLED--------IKCKEKTILNGVSGMVFPGEILAMLGPSGSGKTTLLSA  85



>ref|XP_010066762.1| PREDICTED: ABC transporter G family member 21 [Eucalyptus grandis]
 gb|KCW64799.1| hypothetical protein EUGRSUZ_G02369 [Eucalyptus grandis]
Length=679

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            SFL+R+LYPI LKFE++ Y +    ++ SCC        + +LNGVTGM  PGE+LAMLG
Sbjct  59   SFLRRSLYPITLKFEDVGYNIKLRTNRNSCCAPNEPKLTRNVLNGVTGMARPGELLAMLG  118

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  119  PSGSGKTTLLTA  130



>gb|KDP27020.1| hypothetical protein JCGZ_20955 [Jatropha curcas]
Length=568

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            + L++A  P+ LKFE++VYKV    KG C  G     EK IL G+TG V PGE+LAMLGP
Sbjct  18   TILKKANSPVTLKFEDVVYKVEPTKKGLCQKGIIKKEEKVILKGITGFVLPGEMLAMLGP  77

Query  440  SGSGKTTLLTA  472
            SG GKTTLLTA
Sbjct  78   SGCGKTTLLTA  88



>gb|EPS63929.1| hypothetical protein M569_10851 [Genlisea aurea]
Length=634

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 68/114 (60%), Gaps = 19/114 (17%)
 Frame = +2

Query  131  SVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            SVAPKP   S +          QP D  P     A+   T + S +QR L+P+ LKFE+I
Sbjct  5    SVAPKPGPGSSE------TGAVQP-DELP-----AFTALTGSNSIVQRTLFPVTLKFEDI  52

Query  311  VYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
              KVG +         S  ++KTILNG+TG V PGE+LAMLGPSGSGKTTLLTA
Sbjct  53   GCKVGSKSD-------SVLKQKTILNGITGTVSPGEVLAMLGPSGSGKTTLLTA  99



>ref|XP_007153314.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
 gb|ESW25308.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
Length=671

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+++L P+ LKFE++ Y +  G +K  C + +     +T+LNGV+GMV PGE++AMLG
Sbjct  58   SVLRQSLRPVTLKFEDVSYSITFGREKNGCVSSQKPKHTRTVLNGVSGMVGPGEVMAMLG  117

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  118  PSGSGKTTLLTA  129



>ref|XP_002524381.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37992.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=709

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 70/121 (58%), Gaps = 14/121 (12%)
 Frame = +2

Query  152  NCSPDQRMDDAATTNQPADAAPD------KPC-LAYPL-----QTNTQ-SFLQRALYPIV  292
            NC P+    +  T   P  A P        PC   + L     QT ++ S L+ +L PI 
Sbjct  40   NCPPNHIALNNWTETVPVYAEPSVSSINLNPCSQEHQLPDEEEQTQSRFSILRESLRPIT  99

Query  293  LKFEEIVYKVGGEDKGS-CCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
            LKFE++ Y V     GS CC+      ++T+LNGV+G+V PGE+LAMLGPSGSGKTTLLT
Sbjct  100  LKFEDVEYSVNFSTNGSSCCSRNEPKSKRTVLNGVSGIVRPGELLAMLGPSGSGKTTLLT  159

Query  470  A  472
            A
Sbjct  160  A  160



>ref|XP_010265331.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=666

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +2

Query  200  PADAAPDKPCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGK  358
            PA ++   PCL   +    +      S L+R+L P+ LKFE++VY +   +  G C +  
Sbjct  22   PALSSNVSPCLEDRMAEQLKARMGECSILRRSLRPVTLKFEDVVYSIKLKKSDGYCFSSP  81

Query  359  SSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
                E+TILNGVTG+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  82   DPKPERTILNGVTGIVRPGELLAMLGPSGSGKTTLLTA  119



>gb|KEH19433.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=635

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            LQ        +   P+ LKF ++VYK+    K      K+   EK ILNGVTGMV PGEI
Sbjct  20   LQKEASKIFHKRNPPVTLKFHDVVYKINKTKKWKLLERKTKVEEKVILNGVTGMVRPGEI  79

Query  422  LAMLGPSGSGKTTLLTA  472
            LA+LGPSGSGKTTLLTA
Sbjct  80   LAILGPSGSGKTTLLTA  96



>ref|XP_004297158.1| PREDICTED: ABC transporter G family member 21 [Fragaria vesca 
subsp. vesca]
Length=694

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/144 (37%), Positives = 84/144 (58%), Gaps = 19/144 (13%)
 Frame = +2

Query  47   PPHSSTTKTPISITQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKP  226
            PP+ S+  + +S ++ +         +H+  P P + +  QR+          D  P++P
Sbjct  17   PPNKSSMLSNVSRSENY-----QTGWVHA-EPSPGSINGSQRL--------APDDMPEQP  62

Query  227  CLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE-KTILNGVTG  400
               +P   +  S L+ +L P+ LKFE++ Y +  E  KGSC +  +  ++ + +LNGV+G
Sbjct  63   ---HPGTPHRASVLRESLRPVTLKFEDVTYSIKLEPTKGSCVSSYNEPKQTRNLLNGVSG  119

Query  401  MVCPGEILAMLGPSGSGKTTLLTA  472
            +V PGE+LAMLGPSGSGKTTLLTA
Sbjct  120  IVRPGELLAMLGPSGSGKTTLLTA  143



>ref|XP_010918656.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=648

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 6/65 (9%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKT  457
            ++P++LKFEE+VYKV          G +   EKTILNG++G+VCPGEILAMLGPSGSGKT
Sbjct  41   VFPVILKFEEVVYKV------KVGGGGAGLAEKTILNGISGVVCPGEILAMLGPSGSGKT  94

Query  458  TLLTA  472
            TLLTA
Sbjct  95   TLLTA  99



>emb|CDP05875.1| unnamed protein product [Coffea canephora]
Length=629

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 9/103 (9%)
 Frame = +2

Query  164  DQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGS  343
            +Q M D         A   K C A        +  ++A  P+ LKFE++VYK+  + +G 
Sbjct  2    EQEMADVEAPQPNGSAGQQKSCAA--------AIFEKANRPVTLKFEDVVYKIKVKKEG-  52

Query  344  CCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
                 + + EKTIL G++GMV PGE+LAMLGPSGSGKTTLLTA
Sbjct  53   WFKKSTESEEKTILKGISGMVLPGEMLAMLGPSGSGKTTLLTA  95



>ref|XP_010910172.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=668

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +2

Query  209  AAPDKPC----LAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG-GEDK--GSCCTGKSSA  367
            A PD+P      ++P       +   AL P+ L+FEE+ YKV  G+     SC    ++A
Sbjct  11   AVPDEPAAVDATSHP-NPRPLPWATTALSPVTLRFEEVAYKVKLGQPMWWSSCHGSAAAA  69

Query  368  REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             EK ILNG+TGMV PGEILAMLGPSGSGKTTLLTA
Sbjct  70   AEKVILNGITGMVPPGEILAMLGPSGSGKTTLLTA  104



>ref|XP_011098341.1| PREDICTED: ABC transporter G family member 9 [Sesamum indicum]
Length=619

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  254  TQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            + +  ++A  P+ LKFE++VYK+  E  G      + ++EK IL G++GMV PGE+LAML
Sbjct  16   SPAIFKKANLPVTLKFEDVVYKIKTEQSGKFFKKTAKSQEKLILKGISGMVLPGEMLAML  75

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLT 
Sbjct  76   GPSGSGKTTLLTG  88



>ref|XP_004244204.1| PREDICTED: ABC transporter G family member 9 [Solanum lycopersicum]
Length=613

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q  + +  ++  +P+ LKF+ +VYK+  + +G   +   S  EK IL GVTG+V PGE+L
Sbjct  8    QLESAAIFKKTNFPVTLKFDNVVYKIKAKTEGMFKSSSKSQEEKIILKGVTGIVFPGEML  67

Query  425  AMLGPSGSGKTTLLTA  472
            AMLGPSGSGKTTLLT 
Sbjct  68   AMLGPSGSGKTTLLTG  83



>ref|XP_010910173.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=653

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +2

Query  209  AAPDKPC----LAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG-GEDK--GSCCTGKSSA  367
            A PD+P      ++P       +   AL P+ L+FEE+ YKV  G+     SC    ++A
Sbjct  11   AVPDEPAAVDATSHP-NPRPLPWATTALSPVTLRFEEVAYKVKLGQPMWWSSCHGSAAAA  69

Query  368  REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             EK ILNG+TGMV PGEILAMLGPSGSGKTTLLTA
Sbjct  70   AEKVILNGITGMVPPGEILAMLGPSGSGKTTLLTA  104



>gb|KDP27016.1| hypothetical protein JCGZ_20951 [Jatropha curcas]
Length=621

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  ++   P+ LKFE+++YKV    +G+ C       EK IL GVTG V PGE+LAMLGP
Sbjct  19   SIFEKTNRPLTLKFEDVIYKVVSNKRGTLCQKGLKQEEKMILKGVTGTVLPGEMLAMLGP  78

Query  440  SGSGKTTLLTA  472
            SGSGKTTLLTA
Sbjct  79   SGSGKTTLLTA  89



>ref|XP_008237669.1| PREDICTED: ABC transporter G family member 9-like [Prunus mume]
Length=614

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 9/87 (10%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQS--FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNG  391
            +K  L   +QT T++    + A+ P+ LKFE+++YK+   +        +   EK ILNG
Sbjct  2    EKEMLDIEIQTATEAPAIFKEAIRPVTLKFEDVIYKIKQNNS-------TKNEEKVILNG  54

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ++G+V PGEILAMLGPSGSGKTTLLTA
Sbjct  55   ISGLVQPGEILAMLGPSGSGKTTLLTA  81



>ref|XP_007199008.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
 gb|EMJ00207.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
Length=614

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 9/87 (10%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNG  391
            +K  L   +QT T+  +  + A+ P+ LKFE++VYK+   +        +   EK ILNG
Sbjct  2    EKEMLDIDIQTATEAPTIFKEAIRPVTLKFEDVVYKIKQNNS-------TKNEEKVILNG  54

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTA  472
            V+G+V PGEILAMLGPSGSGKTTL+TA
Sbjct  55   VSGLVQPGEILAMLGPSGSGKTTLITA  81



>ref|XP_006286036.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
 gb|EOA18934.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
Length=638

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 53/91 (58%), Gaps = 7/91 (8%)
 Frame = +2

Query  200  PADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKT  379
            P D   D   L +       S  ++A  P+ LKFE +VY V  ED   C        E+T
Sbjct  13   PIDKTNDDRSLPF-------SIFKKANNPVTLKFENLVYTVKLEDPNGCFRTNHKTEERT  65

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            IL G+TG V PGEILAMLGPSGSGKT+LLTA
Sbjct  66   ILKGLTGFVKPGEILAMLGPSGSGKTSLLTA  96



>ref|XP_002533914.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF28469.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=632

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 10/81 (12%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKG--SC--------CTGKSSAREKTILNGVTGMVC  409
            S  ++A  P+ LKF+E+VYKVG +     SC        C       EK IL G+TGMV 
Sbjct  18   SIFKKANRPVTLKFDEVVYKVGLQKPSGWSCQKGMKVVSCQNGIKGDEKVILKGITGMVF  77

Query  410  PGEILAMLGPSGSGKTTLLTA  472
            PGE+LAMLGPSGSGKTTLLTA
Sbjct  78   PGEMLAMLGPSGSGKTTLLTA  98



>ref|XP_008389336.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
 ref|XP_008367026.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
Length=683

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 55/151 (36%), Positives = 78/151 (52%), Gaps = 26/151 (17%)
 Frame = +2

Query  41   PLPPHSSTTKTPISITQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPD  220
            PL   +S + TP +I             L ++    +NCS       ++ TN        
Sbjct  3    PLEQENSMSNTPPNIL------------LSNLNRPDQNCSVHAEPSASSRTNV-------  43

Query  221  KPCLA-----YPLQTNTQ-SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKT  379
             PCL       P  T+ + S L ++L+P+ LKFE++ Y +  +   G C         +T
Sbjct  44   SPCLGDDMADQPRPTSARASILHQSLHPVTLKFEDVGYSIKLQATNGGCVASHKXKPTRT  103

