BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013L22

Length=254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU35548.1|  hypothetical protein MIMGU_mgv1a012961mg              71.2    4e-13   Erythranthe guttata [common monkey flower]
ref|XP_009630975.1|  PREDICTED: high mobility group B protein 7-like  68.6    3e-12   Nicotiana tomentosiformis
ref|XP_010034169.1|  PREDICTED: high mobility group B protein 7       68.6    4e-12   Eucalyptus grandis [rose gum]
ref|XP_009797250.1|  PREDICTED: high mobility group B protein 7-like  68.2    5e-12   Nicotiana sylvestris
ref|XP_004236870.1|  PREDICTED: high mobility group B protein 7       67.4    9e-12   Solanum lycopersicum
ref|XP_010546256.1|  PREDICTED: high mobility group B protein 7       63.9    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_010688617.1|  PREDICTED: high mobility group B protein 7       63.2    3e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO77003.1|  hypothetical protein CISIN_1g026850mg                 61.6    1e-09   Citrus sinensis [apfelsine]
ref|XP_006448478.1|  hypothetical protein CICLE_v10016587mg           61.6    1e-09   Citrus clementina [clementine]
ref|XP_006468697.1|  PREDICTED: high mobility group B protein 7-like  61.6    1e-09   
gb|KDO77000.1|  hypothetical protein CISIN_1g026850mg                 61.6    1e-09   Citrus sinensis [apfelsine]
ref|XP_010248937.1|  PREDICTED: high mobility group B protein 7-like  60.5    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010103584.1|  High mobility group B protein 7                  60.5    3e-09   Morus notabilis
ref|XP_008340418.1|  PREDICTED: high mobility group B protein 7-l...  60.5    3e-09   Malus domestica [apple tree]
ref|NP_001190371.1|  high-mobility group B6 protein                   59.7    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351760.1|  PREDICTED: high mobility group B protein 7-l...  59.3    7e-09   
ref|XP_009351762.1|  PREDICTED: high mobility group B protein 7-l...  59.3    8e-09   
ref|XP_008465567.1|  PREDICTED: high mobility group B protein 7       58.5    9e-09   Cucumis melo [Oriental melon]
ref|XP_008810905.1|  PREDICTED: high mobility group B protein 7-like  58.9    9e-09   Phoenix dactylifera
ref|XP_008389062.1|  PREDICTED: high mobility group B protein 7-like  58.9    1e-08   
ref|XP_006288568.1|  hypothetical protein CARUB_v10001858mg           58.9    1e-08   Capsella rubella
ref|XP_006394608.1|  hypothetical protein EUTSA_v10004817mg           58.9    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_004150195.1|  PREDICTED: high mobility group B protein 7-like  58.2    2e-08   Cucumis sativus [cucumbers]
ref|XP_002874129.1|  hypothetical protein ARALYDRAFT_910356           57.8    2e-08   
gb|KJB49542.1|  hypothetical protein B456_008G147700                  57.8    2e-08   Gossypium raimondii
ref|NP_568431.1|  high-mobility group B6 protein                      58.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KJB49541.1|  hypothetical protein B456_008G147700                  57.8    2e-08   Gossypium raimondii
ref|XP_010940378.1|  PREDICTED: high mobility group B protein 7-like  57.4    3e-08   Elaeis guineensis
ref|XP_002873936.1|  hypothetical protein ARALYDRAFT_488801           57.4    3e-08   
ref|XP_011031229.1|  PREDICTED: high mobility group B protein 7-like  56.6    5e-08   Populus euphratica
gb|KHG07657.1|  High mobility group B 7 -like protein                 56.6    6e-08   Gossypium arboreum [tree cotton]
ref|XP_002310906.2|  hypothetical protein POPTR_0007s15320g           56.6    7e-08   Populus trichocarpa [western balsam poplar]
gb|ABK93630.1|  unknown                                               56.6    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008221094.1|  PREDICTED: high mobility group B protein 7-like  56.2    8e-08   Prunus mume [ume]
ref|XP_002513135.1|  DNA-binding protein MNB1B, putative              55.5    1e-07   Ricinus communis
ref|XP_002267697.2|  PREDICTED: high mobility group B protein 7       55.5    2e-07   
ref|XP_007043200.1|  High-mobility group box 6                        55.1    3e-07   
ref|XP_011070479.1|  PREDICTED: high mobility group B protein 7-like  54.3    4e-07   Sesamum indicum [beniseed]
ref|XP_004297711.1|  PREDICTED: high mobility group B protein 7-like  54.7    4e-07   Fragaria vesca subsp. vesca