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +LNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  104  VLNGVSGIVLPGELLAMLGPSGSGKTTLLTA  134



>ref|XP_010918655.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=666

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 12/77 (16%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGSCCTG------------KSSAREKTILNGVTGMVCPGEI  421
            ++P++LKFEE+VYKV      S   G             +   EKTILNG++G+VCPGEI
Sbjct  41   VFPVILKFEEVVYKVKVGHHSSKSPGLFCCCCGGGGGGGAGLAEKTILNGISGVVCPGEI  100

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKTTLLTA
Sbjct  101  LAMLGPSGSGKTTLLTA  117



>ref|XP_006413078.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
 gb|ESQ54531.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
Length=640

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  ++A  PI LKFE +VY V   E K   C  K   +E+TIL G+TG+V PGEILAMLG
Sbjct  27   SNFKKANLPITLKFENVVYTVKVKEPKSWLCQTKGKTKERTILKGLTGIVKPGEILAMLG  86

Query  437  PSGSGKTTLLTA  472
            PSGSGKT+ LTA
Sbjct  87   PSGSGKTSFLTA  98



>ref|XP_008226675.1| PREDICTED: ABC transporter G family member 9 [Prunus mume]
Length=622

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 14/83 (17%)
 Frame = +2

Query  245  QTNTQS-------FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGM  403
            QTNT S         ++A+ P+ LKFE++VYK+  +         +   E+ ILNGV+G+
Sbjct  13   QTNTTSDTVEAPAIFKKAIRPVTLKFEDVVYKIKPKKS-------TKNEERVILNGVSGL  65

Query  404  VCPGEILAMLGPSGSGKTTLLTA  472
            V PGEILAMLGPSGSGKTTLLTA
Sbjct  66   VQPGEILAMLGPSGSGKTTLLTA  88



>ref|XP_007225163.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
 gb|EMJ26362.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
Length=683

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +2

Query  161  PDQRMDDAATTNQPADAAPDKPCLAYPL-----QTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PDQ     A  + P  +  + PCL   +      ++  S L+++L P+ LKFE++ Y + 
Sbjct  25   PDQNGSVHAERSTPPSSNVN-PCLGDDMPADRPTSHRTSILRQSLRPVTLKFEDVTYSIK  83

Query  326  GED-KGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             +  +G C       + +TILNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  84   LQTTRGGCVASHEPKQTRTILNGVSGIVRPGELLAMLGPSGSGKTTLLTA  133



>ref|XP_010943389.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=661

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 10/102 (10%)
 Frame = +2

Query  197  QPADAAPDKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGS--------C  346
             P   A +   +AYP   +    + L  A++P++LKFEE+ YKV     GS         
Sbjct  12   HPNGPAANPTVVAYPTPHSYPCCTLLATAVFPVLLKFEEVEYKVKVSHHGSKGPGLCCCG  71

Query  347  CTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
              G     EKTIL G+TG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  72   RGGGGGQAEKTILKGITGVVCPGEMLAMLGPSGSGKTTLLTA  113



>ref|XP_008451875.1| PREDICTED: ABC transporter G family member 14 [Cucumis melo]
Length=655

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 54/109 (50%), Positives = 63/109 (58%), Gaps = 19/109 (17%)
 Frame = +2

Query  203  ADAAPDKPCLAYPLQTNTQS-----------FLQRALYPIVLKFEEIVYKVGGEDKGSCC  349
            +D A +   LAYP   ++ +             Q  L  + LKFEEIVYKV  E KG  C
Sbjct  2    SDVAQNDAVLAYPFHVDSHNTRANNNNSNNNLHQLPLLTVTLKFEEIVYKVKLEGKGGSC  61

Query  350  TGKSS--------AREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             G            REKTILNG++G+V PGEILAMLGPSGSGKTTLLTA
Sbjct  62   WGGGGGSSWGAAATREKTILNGLSGVVFPGEILAMLGPSGSGKTTLLTA  110



>ref|XP_009395262.1| PREDICTED: ABC transporter G family member 9-like [Musa acuminata 
subsp. malaccensis]
Length=622

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +2

Query  257  QSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            QS   +A  PI LKFE++VYK+  ++K     GK   RE+ ILNG++G V PGE++AMLG
Sbjct  20   QSIFAKAHRPIDLKFEDVVYKIKTKEKRGENKGKQ--RERVILNGISGTVYPGEMMAMLG  77

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLT 
Sbjct  78   PSGSGKTTLLTV  89



>ref|XP_010502440.1| PREDICTED: ABC transporter G family member 21-like isoform X2 
[Camelina sativa]
Length=468

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  111  LLAMLGPSGSGKTTLVTA  128



>ref|XP_008243143.1| PREDICTED: ABC transporter G family member 21 [Prunus mume]
Length=683

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +2

Query  206  DAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTI  382
            D   D+P       ++  S L+R+L P+ LKFE++ Y +  +  KG         + +TI
Sbjct  50   DMPADRPT------SHRSSILRRSLRPVTLKFEDVTYSIKLQTTKGGWVASHEPKQTRTI  103

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  104  LNGVSGIVRPGELLAMLGPSGSGKTTLLTA  133



>ref|XP_010425210.1| PREDICTED: ABC transporter G family member 21 isoform X2 [Camelina 
sativa]
Length=468

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  111  LLAMLGPSGSGKTTLVTA  128



>ref|XP_004293103.1| PREDICTED: ABC transporter G family member 9 [Fragaria vesca 
subsp. vesca]
Length=633

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCC---TGKSSAREKTILNGVTGMVCP  412
            +   + +  ++A+ P+ LKFE++ Y +  E  G        K+S  EK ILNG++G+V P
Sbjct  16   IDEESPAIFKKAIRPVTLKFEDVAYTIKAETDGMSWLRKKDKNSDSEKHILNGISGVVKP  75

Query  413  GEILAMLGPSGSGKTTLLTA  472
            GEILAMLGPSGSGKTTLLTA
Sbjct  76   GEILAMLGPSGSGKTTLLTA  95



>ref|XP_008339724.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +2

Query  224  PCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTI  382
            PCL   +    Q      S L+++L P+ LKFE++ Y +  +  KG C     +   +T+
Sbjct  45   PCLGDDMTDQPQPTSHRASILRQSLRPVTLKFEDVGYSIKLQTPKGGCVXSHEATPTRTV  104

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  105  LNGVSGIVRPGELLAMLGPSGSGKTTLLTA  134



>ref|XP_008361741.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +2

Query  224  PCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTI  382
            PCL   +    Q      S L+++L P+ LKFE++ Y +  +  KG C     +   +T+
Sbjct  45   PCLGDDMTDQPQPTSHRASILRQSLRPVTLKFEDVGYSIKLQTPKGGCVXSHEATPTRTV  104

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  105  LNGVSGIVRPGELLAMLGPSGSGKTTLLTA  134



>emb|CAN77762.1| hypothetical protein VITISV_026760 [Vitis vinifera]
Length=315

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 55/88 (63%), Gaps = 17/88 (19%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK---GSCCT------GKSSAR--------EKTILN  388
            +FL  + YPI LKF +I Y+V  E K   G  C        KSS R        EKTILN
Sbjct  29   NFLMASCYPISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILN  88

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            GVTGM CPGEILA+LGPSGSGK+TLL A
Sbjct  89   GVTGMACPGEILAVLGPSGSGKSTLLNA  116



>gb|AIU41651.1| ABC transporter family protein [Hevea brasiliensis]
Length=680

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S L+ +L P+ L F ++ Y +    KGSCC+   S   + +LNGV+G+V PGE++AMLGP
Sbjct  61   SILRASLRPVTLMFVDVAYSIDLSTKGSCCSPNGSKSTRIVLNGVSGIVRPGELVAMLGP  120

Query  440  SGSGKTTLLTA  472
            SGSGKTTLLTA
Sbjct  121  SGSGKTTLLTA  131



>ref|XP_004147769.1| PREDICTED: ABC transporter G family member 14-like [Cucumis sativus]
 gb|KGN53471.1| hypothetical protein Csa_4G056620 [Cucumis sativus]
Length=655

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 56/109 (51%), Positives = 62/109 (57%), Gaps = 19/109 (17%)
 Frame = +2

Query  203  ADAAPDKPCLAYPLQT---NTQSFL--------QRALYPIVLKFEEIVYKVGGEDKGSCC  349
            +D A +    AYP      NTQ           Q  L  + LKFEEIVYKV  E KG  C
Sbjct  2    SDVAQNDAVFAYPFHVDSHNTQDNNNNNNNNLHQLPLLTVTLKFEEIVYKVKLEGKGGSC  61

Query  350  TGKSSA--------REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             G            REKTILNG++G+V PGEILAMLGPSGSGKTTLLTA
Sbjct  62   WGGGGGSSWGAAANREKTILNGLSGVVFPGEILAMLGPSGSGKTTLLTA  110



>ref|XP_009768130.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=674

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+ +L P+ LKFE++ Y +  E +KG C +     + + +L GVTG+V PGEILAMLG
Sbjct  60   SVLRESLRPVTLKFEDVSYTIKLESNKGGCFSSTQQKQTRMLLQGVTGIVKPGEILAMLG  119

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  120  PSGSGKTTLLTA  131



>ref|XP_009792869.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=616

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q  T +  ++   P+ LKFE +VYK+  + +G   +      EK IL G+TG+V PGE+L
Sbjct  12   QLETAAIFKKTNLPVTLKFENVVYKIKPKKEGLFNSSSKPEEEKIILKGITGIVFPGEML  71

Query  425  AMLGPSGSGKTTLLTA  472
            AMLGPSGSGKTTLLT 
Sbjct  72   AMLGPSGSGKTTLLTG  87



>ref|XP_007214012.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
 gb|EMJ15211.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
Length=622

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 14/83 (17%)
 Frame = +2

Query  245  QTNTQS-------FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGM  403
            QTNT S         ++A+ P+ LKFE++VYK+  + K S         E+ ILNGV+G+
Sbjct  13   QTNTTSDTVEAPAIFKKAIRPVTLKFEDVVYKI--KPKKSI-----KNEERVILNGVSGL  65

Query  404  VCPGEILAMLGPSGSGKTTLLTA  472
            V PGEILAMLGPSGSGKTTLLTA
Sbjct  66   VQPGEILAMLGPSGSGKTTLLTA  88



>ref|XP_009336649.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = +2

Query  149  ENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGG  328
            +NCS       ++ TN       D P    P  ++  S L ++L PI LKFE++ Y +  
Sbjct  27   QNCSVQPEPSASSRTNVSPCLGDDMPGQPRP-TSHRASILHQSLRPITLKFEDVGYSIKL  85

Query  329  E-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +   G C         +T+LNGV+G+  PGE+LAMLGPSGSGKTT LTA
Sbjct  86   QATNGGCVASHKPKPTRTVLNGVSGIALPGELLAMLGPSGSGKTTFLTA  134



>ref|XP_009356025.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +2

Query  224  PCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTI  382
            PCL   +    Q      S L ++L P+ LKFE++ Y +  +  KG C         +T+
Sbjct  45   PCLGDDMTDQPQPTSHRASILHQSLRPVTLKFEDVGYSIKLQTAKGGCVASHEPKPTRTV  104

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  105  LNGVSGIVRPGELLAMLGPSGSGKTTLLTA  134



>ref|XP_010648137.1| PREDICTED: ABC transporter G family member 21 [Vitis vinifera]
 emb|CBI27088.3| unnamed protein product [Vitis vinifera]
Length=676

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 66/116 (57%), Gaps = 8/116 (7%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ------SFLQRALYPIVLKFEE  307
            P N     R+++  T +    A+   PCL        Q      S L+ +L P+ LKFE+
Sbjct  14   PANVLGANRIENV-TIHAAEPASNVSPCLEDQTPDGQQTTRPQFSILRESLRPVTLKFED  72

Query  308  IVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +VY +     +GSC       + +T+LNGV+G+  PGE+LAMLGPSGSGKTTLLTA
Sbjct  73   VVYVIKLRSTEGSCFGSPEPKQSRTVLNGVSGIARPGELLAMLGPSGSGKTTLLTA  128