ref|XP_006360847.1|  PREDICTED: high mobility group B protein 7-like  54.3    5e-07   Solanum tuberosum [potatoes]
ref|XP_010421143.1|  PREDICTED: high mobility group B protein 7-l...  53.5    5e-07   
emb|CDY64875.1|  BnaCnng45460D                                        54.3    8e-07   Brassica napus [oilseed rape]
ref|XP_009385984.1|  PREDICTED: high mobility group B protein 7-like  53.1    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802830.1|  PREDICTED: high mobility group B protein 7-like  53.1    1e-06   Phoenix dactylifera
ref|XP_010493464.1|  PREDICTED: high mobility group B protein 7-like  53.9    1e-06   Camelina sativa [gold-of-pleasure]
emb|CDY16851.1|  BnaA09g05310D                                        53.9    1e-06   Brassica napus [oilseed rape]
ref|XP_009141528.1|  PREDICTED: high mobility group B protein 7-like  53.9    1e-06   Brassica rapa
ref|XP_010421142.1|  PREDICTED: high mobility group B protein 7-l...  53.1    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007224613.1|  hypothetical protein PRUPE_ppa026912mg           52.4    2e-06   
gb|ABK23898.1|  unknown                                               52.8    2e-06   Picea sitchensis
ref|XP_010454621.1|  PREDICTED: high mobility group B protein 7-like  53.1    2e-06   Camelina sativa [gold-of-pleasure]
gb|EPS72473.1|  hypothetical protein M569_02286                       52.0    2e-06   Genlisea aurea
gb|KFK27649.1|  hypothetical protein AALP_AA8G410700                  52.8    3e-06   Arabis alpina [alpine rockcress]
ref|XP_008340417.1|  PREDICTED: high mobility group B protein 7-l...  51.6    7e-06   Malus domestica [apple tree]
gb|AFW65042.1|  hypothetical protein ZEAMMB73_846021                  49.7    1e-05   
ref|XP_009130115.1|  PREDICTED: high mobility group B protein 7-l...  50.8    1e-05   Brassica rapa
ref|XP_006848664.1|  hypothetical protein AMTR_s00171p00070550        50.4    1e-05   Amborella trichopoda
ref|XP_009130114.1|  PREDICTED: high mobility group B protein 7-l...  50.8    1e-05   Brassica rapa
dbj|BAK07893.1|  predicted protein                                    50.1    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH44448.1|  high mobility group (HMG)-box protein                 50.1    2e-05   Medicago truncatula
gb|ACG31059.1|  HMG1/2-like protein                                   50.1    2e-05   Zea mays [maize]
emb|CDP16974.1|  unnamed protein product                              50.1    2e-05   Coffea canephora [robusta coffee]
gb|EMS56844.1|  High mobility group B protein 7                       49.7    2e-05   Triticum urartu
emb|CDY46957.1|  BnaA02g32890D                                        50.1    3e-05   Brassica napus [oilseed rape]
ref|NP_001236719.1|  uncharacterized protein LOC100306558             49.7    3e-05   Glycine max [soybeans]
gb|KHN23128.1|  High mobility group B protein 7                       49.3    3e-05   Glycine soja [wild soybean]
ref|XP_007142737.1|  hypothetical protein PHAVU_007G012700g           49.3    3e-05   Phaseolus vulgaris [French bean]
emb|CDY40795.1|  BnaC02g41640D                                        50.1    3e-05   Brassica napus [oilseed rape]
ref|XP_002444850.1|  hypothetical protein SORBIDRAFT_07g000230        49.7    3e-05   Sorghum bicolor [broomcorn]
ref|XP_004972392.1|  PREDICTED: high mobility group B protein 7-l...  49.3    4e-05   Setaria italica
ref|XP_008677776.1|  PREDICTED: nucleosome/chromatin assembly fac...  49.7    4e-05   
gb|KDP40471.1|  hypothetical protein JCGZ_24470                       48.9    5e-05   Jatropha curcas
gb|KHN37346.1|  High mobility group B protein 7                       48.1    7e-05   Glycine soja [wild soybean]
ref|XP_003536758.1|  PREDICTED: high mobility group B protein 7-like  48.1    8e-05   Glycine max [soybeans]
ref|XP_004497257.1|  PREDICTED: high mobility group B protein 7-l...  47.8    9e-05   Cicer arietinum [garbanzo]
ref|XP_004497256.1|  PREDICTED: high mobility group B protein 7-l...  48.1    9e-05   Cicer arietinum [garbanzo]
gb|AFK37944.1|  unknown                                               47.0    2e-04   Lotus japonicus
ref|XP_009799133.1|  PREDICTED: high mobility group B protein 7-like  45.4    3e-04   Nicotiana sylvestris
ref|XP_004972391.1|  PREDICTED: high mobility group B protein 7-l...  47.0    4e-04   



>gb|EYU35548.1| hypothetical protein MIMGU_mgv1a012961mg [Erythranthe guttata]
Length=234

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SSNA R+RKRVEVD++ SS    +LKRA+DGSAFA+C+EC KDVPVALIS
Sbjct  8    SSNASRLRKRVEVDTD-SSATTMALKRARDGSAFAKCEECNKDVPVALIS  56



>ref|XP_009630975.1| PREDICTED: high mobility group B protein 7-like [Nicotiana tomentosiformis]
Length=223

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 5/52 (10%)
 Frame = +3

Query  102  KSSNAP-RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            K+SN P RVRKRVEV+S       ASLKRAKDGSAFARC+EC KDVP+ALI+
Sbjct  8    KNSNGPTRVRKRVEVES----ATAASLKRAKDGSAFARCEECNKDVPIALIN  55



>ref|XP_010034169.1| PREDICTED: high mobility group B protein 7 [Eucalyptus grandis]
 gb|KCW50636.1| hypothetical protein EUGRSUZ_J00336 [Eucalyptus grandis]
Length=245

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SNAP+ RKRVEVD+  ++  ++SL R KDGSAFARC+EC KDVPVALIS
Sbjct  9    SNAPKARKRVEVDAAAAAAASSSLVRGKDGSAFARCEECNKDVPVALIS  57



>ref|XP_009797250.1| PREDICTED: high mobility group B protein 7-like [Nicotiana sylvestris]
Length=203

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = +3

Query  102  KSSNAP-RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            KSSN P RVRKRVEV     S   ASLKRAKDGSAFARC+EC KDVP+ALI+
Sbjct  8    KSSNGPTRVRKRVEV----VSATAASLKRAKDGSAFARCEECNKDVPIALIN  55



>ref|XP_004236870.1| PREDICTED: high mobility group B protein 7 [Solanum lycopersicum]
Length=215

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 3/45 (7%)
 Frame = +3

Query  120  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            RVRKRVEV+S  S+   ASLKRAKDGSAFARC+EC KDVP+ALIS
Sbjct  17   RVRKRVEVESAASA---ASLKRAKDGSAFARCEECSKDVPIALIS  58



>ref|XP_010546256.1| PREDICTED: high mobility group B protein 7 [Tarenaya hassleriana]
Length=233

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 2/49 (4%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            +NAP+ RKRVE +S  +S  +++L RAKDGSAFARC+EC +DVPVALIS
Sbjct  8    ANAPKPRKRVEAESANAS--SSTLLRAKDGSAFARCEECKRDVPVALIS  54



>ref|XP_010688617.1| PREDICTED: high mobility group B protein 7 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 3/52 (6%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINA---SLKRAKDGSAFARCDECXKDVPVALI  251
            SSN P+ RKRVE D+   +  +A   SLKRAKDGSAFARC+EC   VPVALI
Sbjct  7    SSNPPKQRKRVEADTPTEASSSAAMLSLKRAKDGSAFARCEECKSSVPVALI  58



>gb|KDO77003.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
Length=220

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SNAP+ RKRV  D+  +S  +A+L R +DGSAFARC+EC K+VPVALIS
Sbjct  7    SNAPKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALIS  53



>ref|XP_006448478.1| hypothetical protein CICLE_v10016587mg [Citrus clementina]
 gb|ESR61718.1| hypothetical protein CICLE_v10016587mg [Citrus clementina]
Length=224

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SNAP+ RKRV  D+  +S  +A+L R +DGSAFARC+EC K+VPVALIS
Sbjct  7    SNAPKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALIS  53



>ref|XP_006468697.1| PREDICTED: high mobility group B protein 7-like [Citrus sinensis]
Length=224

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SNAP+ RKRV  D+  +S  +A+L R +DGSAFARC+EC K+VPVALIS
Sbjct  7    SNAPKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALIS  53



>gb|KDO77000.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
 gb|KDO77001.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
 gb|KDO77002.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
Length=232

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SNAP+ RKRV  D+  +S  +A+L R +DGSAFARC+EC K+VPVALIS
Sbjct  7    SNAPKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALIS  53



>ref|XP_010248937.1| PREDICTED: high mobility group B protein 7-like [Nelumbo nucifera]
Length=195

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 7/49 (14%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            S + PR RKRVEV+        ++LKRAKDGSAF RC+EC KDVPV LI
Sbjct  6    SKSTPRARKRVEVE-------KSTLKRAKDGSAFTRCEECNKDVPVVLI  47



>ref|XP_010103584.1| High mobility group B protein 7 [Morus notabilis]
 gb|EXB96361.1| High mobility group B protein 7 [Morus notabilis]
Length=209

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN  + RKRVE  S ES+   ASL R KDGSAFARC+EC KDVPVALIS
Sbjct  8    SNPTKTRKRVEA-SQESTA--ASLVRGKDGSAFARCEECSKDVPVALIS  53



>ref|XP_008340418.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Malus 
domestica]
Length=234

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINAS------LKRAKDGSAFARCDECXKDVPVALIS  254
            SN  + RKRVE    E + ++ S      L R KDGSAFARCDEC KDVPVALI+
Sbjct  8    SNPTKARKRVEATETEENSLSMSTAPPLSLVRGKDGSAFARCDECNKDVPVALIT  62



>ref|NP_001190371.1| high-mobility group B6 protein [Arabidopsis thaliana]
 gb|AED93165.1| high-mobility group B6 protein [Arabidopsis thaliana]
Length=157

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            +SNAP+ RKRVE ++  SS  + +L+RAKDGSAFA C+ C K V VALIS
Sbjct  7    TSNAPKQRKRVEAET--SSNTSTTLRRAKDGSAFALCEGCNKSVAVALIS  54



>ref|XP_009351760.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009351761.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Pyrus 
x bretschneideri]
Length=223

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQIN------ASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN  + RKRVE    E + ++       SL R KDGSAFARCDEC KDVPVALI+
Sbjct  8    SNPTKARKRVEATETEENSLSMSTAPPPSLVRVKDGSAFARCDECNKDVPVALIT  62



>ref|XP_009351762.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Pyrus 
x bretschneideri]
Length=221