>ref|XP_010943390.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=660

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 50/73 (68%), Gaps = 8/73 (11%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGS--------CCTGKSSAREKTILNGVTGMVCPGEILAML  433
            ++P+VLKFEE+ YKV     GS           G     EKTIL G+TG+VCPGE+LAML
Sbjct  40   VFPVVLKFEEVEYKVKVSHHGSKGPGLCCCGRGGGGGQAEKTILKGITGVVCPGEMLAML  99

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  100  GPSGSGKTTLLTA  112



>ref|XP_010668407.1| PREDICTED: ABC transporter G family member 21-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=344

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 73/129 (57%), Gaps = 18/129 (14%)
 Frame = +2

Query  140  PKPENCSPDQRMDDAATTNQPADAAPDKPCLAY----PLQTNTQSFLQRA----------  277
            P   + SP  ++ +AA TN    +   +P L+     P   + + F Q++          
Sbjct  8    PTSNSSSPSIKIHNAANTNPEEFSVHMEPSLSNRAISPCLEDLEPFHQQSVPPQFSTLHG  67

Query  278  -LYPIVLKFEEIVYKVGGE--DKGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSG  445
             L PI+LKFE++ Y +      + +CC G +S +  + IL+GVTG+V  GE+LAMLGPSG
Sbjct  68   SLRPIILKFEDVTYNITLHPTQESACCLGNTSPKLNRVILDGVTGIVRSGELLAMLGPSG  127

Query  446  SGKTTLLTA  472
            SGKTTLLTA
Sbjct  128  SGKTTLLTA  136



>ref|XP_008389338.1| PREDICTED: ABC transporter G family member 21-like isoform X3 
[Malus domestica]
 ref|XP_008367028.1| PREDICTED: ABC transporter G family member 21-like isoform X3 
[Malus domestica]
Length=471

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L ++L+P+ LKFE++ Y +  +   G C         +T+LNGV+G+V PGE+LAMLG
Sbjct  63   SILHQSLHPVTLKFEDVGYSIKLQATNGGCVASHKXKPTRTVLNGVSGIVLPGELLAMLG  122

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  123  PSGSGKTTLLTA  134



>emb|CAB43874.1| putative protei [Arabidopsis thaliana]
 emb|CAB81392.1| putative protein [Arabidopsis thaliana]
Length=635

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  ++A  P+ LKFE +VY V  +D   C        E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKANNPVTLKFENLVYTVKLKDSQGCFGKNDKTEERTILKGLTGIVKPGEILAMLGP  85

Query  440  SGSGKTTLLTA  472
            SGSGKT+LLTA
Sbjct  86   SGSGKTSLLTA  96



>ref|XP_008389337.1| PREDICTED: ABC transporter G family member 21-like isoform X2 
[Malus domestica]
 ref|XP_008367027.1| PREDICTED: ABC transporter G family member 21-like isoform X2 
[Malus domestica]
Length=478

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L ++L+P+ LKFE++ Y +  +   G C         +T+LNGV+G+V PGE+LAMLG
Sbjct  63   SILHQSLHPVTLKFEDVGYSIKLQATNGGCVASHKXKPTRTVLNGVSGIVLPGELLAMLG  122

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  123  PSGSGKTTLLTA  134



>ref|NP_194472.3| ABC transporter G family member 9 [Arabidopsis thaliana]
 sp|Q9SZR9.2|AB9G_ARATH RecName: Full=ABC transporter G family member 9; Short=ABC transporter 
ABCG.9; Short=AtABCG9; AltName: Full=Probable white-brown 
complex homolog protein 9; Short=AtWBC9 [Arabidopsis 
thaliana]
 gb|AEE85338.1| ABC transporter G family member 9 [Arabidopsis thaliana]
Length=638

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  ++A  P+ LKFE +VY V  +D   C        E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKANNPVTLKFENLVYTVKLKDSQGCFGKNDKTEERTILKGLTGIVKPGEILAMLGP  85

Query  440  SGSGKTTLLTA  472
            SGSGKT+LLTA
Sbjct  86   SGSGKTSLLTA  96



>ref|XP_010502439.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Camelina sativa]
Length=672

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  111  LLAMLGPSGSGKTTLVTA  128



>ref|XP_009766511.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=637

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q+ + +  +++  P+ LKFE +VYK+    +G C     S  EK IL GV+G+V PGE+L
Sbjct  25   QSKSSAIFRKSNRPVTLKFENVVYKIKLVKEG-CINSSKSVEEKIILKGVSGIVSPGEML  83

Query  425  AMLGPSGSGKTTLLTA  472
            A+LGPSGSGKTTLLT 
Sbjct  84   AILGPSGSGKTTLLTG  99



>ref|XP_010514180.1| PREDICTED: ABC transporter G family member 21-like [Camelina 
sativa]
Length=673

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  52   QSRQSSVLRQSLRPITLKFEELAYSIKSQTEKGSYWFGSQEPKLNRLILNGVSGIVKPGE  111

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  112  LLAMLGPSGSGKTTLVTA  129



>ref|XP_010425209.1| PREDICTED: ABC transporter G family member 21 isoform X1 [Camelina 
sativa]
Length=672

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  111  LLAMLGPSGSGKTTLVTA  128



>ref|XP_009586692.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
tomentosiformis]
Length=675

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+ +L P+ LKFE++ Y +  E +KG C +     + + +L GVTG+V PGEILAMLG
Sbjct  57   SVLRESLRPVTLKFEDVSYTIKLERNKGGCFSSTQQKQTRMLLQGVTGIVKPGEILAMLG  116

Query  437  PSGSGKTTLLTA  472
            PSG GKTTLLTA
Sbjct  117  PSGCGKTTLLTA  128



>ref|XP_006395639.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
 gb|ESQ32925.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
Length=670

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    +  + +LNGV+G+V PGE
Sbjct  50   QSRQSSVLRQSLRPIILKFEELTYSIKSQTGKGSYWFGSQEPKPNRLVLNGVSGIVKPGE  109

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  110  LLAMLGPSGSGKTTLVTA  127



>ref|XP_010262410.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=685

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 24/122 (20%)
 Frame = +2

Query  116  MPALHS-VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            +PAL S V+P  E+  P+Q             AA    C          S L+ +L PI 
Sbjct  38   LPALSSNVSPSLEDQMPEQ-----------LQAAMGGQC----------SLLRGSLRPIT  76

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAR--EKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            LKFE++ Y +  +  G C       +  E+TILNGVTG+V PG++LAMLGPSGSGKTTLL
Sbjct  77   LKFEDVSYSIKIKKSGGCWFSAPEPKPSERTILNGVTGVVQPGDLLAMLGPSGSGKTTLL  136

Query  467  TA  472
            TA
Sbjct  137  TA  138



>ref|XP_011077437.1| PREDICTED: ABC transporter G family member 21 [Sesamum indicum]
Length=672

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK-GSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+ +L P+ LKFE++ Y +  +++ G CC+       + ILN V+G V PGE+LAMLG
Sbjct  53   SVLRESLRPVTLKFEDVSYTIKLQNRRGGCCSSSEPKLTRNILNSVSGTVRPGELLAMLG  112

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  113  PSGSGKTTLLTA  124



>ref|XP_010556399.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=685

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSARE-KTILNGVTGMVCPGE  418
            Q    S L+R+L P++LKFE++ Y +     KGS   G    +  + ILNGVTG+V PGE
Sbjct  58   QLRKSSVLRRSLRPVILKFEDLTYSINLRTGKGSFWFGSHEPKSTRLILNGVTGIVKPGE  117

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTLLTA
Sbjct  118  LLAMLGPSGSGKTTLLTA  135



>ref|XP_009129040.1| PREDICTED: ABC transporter G family member 21-like [Brassica 
rapa]
Length=669

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +2

Query  224  PCL---AYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSARE-KTILN  388
            PCL       Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    ++ + ILN
Sbjct  38   PCLDDDGPSHQSCQSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGSQEPKQNRLILN  97

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            GV+G+V PGE+LAMLGPSGSGKTTL+TA
Sbjct  98   GVSGIVKPGELLAMLGPSGSGKTTLVTA  125



>ref|XP_009607601.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
tomentosiformis]
Length=631

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q+ + +  +++  P+ LKFE +VYK+    +G C     S  EK IL GV+G+V PGE+L
Sbjct  19   QSKSAAIFKKSNRPVTLKFENVVYKIKLVKEG-CIKSSKSEEEKIILKGVSGIVSPGEML  77

Query  425  AMLGPSGSGKTTLLTA  472
            A+LGPSGSGKTTLLT 
Sbjct  78   AILGPSGSGKTTLLTG  93



>emb|CDY46506.1| BnaA02g27560D [Brassica napus]
Length=668

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +2

Query  224  PCL---AYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSARE-KTILN  388
            PCL       Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    ++ + ILN
Sbjct  37   PCLDDDGPSHQSCQSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGSQEPKQNRLILN  96

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            GV+G+V PGE+LAMLGPSGSGKTTL+TA
Sbjct  97   GVSGIVKPGELLAMLGPSGSGKTTLVTA  124



>ref|XP_009139468.1| PREDICTED: ABC transporter G family member 27 [Brassica rapa]
Length=735

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 60/121 (50%), Gaps = 24/121 (20%)
 Frame = +2

Query  110  LAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPI  289
             A+P    + P   +CS D  ++D           P++P                  +PI
Sbjct  99   FAVPHEEEIIPSERSCSNDDNLEDIEAATSSVVKLPEEPT-----------------FPI  141

Query  290  VLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
             LKF +I YKV        C   +S+ EK+ILNG++G   PGE+LA++GPSGSGKTTLL 
Sbjct  142  YLKFIDITYKV-------TCKAMTSSSEKSILNGISGSAYPGELLALMGPSGSGKTTLLN  194

Query  470  A  472
             
Sbjct  195  V  195



>gb|KDO70136.1| hypothetical protein CISIN_1g005545mg [Citrus sinensis]
Length=691

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 66/128 (52%), Gaps = 16/128 (13%)
 Frame = +2

Query  137  APKPENCSPDQRMDDAATTNQPADAAPD-KPC---------LAYPLQTNTQSFLQRALYP  286
             P   N     R D      QP+ +A +  PC         +  P      S L+ +L+P
Sbjct  18   GPPAANTILSNRTDTVLVHAQPSVSANNVSPCSDDDGISVQIQEPPLVIRFSILRESLHP  77

Query  287  IVLKFEEIVYKVG-GEDKGSCCTG-----KSSAREKTILNGVTGMVCPGEILAMLGPSGS  448
            + LKFE++ Y +     KGSC            R  ++LNGV+GMV PGE+LAMLGPSGS
Sbjct  78   VTLKFEDVAYSINLHTSKGSCFATSHGEPNKQTRTVSVLNGVSGMVKPGELLAMLGPSGS  137

Query  449  GKTTLLTA  472
            GKTTLLTA
Sbjct  138  GKTTLLTA  145



>ref|XP_008805673.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=666

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 28/86 (33%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAR--------------------EKTILNGV  394
             ++P++LKFEE+VYKV          G+ S++                    EK ILNG+
Sbjct  40   VVFPVILKFEEVVYKVK--------VGRHSSKGPGLCCCCGRGGGGGGGGPAEKMILNGI  91

Query  395  TGMVCPGEILAMLGPSGSGKTTLLTA  472
            TG+VCPGEILAMLGPSGSGKTTLLTA
Sbjct  92   TGVVCPGEILAMLGPSGSGKTTLLTA  117



>ref|XP_006484387.1| PREDICTED: ABC transporter G family member 21-like [Citrus sinensis]
Length=691

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 6/77 (8%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTG-----KSSAREKTILNGVTGMVCPGEI  421
            S L+ +L+P++L+FE++ Y +     KGSC            R  ++LNGV+GMV PGE+
Sbjct  69   SILRESLHPVMLQFEDVAYSINLHTSKGSCFAASHDEPNKQTRTVSVLNGVSGMVKPGEL  128

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKTTLLTA
Sbjct  129  LAMLGPSGSGKTTLLTA  145



>ref|XP_004972751.1| PREDICTED: ABC transporter G family member 14-like [Setaria italica]
Length=747

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 55/87 (63%), Gaps = 23/87 (26%)
 Frame = +2