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 6/55 (11%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQIN------ASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN  + RKRVE    E + ++       SL R KDGSAFARCDEC KDVPVALI+
Sbjct  8    SNPTKARKRVEATETEENSLSMSTAPPPSLVRVKDGSAFARCDECNKDVPVALIT  62



>ref|XP_008465567.1| PREDICTED: high mobility group B protein 7 [Cucumis melo]
Length=153

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  120  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            + RKRVE    + +    SL RAKDGSAFARCDEC K VPVALIS
Sbjct  8    KSRKRVEATPADVAATGPSLVRAKDGSAFARCDECGKSVPVALIS  52



>ref|XP_008810905.1| PREDICTED: high mobility group B protein 7-like [Phoenix dactylifera]
Length=197

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 7/48 (15%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            +N PR RKRVE ++N       +LKRA+DGSAF RC+ C KDVPV LI
Sbjct  8    TNPPRARKRVEAETN-------TLKRARDGSAFTRCEACNKDVPVVLI  48



>ref|XP_008389062.1| PREDICTED: high mobility group B protein 7-like [Malus domestica]
Length=217

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVE---VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN  + R+RVE      N  S +  SL R KDGSAFARC+EC KDVPVALIS
Sbjct  8    SNPTKARRRVEATETGENSLSTVPPSLVRGKDGSAFARCEECNKDVPVALIS  59



>ref|XP_006288568.1| hypothetical protein CARUB_v10001858mg [Capsella rubella]
 gb|EOA21466.1| hypothetical protein CARUB_v10001858mg [Capsella rubella]
Length=236

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            ++NAP+ RKRVE +++ ++    +L+RAKDGSAFARC+ C K+V VALIS
Sbjct  7    TTNAPKPRKRVEAETSSNASTTTTLRRAKDGSAFARCEGCNKNVAVALIS  56



>ref|XP_006394608.1| hypothetical protein EUTSA_v10004817mg [Eutrema salsugineum]
 gb|ESQ31894.1| hypothetical protein EUTSA_v10004817mg [Eutrema salsugineum]
Length=251

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            +SNAP+ RKRVE ++   +    +L RAKDGSAFARC+ C K+V VALIS
Sbjct  8    NSNAPKQRKRVEAETKPETSNTNTLLRAKDGSAFARCEGCNKNVAVALIS  57



>ref|XP_004150195.1| PREDICTED: high mobility group B protein 7-like [Cucumis sativus]
 ref|XP_004172659.1| PREDICTED: high mobility group B protein 7-like [Cucumis sativus]
Length=207

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  120  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            + RKRVE    + +    SL RAKDGSAFARCDEC K VPVALIS
Sbjct  8    KSRKRVEATPADVAATGPSLVRAKDGSAFARCDECGKSVPVALIS  52



>ref|XP_002874129.1| hypothetical protein ARALYDRAFT_910356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50388.1| hypothetical protein ARALYDRAFT_910356 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            +SNAP+ RKRVE ++  S+  + +L+RAKDGSAFA C+ C K V VALIS
Sbjct  7    TSNAPKQRKRVEAET--STNTSTTLRRAKDGSAFALCEGCNKSVAVALIS  54



>gb|KJB49542.1| hypothetical protein B456_008G147700 [Gossypium raimondii]
Length=164

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN P+ RKRV+  S  +    +SL RAKDGSAFA+CDEC K VPVALI+
Sbjct  7    SNPPKPRKRVDAASAPAPAPASSLVRAKDGSAFAKCDECNKTVPVALIN  55



>ref|NP_568431.1| high-mobility group B6 protein [Arabidopsis thaliana]
 sp|Q8LDF9.1|HMGB7_ARATH RecName: Full=High mobility group B protein 7; AltName: Full=Nucleosome/chromatin 
assembly factor group D 07; Short=Nucleosome/chromatin 
assembly factor group D 7; AltName: Full=Protein 
NUCLEAR FUSION DEFECTIVE 7 [Arabidopsis thaliana]
 gb|AAM63233.1| unknown [Arabidopsis thaliana]
 dbj|BAC43282.1| unknown protein [Arabidopsis thaliana]
 gb|AED93164.1| high-mobility group B6 protein [Arabidopsis thaliana]
Length=241

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            +SNAP+ RKRVE ++  SS  + +L+RAKDGSAFA C+ C K V VALIS
Sbjct  7    TSNAPKQRKRVEAET--SSNTSTTLRRAKDGSAFALCEGCNKSVAVALIS  54



>gb|KJB49541.1| hypothetical protein B456_008G147700 [Gossypium raimondii]
Length=214

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN P+ RKRV+  S  +    +SL RAKDGSAFA+CDEC K VPVALI+
Sbjct  7    SNPPKPRKRVDAASAPAPAPASSLVRAKDGSAFAKCDECNKTVPVALIN  55



>ref|XP_010940378.1| PREDICTED: high mobility group B protein 7-like [Elaeis guineensis]
Length=193

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 7/48 (15%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            +N PR RKRVE ++N       +LKRA+DGSAF +C+ C KDVPV LI
Sbjct  8    TNPPRARKRVEAETN-------TLKRARDGSAFTKCEACNKDVPVVLI  48



>ref|XP_002873936.1| hypothetical protein ARALYDRAFT_488801 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50195.1| hypothetical protein ARALYDRAFT_488801 [Arabidopsis lyrata subsp. 
lyrata]
Length=224

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            +SNAP+ RKRVE +++ S+  + +L+RAKDGSAFA C+ C K V VALIS
Sbjct  7    TSNAPKQRKRVEAETS-SNNTSTTLRRAKDGSAFALCEGCNKSVAVALIS  55



>ref|XP_011031229.1| PREDICTED: high mobility group B protein 7-like [Populus euphratica]
Length=194

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  123  VRKRVEVDSNESS---QINASLKRAKDGSAFARCDECXKDVPVALIS  254
             +KRVE +S + S       SL RAKDGSAFA+C+EC KDVPVALIS
Sbjct  2    AKKRVEAESTDGSVDANTTTSLVRAKDGSAFAKCEECKKDVPVALIS  48



>gb|KHG07657.1| High mobility group B 7 -like protein [Gossypium arboreum]
Length=214

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN P+ RKRV+  S  +    +SL RAKDGSAFA+CDEC K VP+ALI+
Sbjct  7    SNPPKPRKRVDAASAPAPAPASSLVRAKDGSAFAKCDECNKTVPMALIN  55



>ref|XP_002310906.2| hypothetical protein POPTR_0007s15320g [Populus trichocarpa]
 gb|EEE91356.2| hypothetical protein POPTR_0007s15320g [Populus trichocarpa]
Length=201

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  123  VRKRVEVDSNESS---QINASLKRAKDGSAFARCDECXKDVPVALIS  254
             RKRVE +S + S       SL RAKDGSAF +C+EC KDVPVALIS
Sbjct  2    ARKRVEAESTDGSVDANTTTSLVRAKDGSAFTKCEECKKDVPVALIS  48



>gb|ABK93630.1| unknown [Populus trichocarpa]
Length=201

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = +3

Query  126  RKRVEVDSNESS---QINASLKRAKDGSAFARCDECXKDVPVALIS  254
            RKRVE +S + S       SL RAKDGSAF +C+EC KDVPVALIS
Sbjct  3    RKRVEAESTDGSVDANTTTSLVRAKDGSAFTKCEECKKDVPVALIS  48



>ref|XP_008221094.1| PREDICTED: high mobility group B protein 7-like [Prunus mume]
Length=206

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN  + RKRVE  + E S +  SL R KDGSAFARC+EC K+VPVALIS
Sbjct  8    SNPTKARKRVE--ATEESSV-PSLVRGKDGSAFARCEECNKNVPVALIS  53



>ref|XP_002513135.1| DNA-binding protein MNB1B, putative [Ricinus communis]
 gb|EEF49638.1| DNA-binding protein MNB1B, putative [Ricinus communis]
Length=196

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +3

Query  123  VRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
             RKRVE +  +++    S+ R KDGSAFARCDEC KDVPVALIS
Sbjct  2    ARKRVEAE--DTATAANSMVRGKDGSAFARCDECKKDVPVALIS  43



>ref|XP_002267697.2| PREDICTED: high mobility group B protein 7 [Vitis vinifera]
 emb|CAN61363.1| hypothetical protein VITISV_034306 [Vitis vinifera]
 emb|CBI35359.3| unnamed protein product [Vitis vinifera]
Length=190

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 7/46 (15%)
 Frame = +3

Query  114  APRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
             P+ RKRVE ++       +SLKRA+DGSAF RC+EC KDVPV LI
Sbjct  3    GPKQRKRVEAET-------SSLKRARDGSAFIRCEECKKDVPVVLI  41



>ref|XP_007043200.1| High-mobility group box 6 [Theobroma cacao]
 gb|EOX99031.1| High-mobility group box 6 [Theobroma cacao]
Length=210

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN P+ RKRV  D+  ++   +SL RAKDGSAFA+C+EC K VPVALIS
Sbjct  7    SNPPKPRKRV--DAASTAAPASSLVRAKDGSAFAKCEECNKTVPVALIS  53



>ref|XP_011070479.1| PREDICTED: high mobility group B protein 7-like [Sesamum indicum]
Length=210

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 4/50 (8%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
               A R+RKRVE      S  +++LKRAKDGSAFA+C+EC KDVPVALIS
Sbjct  3    GGGASRLRKRVEA----ESSSSSALKRAKDGSAFAKCEECNKDVPVALIS  48



>ref|XP_004297711.1| PREDICTED: high mobility group B protein 7-like [Fragaria vesca 
subsp. vesca]
Length=215

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            SN  R RKRVE  + + S    SL R KDGSAFARC+ C KDVPVA IS
Sbjct  8    SNPTRSRKRVEATAEDDSS-RPSLVRGKDGSAFARCEGCKKDVPVATIS  55



>ref|XP_006360847.1| PREDICTED: high mobility group B protein 7-like [Solanum tuberosum]
Length=215

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 4/51 (8%)
 Frame = +3

Query  105  SSNAP-RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            S+  P RVRKRV     ES+   ASLKRAKDGSAFARC+EC KDVP+ALIS
Sbjct  11   SNGGPTRVRKRV---EVESAAAAASLKRAKDGSAFARCEECSKDVPIALIS  58