Query  281  YPIVLKFEEIVYKV---------------------GGED--KGSCCTGKSSAREKTILNG  391
            +P+VLKFEE+VYKV                     GG D  K       SSAREKTI++G
Sbjct  92   FPLVLKFEEVVYKVKLGQPTAGWCDKLSAAASMAVGGGDGRKKKAAAPGSSAREKTIISG  151

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ++G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  152  MSGVVRPGEMLAMLGPSGSGKTTLLTA  178



>ref|XP_002876921.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53180.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    +  + ILNGV+G+V PGE
Sbjct  50   QSRQSSVLRQSLRPIILKFEELSYSIKSQTGKGSYWFGSQEPKPNRLILNGVSGIVKPGE  109

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  110  LLAMLGPSGSGKTTLVTA  127



>ref|XP_003591854.1| ABC transporter G family member [Medicago truncatula]
 gb|AES62105.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=665

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 63/117 (54%), Gaps = 6/117 (5%)
 Frame = +2

Query  140  PKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNT----QSFLQRALYPIVLKFEE  307
            P+ EN S     D +++         D   +  P    T     S L ++L P+ LKFE+
Sbjct  4    PETENSSIHGEPDGSSSNKVKPSLDIDHNAINIPSHPTTPLTSFSILPQSLRPVTLKFED  63

Query  308  IVYKVG--GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            + Y +    + K  C  GK S   + ILNGVTG+  PGE+ AMLGPSGSGKTTLLTA
Sbjct  64   VSYSITMTNQKKNGCVMGKESKVTRKILNGVTGVARPGELTAMLGPSGSGKTTLLTA  120



>ref|XP_006878615.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
 gb|ERM94760.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
Length=648

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q+   S L  AL P+ LKFE++ YKV    +G C   +    EKTIL G+TG+V PGEIL
Sbjct  30   QSGASSPLGLALCPVTLKFEDVGYKVK-LAQGECLPTRKLIVEKTILTGLTGIVSPGEIL  88

Query  425  AMLGPSGSGKTTLLTA  472
            AMLGPSGSGKTTLLTA
Sbjct  89   AMLGPSGSGKTTLLTA  104



>ref|XP_007046353.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY02185.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=684

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = +2

Query  224  PCLAYPLQTNTQ---------SFLQRALYPIVLKFEEIVYKVGGEDKGS-CCTGKSSARE  373
            PC   P+  + Q         S L+ +L P+ LKFEE+ Y +        C + +     
Sbjct  45   PCSQEPIPAHQQQEQQTPLRISVLRESLRPVTLKFEEVAYSIYSNTTARRCLSSQEPKPR  104

Query  374  KTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +++LNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  105  RSVLNGVSGVVRPGELLAMLGPSGSGKTTLLTA  137



>emb|CBI18157.3| unnamed protein product [Vitis vinifera]
Length=645

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 55/88 (63%), Gaps = 17/88 (19%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK---GSCCT------GKSSAR--------EKTILN  388
            +FL  + YPI LKF +I Y+V  E K   G  C        KSS R        EKTILN
Sbjct  32   NFLMASCYPISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILN  91

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            GVTGM CPGEILA+LGPSGSGK+TLL A
Sbjct  92   GVTGMACPGEILAVLGPSGSGKSTLLNA  119



>emb|CDP00551.1| unnamed protein product [Coffea canephora]
Length=678

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 9/101 (9%)
 Frame = +2

Query  173  MDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCT  352
            ++ A   NQ  D     P           S L+++L P+ LKFE++ Y +     G  C 
Sbjct  39   LNSATNVNQSPDENQTSPV--------RYSILRQSLRPVTLKFEDVAYTLSLRGTGGGCF  90

Query  353  GKSSAR-EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
              S  +  + ILNGV+G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  91   SSSHPKPTRAILNGVSGIVRPGELLAMLGPSGSGKTTLLTA  131



>ref|XP_002268373.1| PREDICTED: ABC transporter G family member 25 [Vitis vinifera]
Length=664

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 55/88 (63%), Gaps = 17/88 (19%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK---GSCCT------GKSSAR--------EKTILN  388
            +FL  + YPI LKF +I Y+V  E K   G  C        KSS R        EKTILN
Sbjct  32   NFLMASCYPISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILN  91

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            GVTGM CPGEILA+LGPSGSGK+TLL A
Sbjct  92   GVTGMACPGEILAVLGPSGSGKSTLLNA  119



>emb|CDX92829.1| BnaC07g40870D [Brassica napus]
Length=644

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A  PI LKFE +VY V   E K      K    +KTIL GV G+V PGEI
Sbjct  27   QTLPFSIFKKANLPITLKFENVVYTVKVKEPKSWLGQTKGKTEDKTILKGVNGIVKPGEI  86

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKT+LLTA
Sbjct  87   LAMLGPSGSGKTSLLTA  103



>ref|XP_004164431.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
14-like [Cucumis sativus]
Length=655

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 61/109 (56%), Gaps = 19/109 (17%)
 Frame = +2

Query  203  ADAAPDKPCLAYPLQT---NTQSFL--------QRALYPIVLKFEEIVYKVGGEDKGSCC  349
            +D A +    AYP      NTQ           Q  L  + LKFEEIVYKV  E KG  C
Sbjct  2    SDVAQNDAVFAYPFHVDSHNTQDNNNNNNNNLHQLPLLTVTLKFEEIVYKVKLEGKGGSC  61

Query  350  TGKSSA--------REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             G            REKTILNG++G+V PGEILAMLGPSGSG TTLLTA
Sbjct  62   WGGGGGSSWGAAANREKTILNGLSGVVFPGEILAMLGPSGSGXTTLLTA  110



>ref|XP_009593646.1| PREDICTED: ABC transporter G family member 21 [Nicotiana tomentosiformis]
Length=644

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 11/97 (11%)
 Frame = +2

Query  215  PDK--PCLAYPLQTNTQ-------SFLQRALYPIVLKFEEIVYKVGGE-DKG-SCCTGKS  361
            PD+  PC     Q N Q       S L  +L+P+ LKFE+I Y +  E +KG S  +   
Sbjct  4    PDQVSPCANDDFQDNQQQSNHVKLSVLHESLHPVTLKFEDISYTIKLESNKGISYFSTPQ  63

Query  362  SAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
              + + IL GVTG+V PGE LAMLGPSGSGKTTLLTA
Sbjct  64   RKQNRAILQGVTGIVHPGEFLAMLGPSGSGKTTLLTA  100



>emb|CDX99764.1| BnaC02g35560D [Brassica napus]
Length=685

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +2

Query  224  PCL---AYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSARE-KTILN  388
            PCL       Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    ++ + ILN
Sbjct  37   PCLDDDGPSHQSRQSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGSQEPKQNRLILN  96

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            GV+G+V PG++LAMLGPSGSGKTTL+TA
Sbjct  97   GVSGIVKPGDLLAMLGPSGSGKTTLVTA  124



>ref|XP_009605775.1| PREDICTED: ABC transporter G family member 9 [Nicotiana tomentosiformis]
Length=616

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q  + +  ++   P+ LKFE +VYK+  + +G   +      EK IL G+TG+V PGE+L
Sbjct  12   QLESAAIFKKTNLPVTLKFENVVYKIKPKKEGLFNSSSKLEEEKIILKGITGIVFPGEML  71

Query  425  AMLGPSGSGKTTLLTA  472
            AMLGPSGSGKTTLLT 
Sbjct  72   AMLGPSGSGKTTLLTG  87



>gb|KDP29341.1| hypothetical protein JCGZ_18262 [Jatropha curcas]
Length=682

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFL--QRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGE  418
            + NT  FL  + + +P+ LKFE++ Y +    K SC   +  +  KT+LN V+G+V PGE
Sbjct  58   ELNTSRFLILRESSHPVTLKFEDVSYSINLSAKRSCYLNEPKSTTKTVLNCVSGIVRPGE  117

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTLLTA
Sbjct  118  LLAMLGPSGSGKTTLLTA  135



>ref|XP_008457190.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
 ref|XP_008457191.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
Length=673

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +2

Query  215  PDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE----KT  379
            PD    A P   +T S L+++L+P+ LKFE++ Y +  + +K  C + +++  +    +T
Sbjct  28   PDLLIHAVPSAPDTFSILRQSLFPLTLKFEDVSYSIKIQTNKRRCLSLRNNESQSNTTRT  87

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ILNGV+G+V PGE+LAMLG SGSGKTTLLTA
Sbjct  88   ILNGVSGVVRPGELLAMLGTSGSGKTTLLTA  118



>gb|KCW50637.1| hypothetical protein EUGRSUZ_J00337 [Eucalyptus grandis]
Length=603

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  248  TNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSC-CTGKSS-AREKTILNGVTGMVCPGEI  421
            T T     R+  PI LKF ++VYK+      +    GKS+ A EK ILNG+TG+V PGE+
Sbjct  28   TTTSCIFSRSSNPITLKFHDVVYKIKIRRAAAGGFLGKSTEAEEKVILNGLTGVVRPGEM  87

Query  422  LAMLGPSGSGKTTLLT  469
            LAMLGPSGSGKTTLLT
Sbjct  88   LAMLGPSGSGKTTLLT  103



>ref|XP_009378509.1| PREDICTED: ABC transporter G family member 9 [Pyrus x bretschneideri]
Length=622

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 7/75 (9%)
 Frame = +2

Query  248  TNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILA  427
            + T    + A+ P+ +KFE++VYK+  + KG+       + EK ILN V G+V PGEILA
Sbjct  19   SETPGIFKNAIRPVTVKFEDVVYKIKAK-KGT------KSEEKVILNSVNGLVQPGEILA  71

Query  428  MLGPSGSGKTTLLTA  472
            MLGPSGSGKTTLLTA
Sbjct  72   MLGPSGSGKTTLLTA  86



>ref|XP_010034170.1| PREDICTED: ABC transporter G family member 9 [Eucalyptus grandis]
Length=651

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  248  TNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSC-CTGKSS-AREKTILNGVTGMVCPGEI  421
            T T     R+  PI LKF ++VYK+      +    GKS+ A EK ILNG+TG+V PGE+
Sbjct  36   TTTSCIFSRSSNPITLKFHDVVYKIKIRRAAAGGFLGKSTEAEEKVILNGLTGVVRPGEM  95

Query  422  LAMLGPSGSGKTTLLT  469
            LAMLGPSGSGKTTLLT
Sbjct  96   LAMLGPSGSGKTTLLT  111



>emb|CAN62390.1| hypothetical protein VITISV_039480 [Vitis vinifera]
Length=696

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 67/120 (56%), Gaps = 8/120 (7%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ------SFLQRALYPIVL  295
            +   P N     R+++  T +    A+   PCL        Q      S L+ +L P+ L
Sbjct  30   ITGDPANVLGANRIENV-TIHAAEPASNVSPCLEDQTPDGQQTTRPQFSILRESLRPVTL  88

Query  296  KFEEIVYKVGGED-KGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFE++VY +     +GSC       + +T+LNGV+G+  PGE+LAMLGPSGSGKTTLLTA
Sbjct  89   KFEDVVYVIKLRSTEGSCFGSPEPKQSRTVLNGVSGIARPGELLAMLGPSGSGKTTLLTA  148



>ref|XP_010675645.1| PREDICTED: ABC transporter G family member 9 [Beta vulgaris subsp. 
vulgaris]
Length=636

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +2

Query  269  QRALYPIVLKFEEIVYKV---GGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            ++A +P++LKF+++VYKV       K    T  S  RE+ ILN ++G+V PGE+LAMLGP
Sbjct  20   KKAKHPVILKFKDVVYKVKFPSQRKKFFKQTTSSPVRERVILNSISGVVYPGEMLAMLGP  79

Query  440  SGSGKTTLLTA  472
            SGSGKTTLLTA
Sbjct  80   SGSGKTTLLTA  90



>gb|EMT29518.1| hypothetical protein F775_52365 [Aegilops tauschii]
Length=571

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 54/133 (41%), Positives = 72/133 (54%), Gaps = 33/133 (25%)
 Frame = +2