>ref|XP_010421143.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Camelina 
sativa]
Length=170

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 3/53 (6%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINAS---LKRAKDGSAFARCDECXKDVPVALIS  254
            ++NAP+ RKRVE +++ ++    +   L+RAKDGSAFARC+ C K+V VALIS
Sbjct  7    NTNAPKPRKRVEAETSSNASSTTTTTTLRRAKDGSAFARCEGCNKNVAVALIS  59



>emb|CDY64875.1| BnaCnng45460D [Brassica napus]
Length=240

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDS-NESSQINAS--LKRAKDGSAFARCDECXKDVPVALIS  254
            SNA + RKRVE ++ +ES+  N S  L RAKDGSAFARC+ C K+V VALIS
Sbjct  12   SNAAKQRKRVEAETKDESTAKNNSNTLLRAKDGSAFARCEGCNKNVAVALIS  63



>ref|XP_009385984.1| PREDICTED: high mobility group B protein 7-like [Musa acuminata 
subsp. malaccensis]
Length=199

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 6/48 (13%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            SN PR RKRVE ++       ++LKRA+DGSAF RC+ C KDV V LI
Sbjct  8    SNPPRPRKRVEAETA------STLKRARDGSAFTRCEACKKDVAVVLI  49



>ref|XP_008802830.1| PREDICTED: high mobility group B protein 7-like [Phoenix dactylifera]
Length=193

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 7/48 (15%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            ++ PR RKRV  ++N       +LKRA+DGSAF RC+ C KDVPV LI
Sbjct  8    THPPRGRKRVGAETN-------TLKRARDGSAFTRCEACNKDVPVVLI  48



>ref|XP_010493464.1| PREDICTED: high mobility group B protein 7-like [Camelina sativa]
Length=238

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINAS-LKRAKDGSAFARCDECXKDVPVALIS  254
            ++NAP+ RKRVE +++ ++    + L+RAKDGSAFARC+ C K+V VALIS
Sbjct  7    NTNAPKPRKRVEAETSSNASTTTTTLRRAKDGSAFARCEGCNKNVAVALIS  57



>emb|CDY16851.1| BnaA09g05310D [Brassica napus]
Length=240

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDS-NESSQINAS--LKRAKDGSAFARCDECXKDVPVALIS  254
            SNA + RKRVE ++ +ES+  N S  L RAKDGSAFARC+ C K+V VALIS
Sbjct  12   SNAAKQRKRVEAETKDESTAKNNSNTLLRAKDGSAFARCEGCSKNVAVALIS  63



>ref|XP_009141528.1| PREDICTED: high mobility group B protein 7-like [Brassica rapa]
Length=246

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDS-NESSQINAS--LKRAKDGSAFARCDECXKDVPVALIS  254
            SNA + RKRVE ++ +ES+  N S  L RAKDGSAFARC+ C K+V VALIS
Sbjct  12   SNAAKQRKRVEAETKDESTAKNNSNTLLRAKDGSAFARCEGCSKNVAVALIS  63



>ref|XP_010421142.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Camelina 
sativa]
Length=238

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 3/53 (6%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINAS---LKRAKDGSAFARCDECXKDVPVALIS  254
            ++NAP+ RKRVE +++ ++    +   L+RAKDGSAFARC+ C K+V VALIS
Sbjct  7    NTNAPKPRKRVEAETSSNASSTTTTTTLRRAKDGSAFARCEGCNKNVAVALIS  59



>ref|XP_007224613.1| hypothetical protein PRUPE_ppa026912mg [Prunus persica]
 gb|EMJ25812.1| hypothetical protein PRUPE_ppa026912mg [Prunus persica]
Length=197

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = +3

Query  126  RKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            RKRVE  + E S +  SL R KDGSAFARC+EC K+VPVALIS
Sbjct  3    RKRVE--ATEESSV-PSLVRGKDGSAFARCEECNKNVPVALIS  42



>gb|ABK23898.1| unknown [Picea sitchensis]
Length=220

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 7/47 (15%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVAL  248
            +N PR RKRV+VD        A+LKRA+DGS F +CD C K +PVAL
Sbjct  9    TNPPRQRKRVDVDP-------ANLKRARDGSGFTKCDVCNKHIPVAL  48



>ref|XP_010454621.1| PREDICTED: high mobility group B protein 7-like [Camelina sativa]
Length=238

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 3/53 (6%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINAS---LKRAKDGSAFARCDECXKDVPVALIS  254
            ++NAP+ RKRVE +++ ++    +   L+RAKDGSAFARC+ C K+V VALIS
Sbjct  7    NTNAPKPRKRVEAETSSNASSTTTTTTLRRAKDGSAFARCEGCNKNVAVALIS  59



>gb|EPS72473.1| hypothetical protein M569_02286, partial [Genlisea aurea]
Length=174

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINAS--LKRAKDGSAFARCDECXKDVPVALI  251
            SSNA R+RKRVEV+S  S+  ++   LKRA+DGSAF +C+EC + V VALI
Sbjct  1    SSNASRLRKRVEVESASSTSSSSLPSLKRARDGSAFVKCEECNESVHVALI  51