Query  131  SVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            +  P   N +P   +    T++ P+DA+  +P  A               +P+VLKFEE+
Sbjct  19   TCTPPSSNGNPSGAVH-PTTSSPPSDASGHRPAAANS-------------FPLVLKFEEV  64

Query  311  VYKV--GGEDKGSCCTGKSSA-----------------REKTILNGVTGMVCPGEILAML  433
            VYKV  G   +G C    SSA                 REKTI++G++G+V PGE+LAML
Sbjct  65   VYKVKVGQATEGWCTRVVSSACGGGAVTKKNKAAALPPREKTIISGMSGVVRPGEMLAML  124

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  125  GPSGSGKTTLLTA  137



>gb|KFK39853.1| hypothetical protein AALP_AA3G297000 [Arabis alpina]
Length=672

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE--DKGSCCTGKSSAREKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +   K      K     + ILNGV+G+V PGE
Sbjct  52   QSRQSSVLRQSLRPIILKFEELTYSIKSQTGKKNYWFGSKEPKPNRLILNGVSGIVKPGE  111

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  112  LLAMLGPSGSGKTTLVTA  129



>ref|XP_008797958.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=649

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query  209  AAPDKPCLAYPLQTNTQSFLQRA---LYPIVLKFEEIVYKVG-GEDK--GSCCTGKSSAR  370
            AAPD+P  A          L RA   L P+ LKFEE+VYK+  G       CC   +   
Sbjct  11   AAPDEPAPADATSHPNPRPLPRATTPLDPVTLKFEEVVYKLKIGRPMWWSGCCGSGAGGA  70

Query  371  EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            EK ILNG+TGMV PGE+LAMLGPSGSGKTTLLTA
Sbjct  71   EKVILNGITGMVGPGEMLAMLGPSGSGKTTLLTA  104



>ref|XP_010921129.1| PREDICTED: ABC transporter G family member 9 [Elaeis guineensis]
Length=619

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = +2

Query  257  QSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            +S   +A +P+ +KFE++VY +  +  GS         EKTIL GV+G V PGE+LAM+G
Sbjct  22   RSIFAKASHPVTIKFEDVVYMIKTKANGS------KKGEKTILKGVSGAVVPGEMLAMMG  75

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  76   PSGSGKTTLLTA  87



>emb|CDY23205.1| BnaA04g05540D [Brassica napus]
Length=735

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 59/121 (49%), Gaps = 24/121 (20%)
 Frame = +2

Query  110  LAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPI  289
             A+P    + P   +CS D  ++D            ++P                  +PI
Sbjct  99   FAVPHEEEIIPSERSCSNDDNLEDIEAATSSVVKLQEEPT-----------------FPI  141

Query  290  VLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
             LKF +I YKV        C   +S+ EK+ILNG++G   PGEILA++GPSGSGKTTLL 
Sbjct  142  YLKFIDITYKV-------TCKAMTSSSEKSILNGISGSAYPGEILALMGPSGSGKTTLLN  194

Query  470  A  472
             
Sbjct  195  V  195



>emb|CDP08055.1| unnamed protein product [Coffea canephora]
Length=641

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +2

Query  233  AYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAR-EKTILNGVTGMVC  409
            A  L+  + +  ++A  P+ LKF ++VYK+  +++G     K+  R EKTIL GV+G+  
Sbjct  43   ASALEQKSCTLFEKAYRPVALKFVDVVYKIKVKNEG--WFKKNIERSEKTILRGVSGLAM  100

Query  410  PGEILAMLGPSGSGKTTLLTA  472
            PGE+LAMLGPSGSGKTTLLTA
Sbjct  101  PGEMLAMLGPSGSGKTTLLTA  121



>gb|KFK29257.1| hypothetical protein AALP_AA7G109600 [Arabis alpina]
Length=639

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A   + LKFE +VY V   E KG     K    E+TIL G+TG+V PGEI
Sbjct  21   QTLPFSIFKKANRSVTLKFENVVYTVKVKEAKGWPWQTKDKTEERTILKGLTGIVKPGEI  80

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKT+LLTA
Sbjct  81   LAMLGPSGSGKTSLLTA  97



>ref|XP_006437762.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
 gb|ESR51002.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
Length=691

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 6/77 (8%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTG-----KSSAREKTILNGVTGMVCPGEI  421
            S L+ +L+P+ LKFE++ Y +     KGSC            R  ++LNGV+G+V PGE+
Sbjct  69   SILRESLHPVTLKFEDVAYSINLHTSKGSCFATSHDEPNKQTRTVSVLNGVSGVVKPGEL  128

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKTTLLTA
Sbjct  129  LAMLGPSGSGKTTLLTA  145



>ref|XP_006451938.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
 gb|ESR65178.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
Length=628

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSG  451
            RA +P+ LKFE+IVYK+  + KG   + K    EK IL G+TGMV PGE+LAMLGPSG G
Sbjct  32   RAKHPVTLKFEDIVYKIKMK-KGFYGSNKK-IEEKAILKGITGMVKPGEMLAMLGPSGCG  89

Query  452  KTTLLTA  472
            KTTLLTA
Sbjct  90   KTTLLTA  96



>ref|XP_006464709.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=628

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSG  451
            RA +P+ LKFE+IVYK+  + KG   + K    EK IL G+TGMV PGE+LAMLGPSG G
Sbjct  32   RAKHPVTLKFEDIVYKIKMK-KGFYGSNKK-IEEKAILKGITGMVKPGEMLAMLGPSGCG  89

Query  452  KTTLLTA  472
            KTTLLTA
Sbjct  90   KTTLLTA  96



>ref|XP_008799253.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 6/66 (9%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGK  454
            A +P+ LKFE++VYK+  +  GS         EKTIL GV+G V PGE+LAM+GPSGSGK
Sbjct  28   ARHPVTLKFEDVVYKIEVKADGS------RKGEKTILKGVSGAVLPGEMLAMMGPSGSGK  81

Query  455  TTLLTA  472
            TTLLTA
Sbjct  82   TTLLTA  87



>emb|CDY29304.1| BnaC01g19560D [Brassica napus]
Length=638

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  ++A  PI LKFE IVY V   E K      K    E TIL G+ G+V PGEILAMLG
Sbjct  26   SIFKKANLPITLKFENIVYTVKVKEPKSWLSQTKVKTEEMTILKGINGIVKPGEILAMLG  85

Query  437  PSGSGKTTLLTA  472
            PSGSGKT+LLTA
Sbjct  86   PSGSGKTSLLTA  97



>ref|XP_009383080.1| PREDICTED: ABC transporter G family member 9 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 62/112 (55%), Gaps = 14/112 (13%)
 Frame = +2

Query  137  APKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            A   E+    + +D+  T  + AD           L+ N  S   +A  P+ LKFE++VY
Sbjct  6    ARAVEDGKETKELDNDVTVYRLADHK------GLILKINIYS---KANRPVTLKFEDVVY  56

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            K+  + KG    G     E+ IL GV+G V PGE+LAMLGPSGSGKTTLLT 
Sbjct  57   KIKTKGKGKAKEG-----ERVILKGVSGAVSPGEMLAMLGPSGSGKTTLLTV  103



>dbj|BAC99536.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
 dbj|BAC99846.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
Length=757

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 18/82 (22%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA-----------------REKTILNGVTGMV  406
            YP+VLKFEE+VYKV  G+     C   SSA                 +EKTI++G++G+V
Sbjct  97   YPLVLKFEEVVYKVKIGKPAAGWCARMSSAIGGGGEGRRKKGAAAVAKEKTIISGMSGVV  156

Query  407  CPGEILAMLGPSGSGKTTLLTA  472
             PGE+LAMLGPSGSGKTTLLTA
Sbjct  157  RPGEMLAMLGPSGSGKTTLLTA  178



>gb|EAZ41641.1| hypothetical protein OsJ_26175 [Oryza sativa Japonica Group]
Length=757

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 18/82 (22%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA-----------------REKTILNGVTGMV  406
            YP+VLKFEE+VYKV  G+     C   SSA                 +EKTI++G++G+V
Sbjct  97   YPLVLKFEEVVYKVKIGKPAAGWCARMSSAIGGGGEGRRKKGAAAVAKEKTIISGMSGVV  156

Query  407  CPGEILAMLGPSGSGKTTLLTA  472
             PGE+LAMLGPSGSGKTTLLTA
Sbjct  157  RPGEMLAMLGPSGSGKTTLLTA  178



>ref|XP_010324497.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
 ref|XP_010324498.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
Length=598

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  344  CCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTA
Sbjct  2    CCGGSSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTA  44



>gb|KDO74147.1| hypothetical protein CISIN_1g010509mg [Citrus sinensis]
Length=508

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 2/67 (3%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSG  451
            RA +P+ LKFE+IVYK+    KG   + K    EK IL G+TGMV PGE+LAMLGPSG G
Sbjct  32   RAKHPVTLKFEDIVYKIK-MKKGFYGSNKK-IEEKAILKGITGMVKPGEMLAMLGPSGCG  89

Query  452  KTTLLTA  472
            KTTLLTA
Sbjct  90   KTTLLTA  96



>ref|XP_008775311.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 6/66 (9%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGK  454
            A +P+ LKFE++VYK+  +  GS         EKTIL GV+G V PGE+LAM+GPSGSGK
Sbjct  28   ARHPVTLKFEDVVYKIEVKADGS------RKGEKTILKGVSGAVLPGEMLAMMGPSGSGK  81

Query  455  TTLLTA  472
            TTLLTA
Sbjct  82   TTLLTA  87



>emb|CDX95330.1| BnaC04g28280D [Brassica napus]
Length=738

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 68/139 (49%), Gaps = 26/139 (19%)
 Frame = +2

Query  56   SSTTKTPISITQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLA  235
            S  T   + ++ +F  F  A+P    + P  ++CS +  ++D            ++P   
Sbjct  82   SRATSASLGLSFSFTGF--AVPHEEEIIPSEQSCSNEDNLEDIEAATSNVVKLQEEPT--  137

Query  236  YPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPG  415
                           +PI LKF +I YKV        C   +S+ EK+ILNG++G   PG
Sbjct  138  ---------------FPIYLKFIDITYKV-------TCKAMTSSSEKSILNGISGSAYPG  175

Query  416  EILAMLGPSGSGKTTLLTA  472
            EILA++GPSGSGKTTLL  
Sbjct  176  EILALMGPSGSGKTTLLNV  194



>gb|EEC82957.1| hypothetical protein OsI_27950 [Oryza sativa Indica Group]
Length=761

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 18/82 (22%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA-----------------REKTILNGVTGMV  406
            YP+VLKFEE+VYKV  G+     C   SSA                 +EKTI++G++G+V
Sbjct  101  YPLVLKFEEVVYKVKIGKPAAGWCARMSSAIGGGGEGRRKKGAAAVAKEKTIISGMSGVV  160

Query  407  CPGEILAMLGPSGSGKTTLLTA  472
             PGE+LAMLGPSGSGKTTLLTA
Sbjct  161  RPGEMLAMLGPSGSGKTTLLTA  182



>ref|XP_004139018.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
21-like [Cucumis sativus]
Length=666

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +2

Query  215  PDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE----KT  379
            PD    A P   +T S L+++L+ + LKFE I Y +  + +K  C + +++  +    +T
Sbjct  29   PDLLIHAVPSAPDTFSILRQSLFSLTLKFENISYSIKVQTNKRGCLSLRNNESQSNTTRT  88

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ILNGV+G+V PGE+LAMLG SGSGKTTLLTA
Sbjct  89   ILNGVSGLVRPGELLAMLGTSGSGKTTLLTA  119



>ref|XP_009143407.1| PREDICTED: ABC transporter G family member 9 [Brassica rapa]
 emb|CDX89252.1| BnaA01g16410D [Brassica napus]
Length=638

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  ++A  PI LKFE +VY V   E K      K    E TIL G+ G+V PGEILAMLG
Sbjct  26   SIFKKANLPITLKFENVVYTVKVKEPKSWLSQTKVKTEEMTILKGINGIVKPGEILAMLG  85

Query  437  PSGSGKTTLLTA  472
            PSGSGKT+LLTA
Sbjct  86   PSGSGKTSLLTA  97



>gb|KGN61520.1| hypothetical protein Csa_2G153580 [Cucumis sativus]
Length=673

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +2

Query  215  PDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE----KT  379
            PD    A P   +T S L+++L+ + LKFE I Y +  + +K  C + +++  +    +T
Sbjct  29   PDLLIHAVPSAPDTFSILRQSLFSLTLKFENISYSIKVQTNKRGCLSLRNNESQSNTTRT  88

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ILNGV+G+V PGE+LAMLG SGSGKTTLLTA
Sbjct  89   ILNGVSGLVRPGELLAMLGTSGSGKTTLLTA  119



>ref|XP_004170842.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
21-like [Cucumis sativus]
Length=673

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +2

Query  215  PDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE----KT  379
            PD    A P   +T S L+++L+ + LKFE I Y +  + +K  C + +++  +    +T
Sbjct  29   PDLLIHAVPSAPDTFSILRQSLFSLTLKFENISYSIKVQTNKRGCLSLRNNESQSNTTRT  88

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ILNGV+G+V PGE+LAMLG SGSGKTTLLTA
Sbjct  89   ILNGVSGLVRPGELLAMLGTSGSGKTTLLTA  119



>gb|EYU28941.1| hypothetical protein MIMGU_mgv1a002356mg [Erythranthe guttata]
Length=684

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKG---SCCTGKSSAREKTILNGVTGMVCPGEILAM  430
            S L+ +L P+ LKFE++ Y +    +    +CC        + +LNGVTG V PGE+LAM
Sbjct  57   SVLRESLRPVTLKFEDVSYTIKLSRRSGATNCCASSQPKVTRKLLNGVTGTVRPGELLAM  116

Query  431  LGPSGSGKTTLLTA  472
            LGPSGSGKTTLLTA
Sbjct  117  LGPSGSGKTTLLTA  130



>gb|KHN37813.1| ABC transporter G family member 21 [Glycine soja]
Length=666

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+V PGE+ AML
Sbjct  68   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVVNPGELTAML  127

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  128  GPSGSGKTTLLTA  140



>ref|XP_006589394.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=684

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+V PGE+ AML
Sbjct  69   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVVNPGELTAML  128

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  129  GPSGSGKTTLLTA  141



>ref|XP_002314895.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
 gb|EEF01066.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
Length=683

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 17/120 (14%)
 Frame = +2

Query  113  AMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            A P++ S      +CS DQ +               +P L+        + L+ +L P+ 
Sbjct  35   AEPSVSSSINNTSSCSQDQVLQ-----------GQQEPALS------RFTILRASLRPVT  77

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            L+F ++ Y V    KG+  T       +T+LNG +G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  78   LEFADVAYSVSLSTKGTWFTSSEPKSTRTVLNGASGIVRPGELLAMLGPSGSGKTTLLTA  137



>ref|XP_011008785.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
 ref|XP_011008793.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
Length=684

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            + L+ +L P+ L+F ++ Y V    KG+          +T+LNGV+G+V PGE+LAMLGP
Sbjct  68   TILRASLRPVTLEFADVAYSVSLSTKGTWFASSEPKSTRTVLNGVSGIVRPGELLAMLGP  127

Query  440  SGSGKTTLLTA  472
            SGSGKTTLLTA
Sbjct  128  SGSGKTTLLTA  138



>ref|XP_004252105.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=628

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P+ LKFE +VYK+    +G       S  EK IL GV+G+V PGE+LA+LGPSGSGKTTL
Sbjct  28   PVTLKFENVVYKINLAKEGCFKNSPKSNEEKRILKGVSGIVSPGEMLAILGPSGSGKTTL  87

Query  464  LTA  472
            LT 
Sbjct  88   LTG  90



>gb|KJB13426.1| hypothetical protein B456_002G073600 [Gossypium raimondii]
Length=627

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            +VLKF ++VY +     G     KS + EK ILNG+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  30   VVLKFVDVVYSIKFGKSGHYFQKKSGSGEKVILNGITGVVEPGEMLAMLGPSGSGKTTLL  89

Query  467  TA  472
            TA
Sbjct  90   TA  91



>ref|XP_009152126.1| PREDICTED: ABC transporter G family member 21 [Brassica rapa]
Length=666

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  K S   G    +  + +LNGV+G+V PGE
Sbjct  46   QSRQSSVLRQSLRPIILKFEELTYSITSQTGKRSYWFGSQEPKPNRFVLNGVSGIVKPGE  105

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  106  LLAMLGPSGSGKTTLVTA  123



>ref|XP_010433373.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=638

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  +++  P+ LKFE +VY V  ++            E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKSNNPVTLKFENLVYTVKLKEPNGWFRTNDKTEERTILKGLTGLVKPGEILAMLGP  85

Query  440  SGSGKTTLLTA  472
            SGSGKT+LLTA
Sbjct  86   SGSGKTSLLTA  96



>gb|KHN07718.1| ABC transporter G family member 21, partial [Glycine soja]
Length=602

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  299  FEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            FE++ Y +  G DK  C + +     KT+LNGVTGMV P E++AMLGPSGSGKTTLLTA
Sbjct  1    FEDVSYSITFGRDKNGCVSSQKPKHTKTVLNGVTGMVGPREVMAMLGPSGSGKTTLLTA  59



>emb|CDY51602.1| BnaCnng21050D [Brassica napus]
Length=666

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 69/122 (57%), Gaps = 3/122 (2%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSF-LQRALYPIV  292
            MP     +  P+    +Q +       + +  +   PC       + QSF L+++L PI+
Sbjct  2    MPPNEQESSFPKTPGANQSVTSPVQETRFSSPSHVTPCPDGLSHQSRQSFVLRQSLRPII  61

Query  293  LKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            LKFEE+ Y +  +  K S   G    +  + +LNGV+G+V PGE+LAMLGPSGSGKTTL+
Sbjct  62   LKFEELTYSITSQTGKRSYWFGSQEPKPNRFVLNGVSGIVKPGELLAMLGPSGSGKTTLV  121

Query  467  TA  472
            TA
Sbjct  122  TA  123



>ref|XP_010438619.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=636

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  +++  P+ LKFE +VY V  ++            E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKSNNPVTLKFENLVYTVKLKEPNGWFRTNDKTEERTILKGLTGLVKPGEILAMLGP  85

Query  440  SGSGKTTLLTA  472
            SGSGKT+LLTA
Sbjct  86   SGSGKTSLLTA  96



>ref|XP_010448138.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
 ref|XP_010448139.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
Length=638

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  +++  P+ LKFE +VY V  ++            E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKSNNPVTLKFENLVYTVKLKEPNGWFRTNDKTEERTILKGLTGLVKPGEILAMLGP  85

Query  440  SGSGKTTLLTA  472
            SGSGKT+LLTA
Sbjct  86   SGSGKTSLLTA  96



>ref|XP_006359003.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=628

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P+ LKFE +VYK+    +G       S  EK IL GV+G+V PGE+LA+LGPSGSGKTTL
Sbjct  28   PVTLKFENVVYKINLVKEGCFKNSPKSNEEKIILKGVSGIVSPGEMLAILGPSGSGKTTL  87

Query  464  LTA  472
            LT 
Sbjct  88   LTG  90



>ref|XP_006376281.1| hypothetical protein POPTR_0013s11630g, partial [Populus trichocarpa]
 gb|ERP54078.1| hypothetical protein POPTR_0013s11630g, partial [Populus trichocarpa]
Length=284

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (55%), Gaps = 11/110 (10%)
 Frame = +2

Query  176  DDAATTNQPADAAPDKPCLAYPLQT-NTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCT  352
            +   TTN  +   PD+     P  + +  S +  + YPI LKF E+ Y+V  E++     
Sbjct  5    NGVETTNGDSPDGPDRSKAPPPRDSRDLPSLMLSSCYPITLKFMEVGYRVKFENRNKGSN  64

Query  353  GK----------SSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             K             +E+TILNG+TGM  PGEILA+LGPSGSGK+T L A
Sbjct  65   IKRILGHEPTICDQIQERTILNGITGMASPGEILAVLGPSGSGKSTFLNA  114



>ref|XP_008386302.1| PREDICTED: ABC transporter G family member 9-like [Malus domestica]
Length=622

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 16/90 (18%)
 Frame = +2

Query  203  ADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTI  382
            AD  PD         + T    + A+ P+ +KFE++VYK+  +         + + EK I
Sbjct  13   ADRRPD---------SETPGIFKNAIRPVTVKFEDVVYKIKAKKS-------TKSEEKVI  56

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LN V G+V PGEILAMLGPSGSGKTTLL+A
Sbjct  57   LNSVNGLVQPGEILAMLGPSGSGKTTLLSA  86



>gb|KJB50814.1| hypothetical protein B456_008G188000 [Gossypium raimondii]
Length=690

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKT-ILNGVTGMVCPGEILAMLGPSGS  448
            ++L P+ LKFEE+ Y +      + C      +++T +LNGV+G+V PGE+LAMLGPSGS
Sbjct  72   QSLRPVTLKFEEVAYTIHSSVTSASCFSSHKPKQRTNVLNGVSGVVRPGELLAMLGPSGS  131

Query  449  GKTTLLTA  472
            GKTTLLTA
Sbjct  132  GKTTLLTA  139



>ref|XP_009137658.1| PREDICTED: ABC transporter G family member 9-like [Brassica rapa]
Length=644

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A  PI LKFE +VY V   E K      K    +KTIL GV G+V P EI
Sbjct  27   QTLPFSVFKKANLPITLKFENVVYTVKVKEPKSWLGQTKGKTEDKTILKGVNGIVKPREI  86

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKT+LLTA
Sbjct  87   LAMLGPSGSGKTSLLTA  103



>emb|CDY29837.1| BnaA03g48580D [Brassica napus]
Length=644

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A  PI LKFE +VY V   E K      K    +KTIL GV G+V P EI
Sbjct  27   QTLPFSVFKKANLPITLKFENVVYTVKVKEPKSWLGQTKGKTEDKTILKGVNGIVKPREI  86

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKT+LLTA
Sbjct  87   LAMLGPSGSGKTSLLTA  103



>ref|XP_008237152.1| PREDICTED: ABC transporter G family member 25 [Prunus mume]
Length=669

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 19/112 (17%)
 Frame = +2

Query  179  DAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDK----GSC  346
            D  T+ +      D P    P   N+ +      +PI LKF ++ Y+V  ++K    G C
Sbjct  6    DTTTSGEHQTPNRDLPSDHSPFMINSSN-----CFPITLKFLDVCYRVKIDNKLQYKGGC  60

Query  347  CTGKSSA----------REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            C  K             +E+TIL+G+TGMV PGEILA+LGPSGSGK+TLL A
Sbjct  61   CFSKGRLMQKGQPGQEPQERTILHGITGMVSPGEILAILGPSGSGKSTLLNA  112



>ref|XP_006290691.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
 gb|EOA23589.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
Length=673

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KG    G    +  + ILN V+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPIILKFEELTYSIKSQTGKGRNWFGSQEPKPNRLILNSVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTA  472
            +LAMLGPSGSGKTTL+TA
Sbjct  111  LLAMLGPSGSGKTTLVTA  128



>ref|XP_010535206.1| PREDICTED: ABC transporter G family member 25-like [Tarenaya 
hassleriana]
Length=637

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 48/73 (66%), Gaps = 9/73 (12%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVGGEDKGSCCTG---------KSSAREKTILNGVTGMVCPGEILAML  433
            +PI LKF ++ YKV   D G    G          ++  E+TIL+GVTGMV PGEILA+L
Sbjct  27   FPISLKFIDVSYKVKIHDSGGYSAGLKRLLGMGSTATVEERTILSGVTGMVSPGEILAVL  86

Query  434  GPSGSGKTTLLTA  472
            GPSGSGK+TLL A
Sbjct  87   GPSGSGKSTLLNA  99



>ref|XP_010528033.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=684

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 4/79 (5%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG---GEDKGSCCTGKSSAREKTILNGVTGMVCPG  415
            Q+   S L R+L P++L FE++ Y +    G+     C+ + S   + ILNGVTG+V PG
Sbjct  59   QSRKYSILCRSLCPLILNFEDLTYSINLQTGKASYWFCS-QESKPTRLILNGVTGLVKPG  117