>gb|KFK27649.1| hypothetical protein AALP_AA8G410700 [Arabis alpina]
Length=243

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 4/51 (8%)
 Frame = +3

Query  114  APRVRKRVEVDSNESSQINAS----LKRAKDGSAFARCDECXKDVPVALIS  254
            AP+ RKRVE ++ + +  N +    L RAKDGSAF RCDEC K+V VALIS
Sbjct  10   APKPRKRVEAETKDETSNNTTTTTTLLRAKDGSAFVRCDECSKNVAVALIS  60



>ref|XP_008340417.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Malus 
domestica]
Length=238

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 35/59 (59%), Gaps = 10/59 (17%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSNESSQINAS------LKRAKDGSAFARC----DECXKDVPVALIS  254
            SN  + RKRVE    E + ++ S      L R KDGSAFAR     DEC KDVPVALI+
Sbjct  8    SNPTKARKRVEATETEENSLSMSTAPPLSLVRGKDGSAFARWVWESDECNKDVPVALIT  66



>gb|AFW65042.1| hypothetical protein ZEAMMB73_846021 [Zea mays]
Length=123

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            + NA R RKRVE            LKR++DGSAF RC+ C KDVPV LI
Sbjct  7    TGNAARSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLI  46



>ref|XP_009130115.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Brassica 
rapa]
Length=214

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            S AP+ RKRVE +S     ++    +L RAKDGSAFA+C+ C K+V VALIS
Sbjct  10   STAPKARKRVEAESKPETTNNNNINTLLRAKDGSAFAKCEGCNKNVAVALIS  61



>ref|XP_006848664.1| hypothetical protein AMTR_s00171p00070550 [Amborella trichopoda]
 gb|ERN10245.1| hypothetical protein AMTR_s00171p00070550 [Amborella trichopoda]
Length=199

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 7/45 (16%)
 Frame = +3

Query  117  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            P+ RKRV+ D+        SLKRA+DGSAF +C+ C KDV VAL+
Sbjct  10   PKTRKRVDADT-------GSLKRARDGSAFMKCEACKKDVAVALV  47



>ref|XP_009130114.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Brassica 
rapa]
Length=243

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            S AP+ RKRVE +S     ++    +L RAKDGSAFA+C+ C K+V VALIS
Sbjct  10   STAPKARKRVEAESKPETTNNNNINTLLRAKDGSAFAKCEGCNKNVAVALIS  61



>dbj|BAK07893.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=215

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            + NAPR RKRVE            LKRA+DGSAF RC+ C KDV + LI
Sbjct  4    AGNAPRSRKRVEA---------TVLKRARDGSAFTRCEACNKDVAIVLI  43



>gb|KEH44448.1| high mobility group (HMG)-box protein [Medicago truncatula]
Length=210

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 5/47 (11%)
 Frame = +3

Query  114  APRVRKRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            A +  KRV+ VDS  +S     L RAKDGSAFA+CDEC KDVPVALI
Sbjct  2    ATKGTKRVDAVDSRSAS----VLVRAKDGSAFAKCDECKKDVPVALI  44



>gb|ACG31059.1| HMG1/2-like protein [Zea mays]
 gb|ACG39894.1| HMG1/2-like protein [Zea mays]
 gb|ACN31909.1| unknown [Zea mays]
 gb|AFW65041.1| HMG type nucleosome/chromatin assembly factor DNucleasome/chromatin 
assembly factor D protein NFD106 [Zea mays]
 gb|AIB05281.1| HMG transcription factor, partial [Zea mays]
Length=212

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            + NA R RKRVE            LKR++DGSAF RC+ C KDVPV LI
Sbjct  7    TGNAARSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLI  46



>emb|CDP16974.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 14/59 (24%)
 Frame = +3

Query  120  RVRKRVEVDSNE--------------SSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            R+RKRVEV+ N               ++  +++L RAKDGSAF +C EC KDV VALIS
Sbjct  5    RLRKRVEVEKNSSSSSTSPAASGKSNTTASSSTLLRAKDGSAFTKCGECNKDVAVALIS  63



>gb|EMS56844.1| High mobility group B protein 7 [Triticum urartu]
Length=216

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            + NAPR RKRVE            LKRA+DGSAF RC+ C KDV + LI
Sbjct  4    AGNAPRSRKRVEA---------TVLKRARDGSAFTRCEACNKDVAIVLI  43



>emb|CDY46957.1| BnaA02g32890D [Brassica napus]
Length=243

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            S AP+ RKRVE +S     ++    +L RAKDGSAFA+C+ C K+V VALIS
Sbjct  10   STAPKPRKRVEAESKPETTNNNNINTLLRAKDGSAFAKCEGCNKNVAVALIS  61



>ref|NP_001236719.1| uncharacterized protein LOC100306558 [Glycine max]
 gb|ACU14782.1| unknown [Glycine max]
Length=209

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 5/43 (12%)
 Frame = +3

Query  126  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            RKRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI
Sbjct  7    RKRVDAVDSRAAS----VLVRAKDGSAFARCDDCKKNVPVALI  45