Query  416  EILAMLGPSGSGKTTLLTA  472
            E+LAMLGPSGSGKTTLLTA
Sbjct  118  ELLAMLGPSGSGKTTLLTA  136



>ref|NP_189190.2| ABC transporter G family member 21 [Arabidopsis thaliana]
 gb|AAQ22642.1| At3g25620/T5M7_4 [Arabidopsis thaliana]
 gb|AEE77043.1| ABC transporter G family member 21 [Arabidopsis thaliana]
Length=467

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 9/117 (8%)
 Frame = +2

Query  128  HSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            H  +P  EN     R    +  N   D   D    ++  Q+   S L+++L PI+LKFEE
Sbjct  20   HETSPVQEN-----RFSSPSHVNPCLDDDNDHDGPSH--QSRQSSVLRQSLRPIILKFEE  72

Query  308  IVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            + Y +  +  KGS   G    +  + +L  V+G+V PGE+LAMLGPSGSGKTTL+TA
Sbjct  73   LTYSIKSQTGKGSYWFGSQEPKPNRLVLKCVSGIVKPGELLAMLGPSGSGKTTLVTA  129



>ref|XP_006855537.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
 gb|ERN17004.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
Length=646

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +2

Query  230  LAYP-LQTNTQSFLQRALYPIVLKFEEIVYKVGG---EDKGSCCTGKSSAR----EKTIL  385
            LA P + + T   L++ + PI +KFE++VYK+ G   ++K  C      AR    E+TIL
Sbjct  11   LATPAVDSETHDLLRQPIQPISVKFEDVVYKIKGPNNKEKEKCSLLPLGARQPDAERTIL  70

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
             G+TG V PGE+LA+LGPSGSGKTT L+A
Sbjct  71   KGITGAVRPGEMLALLGPSGSGKTTFLSA  99



>ref|NP_001189973.1| ABC transporter G family member 21 [Arabidopsis thaliana]
 sp|Q7XA72.2|AB21G_ARATH RecName: Full=ABC transporter G family member 21; Short=ABC transporter 
ABCG.21; Short=AtABCG21; AltName: Full=White-brown 
complex homolog protein 21; Short=AtWBC21 [Arabidopsis thaliana]
 dbj|BAB03081.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE77044.1| ABC transporter G family member 21 [Arabidopsis thaliana]
Length=672

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 47/128 (37%), Positives = 69/128 (54%), Gaps = 9/128 (7%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCL-------AYPLQTNTQSFLQR  274
            MP     +  P+  S ++        N+ +  +   PCL           Q+   S L++
Sbjct  2    MPPNEQESSFPKTPSANRHETSPVQENRFSSPSHVNPCLDDDNDHDGPSHQSRQSSVLRQ  61

Query  275  ALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSGS  448
            +L PI+LKFEE+ Y +  +  KGS   G    +  + +L  V+G+V PGE+LAMLGPSGS
Sbjct  62   SLRPIILKFEELTYSIKSQTGKGSYWFGSQEPKPNRLVLKCVSGIVKPGELLAMLGPSGS  121

Query  449  GKTTLLTA  472
            GKTTL+TA
Sbjct  122  GKTTLVTA  129



>gb|KHN00888.1| ABC transporter G family member 21 [Glycine soja]
Length=674

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+  PGE+ AML
Sbjct  66   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVANPGELTAML  125

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  126  GPSGSGKTTLLTA  138



>ref|XP_002281949.1| PREDICTED: ABC transporter G family member 9 [Vitis vinifera]
Length=623

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            ++LKFEE+ YK     KG      S   EK IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  30   VILKFEEVDYK-AKTHKGGLLRKDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLL  88

Query  467  TA  472
            TA
Sbjct  89   TA  90



>ref|XP_003556255.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=682

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+  PGE+ AML
Sbjct  67   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVANPGELTAML  126

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  127  GPSGSGKTTLLTA  139



>emb|CAN62144.1| hypothetical protein VITISV_007841 [Vitis vinifera]
Length=603

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            ++LKFEE+ YK     KG      S   EK IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  33   VILKFEEVDYK-AKTHKGGLLRKDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLL  91

Query  467  TA  472
            TA
Sbjct  92   TA  93



>emb|CDY48079.1| BnaA06g33490D [Brassica napus]
Length=665

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 67/122 (55%), Gaps = 3/122 (2%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPL-QTNTQSFLQRALYPIV  292
            MP     +  P+    +Q +       + +  +   PC   P  Q+   S L ++L PI+
Sbjct  1    MPPNEQESSFPKTPGANQSVTSPVQETRFSSPSHVIPCHGGPSHQSRQSSVLCQSLRPII  60

Query  293  LKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            LKFEE+ Y +     K S   G    +  + +LNGV+G+V PGE+LAMLGPSGSGKTTL+
Sbjct  61   LKFEELTYSITSPTGKRSYWFGSQEPKPNRFVLNGVSGIVKPGELLAMLGPSGSGKTTLV  120

Query  467  TA  472
            TA
Sbjct  121  TA  122



>ref|XP_010520902.1| PREDICTED: ABC transporter G family member 9-like [Tarenaya hassleriana]
Length=620

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  +    P+ LKF+ +VYK+  +  +G       +  EKTIL G+TG+V PGE+LAMLG
Sbjct  23   SIFENVNLPVTLKFDNVVYKIKPKKPRGWFQIETKAQEEKTILKGLTGVVKPGEMLAMLG  82

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLTA
Sbjct  83   PSGSGKTTLLTA  94



>ref|XP_004496215.1| PREDICTED: ABC transporter G family member 21-like [Cicer arietinum]
Length=681

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  152  NCSPDQRMDDAATTNQPADAAPD---KPCL----AYPLQTNTQ-----SFLQRALYPIVL  295
            N SP     ++++ +  A+ +     KP L    A P +T T      S L ++L P+ L
Sbjct  16   NISPITNRTESSSIHGEAEGSFSNKVKPSLDDHNAIPSRTTTVPLTSFSILPQSLRPVTL  75

Query  296  KFEEIVYKV---GGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            KFE++ Y +     ++KG C  GK     + +LNGVTG+  PGE+ AMLGPSGSGKTTLL
Sbjct  76   KFEDVSYSITLTNQKNKG-CVLGKEPKVTRKVLNGVTGIAKPGELTAMLGPSGSGKTTLL  134

Query  467  TA  472
            TA
Sbjct  135  TA  136



>ref|XP_011095242.1| PREDICTED: ABC transporter G family member 9-like isoform X2 
[Sesamum indicum]
Length=618

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            +Q    +  ++A   + LKF ++VYKV            +++ EK +L G+TG+V PGE+
Sbjct  8    IQDENHAIFKKAKSRVTLKFADVVYKVTIGQSKKLLNKNTNSEEKLVLKGITGVVRPGEM  67

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKTTLLTA
Sbjct  68   LAMLGPSGSGKTTLLTA  84



>ref|XP_011095241.1| PREDICTED: ABC transporter G family member 9-like isoform X1 
[Sesamum indicum]
Length=654

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            +Q    +  ++A   + LKF ++VYKV            +++ EK +L G+TG+V PGE+
Sbjct  44   IQDENHAIFKKAKSRVTLKFADVVYKVTIGQSKKLLNKNTNSEEKLVLKGITGVVRPGEM  103

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKTTLLTA
Sbjct  104  LAMLGPSGSGKTTLLTA  120



>emb|CBI20349.3| unnamed protein product [Vitis vinifera]
Length=574

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            ++LKFEE+ YK     KG      S   EK IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  30   VILKFEEVDYK-AKTHKGGLLRKDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLL  88

Query  467  TA  472
            TA
Sbjct  89   TA  90



>ref|XP_007149612.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
 gb|ESW21606.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
Length=624

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            L+T    FL +  + + LKF+++VYK+  + KG     K     K IL GVTG+V PGE+
Sbjct  14   LETPPDVFL-KGKHQVTLKFDDVVYKIKTK-KGGLLAKKRETVVKEILKGVTGVVEPGEM  71

Query  422  LAMLGPSGSGKTTLLTA  472
            LAMLGPSGSGKTTLLTA
Sbjct  72   LAMLGPSGSGKTTLLTA  88



>dbj|BAJ95904.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 23/87 (26%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA----------------------REKTILNG  391
            +P+VLKFEE+VYKV  G+     CT  S+A                      REKTI++G
Sbjct  48   FPLVLKFEEVVYKVKVGQATDGWCTRVSAACRGGGGAGGKKNKAAAAAVSPPREKTIISG  107

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ++G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  108  MSGVVRPGEMLAMLGPSGSGKTTLLTA  134



>dbj|BAJ97566.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 23/87 (26%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA----------------------REKTILNG  391
            +P+VLKFEE+VYKV  G+     CT  S+A                      REKTI++G
Sbjct  48   FPLVLKFEEVVYKVKVGQATDGWCTRVSAACRGGGGAGGKKNKAAAAAVSPPREKTIISG  107

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTA  472
            ++G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  108  MSGVVRPGEMLAMLGPSGSGKTTLLTA  134



>ref|XP_002325552.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE99933.2| ABC transporter family protein [Populus trichocarpa]
Length=665

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 10/81 (12%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK----------GSCCTGKSSAREKTILNGVTGMVC  409
            S L  + YPI LKF ++ Y+V  E+K          G   T     +E+TILNG+TGM  
Sbjct  37   SLLLSSCYPITLKFMDVGYRVKFENKNKGSNIKRIFGHGPTISDQFQERTILNGITGMAS  96

Query  410  PGEILAMLGPSGSGKTTLLTA  472
            PGEILA+LGPSGSGK+TLL A
Sbjct  97   PGEILAILGPSGSGKSTLLNA  117



>gb|KEH38788.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=597

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            + ++F+++VYK+  + KG          EKTIL GVTG+V PGE+LAMLGPSGSGKTTLL
Sbjct  1    MTMQFDDVVYKIKAK-KGGLFKKNIEVEEKTILKGVTGIVQPGEMLAMLGPSGSGKTTLL  59

Query  467  TA  472
            TA
Sbjct  60   TA  61



>ref|XP_003526081.1| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=624

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = +2

Query  263  FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPS  442
            FL R   P+ LKF +++YK+     G     K  A EK ILNGVTGM   GEILAMLGPS
Sbjct  22   FLTRN-SPVTLKFHDVIYKIKTTKWGFLKNTK--AEEKVILNGVTGMAQSGEILAMLGPS  78

Query  443  GSGKTTLLTA  472
            GSGKTTLL A
Sbjct  79   GSGKTTLLAA  88



>ref|XP_004487681.1| PREDICTED: ABC transporter G family member 9-like [Cicer arietinum]
Length=630

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P++LKF+++VYK+   +KG          EK IL GVTG+V PGE+LAMLGPSGSGKTTL
Sbjct  33   PVILKFDDVVYKIKA-NKGGLFKKNKKVEEKVILKGVTGIVKPGEMLAMLGPSGSGKTTL  91

Query  464  LTA  472
            LTA
Sbjct  92   LTA  94



>ref|XP_010521140.1| PREDICTED: ABC transporter G family member 25-like [Tarenaya 
hassleriana]
Length=666

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 66/125 (53%), Gaps = 29/125 (23%)
 Frame = +2

Query  149  ENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGG  328
            EN + D RMD   T+  P    P  P        + +S L  A +PI LKF ++ YKV  
Sbjct  8    ENQTVD-RMDGPDTSVHP----PQDP-------RDPRSLLSSACFPITLKFIDVCYKVKI  55

Query  329  EDKGSCC---------------TGKSSAR--EKTILNGVTGMVCPGEILAMLGPSGSGKT  457
             D+                     +S+A+  E+TIL+G+TGMV PGEILA+LGPSGSGK+
Sbjct  56   HDRSGDSGRIKRLLAMGRQPSDQTRSTAQFEERTILSGITGMVSPGEILAVLGPSGSGKS  115

Query  458  TLLTA  472
            T L A
Sbjct  116  TFLNA  120



>ref|XP_003541854.2| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=627

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +2

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            L +    ++LKF+ +VYK+  + KG          EK IL GV G+V PGE+LAMLGPSG
Sbjct  23   LHKGKRQVILKFDNVVYKIKTK-KGGVFVKNKETEEKEILKGVKGVVEPGEMLAMLGPSG  81

Query  446  SGKTTLLTA  472
            SGKTTLLTA
Sbjct  82   SGKTTLLTA  90



>ref|XP_007143780.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
 gb|ESW15774.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
Length=681

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C     S   + +L+GVTG+  PGE+ AML
Sbjct  66   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRNESKLRRKVLSGVTGVANPGELTAML  125

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  126  GPSGSGKTTLLTA  138



>ref|XP_009793168.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=644

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 11/97 (11%)
 Frame = +2

Query  215  PDK--PCLAYPLQTNTQ-------SFLQRALYPIVLKFEEIVYKVGGE-DKG-SCCTGKS  361
            PD+  PC       N Q       S L+++L P+ LKF+ + Y +  E +KG S  +   
Sbjct  4    PDQVSPCANDDFPDNQQQSNHVKLSVLRKSLRPVTLKFQNVSYTIKLESNKGISYFSTPQ  63

Query  362  SAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
              + + IL GVTG++ PGE LAMLGPSGSGKTTLLTA
Sbjct  64   RKQNRAILQGVTGIIHPGEFLAMLGPSGSGKTTLLTA  100



>ref|XP_008382026.1| PREDICTED: ABC transporter G family member 25-like [Malus domestica]
Length=654

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 8/72 (11%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVGGEDKGS---CCTGKSSA-----REKTILNGVTGMVCPGEILAMLG  436
            +PI LKF ++ YKV  ++K     C  G         +E+TIL+G+TGMV PGEILA+LG
Sbjct  33   FPITLKFVDVCYKVKIDNKSKYRGCLFGHKDKPGQEEQERTILHGITGMVFPGEILAILG  92

Query  437  PSGSGKTTLLTA  472
            PSGSGK+TLL A
Sbjct  93   PSGSGKSTLLNA  104



>ref|XP_011005152.1| PREDICTED: ABC transporter G family member 25-like [Populus euphratica]
Length=655

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 10/81 (12%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGK----------SSAREKTILNGVTGMVC  409
            S +  + YPI LKF E+ Y+V  E++      K             +E+TILNG+TGM  
Sbjct  34   SLMLSSCYPITLKFMEVGYRVKFENRNKGSNIKRILGHEPAICDQVQERTILNGITGMAS  93

Query  410  PGEILAMLGPSGSGKTTLLTA  472
            PGEILA+LGPSGSGK+T L A
Sbjct  94   PGEILAVLGPSGSGKSTFLNA  114



>ref|XP_006493205.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=650

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKV---GGEDKGS----CC--TGKSSAREKTILNGVT  397
            + N +  L++    +++KFE++ +K+   GG  +GS    CC    K+S  EK IL GV+
Sbjct  26   KQNVEDMLKKVNMLVIIKFEDVTHKIKTKGG--RGSLGRYCCYLLNKNSDEEKMILKGVS  83

Query  398  GMVCPGEILAMLGPSGSGKTTLLTA  472
            G V PGE+LA+LGPSG GKTTLLTA
Sbjct  84   GAVSPGELLAILGPSGCGKTTLLTA  108



>ref|XP_009345933.1| PREDICTED: ABC transporter G family member 25-like [Pyrus x bretschneideri]
Length=654

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 8/72 (11%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVGGEDKGS---CCTGKS-----SAREKTILNGVTGMVCPGEILAMLG  436
            +PI LKF ++ YKV  ++K     C  G         +E+TIL+G+TGMV PGEILA+LG
Sbjct  33   FPITLKFVDVCYKVKIDNKSKYRGCLFGHKDKPGLEEQERTILHGITGMVSPGEILAILG  92

Query  437  PSGSGKTTLLTA  472
            PSGSGK+TLL A
Sbjct  93   PSGSGKSTLLNA  104



>ref|XP_009796796.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nicotiana sylvestris]
Length=608

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S REK IL G++G V PGE+LAM+GPSGSGKTTL
Sbjct  10   PIYLKFTEVCYKV-------VIKGVTSTREKEILTGISGSVDPGEVLAMMGPSGSGKTTL  62

Query  464  LT  469
            L+
Sbjct  63   LS  64



>ref|XP_010912511.1| PREDICTED: ABC transporter G family member 25-like [Elaeis guineensis]
Length=642

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 14/89 (16%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDK--------------GSCCTGKSSAREKTI  382
            Q    SF+  + YP+ L+F +I Y+V  + K              G+  +  +  +E+TI
Sbjct  16   QQRMDSFISNSCYPLTLQFVDITYRVKLDPKAANAGTGIKRILHAGAKNSPATVPKERTI  75

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
            LNG++G+V PGEILA+LGPSGSGK+TLL+
Sbjct  76   LNGISGIVSPGEILAVLGPSGSGKSTLLS  104



>ref|XP_010557969.1| PREDICTED: ABC transporter G family member 22-like [Tarenaya 
hassleriana]
Length=750

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 55/108 (51%), Gaps = 18/108 (17%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PE  S  +   D    ++  +A   +P            F      PI LKF +I YKV 
Sbjct  118  PEEISDSKPFSDDEMIHEDIEAGNKQP-----------KFQAEPTLPIYLKFSDITYKV-  165

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
                     G +S+ EK ILNG+ G V PGE+LA++GPSGSGKTTLL+
Sbjct  166  ------VIKGITSSEEKEILNGINGSVVPGEVLALMGPSGSGKTTLLS  207



>ref|XP_010930786.1| PREDICTED: ABC transporter G family member 25 [Elaeis guineensis]
Length=642

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 14/84 (17%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSC-----------CTGKSSA---REKTILNGVT  397
            SF+  + YP+ L+F +I Y++  + K S              G SSA    E+TILNG++
Sbjct  21   SFISNSCYPLSLQFMDITYRIKLDPKASARGSGIKRIFHGGAGNSSAAVPEERTILNGIS  80

Query  398  GMVCPGEILAMLGPSGSGKTTLLT  469
            G V PGEILA+LGPSGSGK+TLL+
Sbjct  81   GAVSPGEILAVLGPSGSGKSTLLS  104



>ref|XP_004236984.1| PREDICTED: ABC transporter G family member 21 [Solanum lycopersicum]
Length=675

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+ +L+P+ LKFE++ Y +    +KG         + + IL  V G+V PGE+LAMLG
Sbjct  62   SILRESLHPVTLKFEDVSYTIKLKSNKGGYFFSHQQKQNRVILQNVMGIVKPGELLAMLG  121

Query  437  PSGSGKTTLLTA  472
            PSGSGKTTLLT+
Sbjct  122  PSGSGKTTLLTS  133



>ref|XP_011094211.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Sesamum indicum]
Length=643

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S  EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  43   PIYLKFTDVTYKV-------VLKGMTSTVEKDILNGITGSVSPGEVLALMGPSGSGKTTL  95

Query  464  LT  469
            L+
Sbjct  96   LS  97



>ref|XP_004252106.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=1013

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKFE + YK+    +G       S  +K IL GV+G+V PGE+LA+LGPSG GKTTL
Sbjct  413  PITLKFENVAYKIKLVKEGCLKNSSKSEEDKIILKGVSGIVSPGEMLAILGPSGCGKTTL  472

Query  464  LTA  472
            LT 
Sbjct  473  LTG  475



>gb|KDO70711.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=435

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S+ EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  20   PIYLKFTDVTYKV-------ILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTL  72

Query  464  LT  469
            L 
Sbjct  73   LN  74



>ref|XP_006430002.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43242.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=650

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S+ EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  147  PIYLKFTDVTYKV-------ILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTL  199

Query  464  L  466
            L
Sbjct  200  L  200



>ref|XP_006830203.1| hypothetical protein AMTR_s01016p00008750, partial [Amborella 
trichopoda]
 gb|ERM97619.1| hypothetical protein AMTR_s01016p00008750, partial [Amborella 
trichopoda]
Length=238

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G+ ++ EK ILNG++G V PGE+LA++GPSGSGKTTL
Sbjct  155  PIFLKFSDVRYKV-------VLKGRRASMEKEILNGISGCVDPGEVLALMGPSGSGKTTL  207

Query  464  LT  469
            L 
Sbjct  208  LN  209



>gb|KDO70708.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=513

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S+ EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  20   PIYLKFTDVTYKV-------ILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTL  72

Query  464  L  466
            L
Sbjct  73   L  73



>ref|XP_006351917.1| PREDICTED: ABC transporter G family member 25-like [Solanum tuberosum]
Length=650

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 52/86 (60%), Gaps = 22/86 (26%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVGGEDKG------------SCCTGKSSA----------REKTILNGV  394
            YPI LKF +I Y++  E+K             S   G +S+          +E+TILNG+
Sbjct  18   YPITLKFMDISYRIKLENKSTSGGSNNIIKMFSTSAGPTSSDIENQTAVIHQERTILNGI  77

Query  395  TGMVCPGEILAMLGPSGSGKTTLLTA  472
            TGMV PGEILA+LGPSGSGK+TLL A
Sbjct  78   TGMVSPGEILAVLGPSGSGKSTLLNA  103



>gb|KDO70709.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
 gb|KDO70710.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=523

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S+ EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  20   PIYLKFTDVTYKV-------ILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTL  72

Query  464  L  466
            L
Sbjct  73   L  73



>sp|Q9FT51.1|AB27G_ARATH RecName: Full=ABC transporter G family member 27; Short=ABC transporter 
ABCG.27; Short=AtABCG27; AltName: Full=Probable white-brown 
complex homolog protein 28; Short=AtWBC28 [Arabidopsis 
thaliana]
 emb|CAC07922.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=737

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 7/70 (10%)
 Frame = +2

Query  263  FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPS  442
            F     +PI LKF +I YKV  +       G +S+ EK+ILNG++G   PGE+LA++GPS
Sbjct  135  FQAEPTFPIYLKFIDITYKVTTK-------GMTSSSEKSILNGISGSAYPGELLALMGPS  187

Query  443  GSGKTTLLTA  472
            GSGKTTLL A
Sbjct  188  GSGKTTLLNA  197



>ref|XP_006481645.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Citrus sinensis]
 ref|XP_006481646.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Citrus sinensis]
Length=746

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S+ EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  147  PIYLKFTDVTYKV-------ILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTL  199

Query  464  L  466
            L
Sbjct  200  L  200



>ref|XP_011001789.1| PREDICTED: ABC transporter G family member 25-like [Populus euphratica]
Length=666

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 10/81 (12%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK----------GSCCTGKSSAREKTILNGVTGMVC  409
            S L  + YPI LKF ++ Y+V  ++K          G   T     +++TILNG+TGM  
Sbjct  38   SLLLSSCYPITLKFMDVGYRVKFQNKNKGSNIKRIFGHGPTISDQFQDRTILNGITGMAS  97

Query  410  PGEILAMLGPSGSGKTTLLTA  472
            PGEILA+LGPSGSGK+TLL A
Sbjct  98   PGEILAILGPSGSGKSTLLNA  118



>ref|XP_006430003.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43243.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=746

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S+ EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  147  PIYLKFTDVTYKV-------ILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTL  199

Query  464  L  466
            L
Sbjct  200  L  200



>ref|XP_010515694.1| PREDICTED: ABC transporter G family member 27 [Camelina sativa]
Length=743

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 7/72 (10%)
 Frame = +2

Query  251  NTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAM  430
            N   F     +PI LKF +I YKV  +       G +S+ EK+ILNG++G   PGE+LA+
Sbjct  133  NVVKFQAEPTFPIYLKFIDITYKVTTK-------GMTSSSEKSILNGISGSAYPGELLAL  185

Query  431  LGPSGSGKTTLL  466
            +GPSGSGKTTLL
Sbjct  186  MGPSGSGKTTLL  197



>ref|XP_010096709.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXB65561.1| ABC transporter G family member 14 [Morus notabilis]
Length=634

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKG--SCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S  + +L P+ LKFE++ Y V  + +   +C +       + +LNGV+G+V PGE+LAML
Sbjct  85   SIFRESLRPVTLKFEDVAYTVNLKPRNGMNCFSTHVPKPTRAVLNGVSGLVRPGELLAML  144

Query  434  GPSGSGKTTLLTA  472
            GPSGSGKTTLLTA
Sbjct  145  GPSGSGKTTLLTA  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180