>gb|KHN23128.1| High mobility group B protein 7 [Glycine soja]
Length=209

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 5/43 (12%)
 Frame = +3

Query  126  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            RKRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI
Sbjct  7    RKRVDAVDSRAAS----VLVRAKDGSAFARCDDCKKNVPVALI  45



>ref|XP_007142737.1| hypothetical protein PHAVU_007G012700g [Phaseolus vulgaris]
 gb|ESW14731.1| hypothetical protein PHAVU_007G012700g [Phaseolus vulgaris]
Length=199

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 5/47 (11%)
 Frame = +3

Query  114  APRVRKRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            A + RKRV+ VDS  +S     L RAKDGSAFARCD+C K+VPV LI
Sbjct  2    ASQTRKRVDAVDSRSAS----VLVRAKDGSAFARCDDCKKNVPVVLI  44



>emb|CDY40795.1| BnaC02g41640D [Brassica napus]
Length=249

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  108  SNAPRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            S AP+ RKRVE +S     ++    +L RAKDGSAFA+C+ C K+V VALIS
Sbjct  10   STAPKPRKRVEAESKPETTTNNNINTLLRAKDGSAFAKCEGCNKNVAVALIS  61



>ref|XP_002444850.1| hypothetical protein SORBIDRAFT_07g000230 [Sorghum bicolor]
 gb|EES14345.1| hypothetical protein SORBIDRAFT_07g000230 [Sorghum bicolor]
Length=221

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
              NA R RKRVE            LKR++DGSAF RC+ C KDVPV LI
Sbjct  7    GGNAARSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLI  46



>ref|XP_004972392.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Setaria 
italica]
Length=219

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            + NA R RKRVE            LKR++DGSAF RC+ C KDVPV LI
Sbjct  8    TGNAARSRKRVEA---------TILKRSRDGSAFTRCEACNKDVPVVLI  47



>ref|XP_008677776.1| PREDICTED: nucleosome/chromatin assembly factor D isoform X1 
[Zea mays]
Length=281

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            + NA R RKRVE            LKR++DGSAF RC+ C KDVPV LI
Sbjct  76   TGNAARSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLI  115



>gb|KDP40471.1| hypothetical protein JCGZ_24470 [Jatropha curcas]
Length=214

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +3

Query  126  RKRVEVDSNESSQIN--ASLKRAKDGSAFARCDECXKDVPVALIS  254
            +KRVE +SN  +      SL RA+DGSAF RC+EC K V VALIS
Sbjct  3    KKRVEAESNAGAAAGNTTSLIRARDGSAFTRCEECKKHVAVALIS  47



>gb|KHN37346.1| High mobility group B protein 7 [Glycine soja]
Length=200

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 5/43 (12%)
 Frame = +3

Query  126  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            +KRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI
Sbjct  7    KKRVDAVDSRAAS----VLLRAKDGSAFARCDDCKKNVPVALI  45



>ref|XP_003536758.1| PREDICTED: high mobility group B protein 7-like [Glycine max]
Length=200

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 5/43 (12%)
 Frame = +3

Query  126  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            +KRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI
Sbjct  7    KKRVDAVDSRAAS----VLLRAKDGSAFARCDDCKKNVPVALI  45



>ref|XP_004497257.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Cicer 
arietinum]
Length=201

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 31/42 (74%), Gaps = 5/42 (12%)
 Frame = +3

Query  129  KRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            KRV+ VDS  +S     L RAKDGSAFARC EC KDVPVALI
Sbjct  7    KRVDAVDSRAAS----VLVRAKDGSAFARCAECKKDVPVALI  44



>ref|XP_004497256.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Cicer 
arietinum]
Length=202

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 31/42 (74%), Gaps = 5/42 (12%)
 Frame = +3

Query  129  KRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            KRV+ VDS  +S     L RAKDGSAFARC EC KDVPVALI
Sbjct  7    KRVDAVDSRAAS----VLVRAKDGSAFARCAECKKDVPVALI  44



>gb|AFK37944.1| unknown [Lotus japonicus]
Length=197

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 5/44 (11%)
 Frame = +3

Query  126  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECXKDVPVALIS  254
            RKR++ VDS  +S     L R++DGSAFARC+EC K VPVALIS
Sbjct  6    RKRIDAVDSRAAS----VLVRSRDGSAFARCEECNKSVPVALIS  45



>ref|XP_009799133.1| PREDICTED: high mobility group B protein 7-like [Nicotiana sylvestris]
Length=94

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 5/42 (12%)
 Frame = +3

Query  102  KSSNAP-RVRKRVEVDSNESSQINASLKRAKDGSAFARCDEC  224
            KSSN P RVRK VEV+        ASLK AKDG+AFARC+EC
Sbjct  8    KSSNGPTRVRKPVEVEY----ATAASLKCAKDGNAFARCEEC  45



>ref|XP_004972391.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Setaria 
italica]
Length=278

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 9/49 (18%)
 Frame = +3

Query  105  SSNAPRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECXKDVPVALI  251
            + NA R RKRVE            LKR++DGSAF RC+ C KDVPV LI
Sbjct  8    TGNAARSRKRVEA---------TILKRSRDGSAFTRCEACNKDVPVVLI  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554004616485