BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013L20

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361429.1|  PREDICTED: putative glucuronosyltransferase ...    146   3e-38   Solanum tuberosum [potatoes]
ref|XP_006361430.1|  PREDICTED: putative glucuronosyltransferase ...    146   3e-38   Solanum tuberosum [potatoes]
ref|XP_004236792.1|  PREDICTED: inositol phosphorylceramide glucu...    144   3e-37   Solanum lycopersicum
ref|XP_010319283.1|  PREDICTED: inositol phosphorylceramide glucu...    143   4e-37   Solanum lycopersicum
ref|XP_009779488.1|  PREDICTED: putative glucuronosyltransferase ...    142   1e-36   Nicotiana sylvestris
ref|XP_009606765.1|  PREDICTED: putative glucuronosyltransferase ...    142   1e-36   Nicotiana tomentosiformis
ref|XP_004239742.1|  PREDICTED: inositol phosphorylceramide glucu...    140   5e-36   Solanum lycopersicum
ref|XP_006346008.1|  PREDICTED: putative glucuronosyltransferase ...    139   2e-35   Solanum tuberosum [potatoes]
ref|XP_002319122.1|  hypothetical protein POPTR_0013s04660g             137   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011038458.1|  PREDICTED: inositol phosphorylceramide glucu...    137   4e-35   Populus euphratica
ref|XP_011038459.1|  PREDICTED: inositol phosphorylceramide glucu...    137   4e-35   Populus euphratica
emb|CAN77613.1|  hypothetical protein VITISV_036932                     137   8e-35   Vitis vinifera
ref|XP_008218517.1|  PREDICTED: putative glucuronosyltransferase ...    136   9e-35   
ref|XP_007030331.1|  Plant glycogenin-like starch initiation prot...    136   1e-34   
ref|XP_007030330.1|  Plant glycogenin-like starch initiation prot...    136   1e-34   
ref|XP_006408154.1|  hypothetical protein EUTSA_v10021780mg             128   1e-34   
ref|XP_002266145.1|  PREDICTED: inositol phosphorylceramide glucu...    136   2e-34   Vitis vinifera
ref|XP_008370762.1|  PREDICTED: putative glucuronosyltransferase ...    135   2e-34   
ref|XP_009599298.1|  PREDICTED: putative glucuronosyltransferase ...    135   2e-34   Nicotiana tomentosiformis
ref|XP_006437461.1|  hypothetical protein CICLE_v10031149mg             134   3e-34   
gb|KHN31485.1|  Glycogenin-1                                            135   3e-34   Glycine soja [wild soybean]
gb|KDP23737.1|  hypothetical protein JCGZ_23570                         134   5e-34   Jatropha curcas
ref|XP_006604859.1|  PREDICTED: putative glucuronosyltransferase ...    134   5e-34   Glycine max [soybeans]
ref|XP_006604858.1|  PREDICTED: putative glucuronosyltransferase ...    134   5e-34   Glycine max [soybeans]
gb|KHG12487.1|  Glycogenin-1                                            134   5e-34   Gossypium arboreum [tree cotton]
ref|XP_009379742.1|  PREDICTED: putative glucuronosyltransferase ...    134   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_008366883.1|  PREDICTED: putative glucuronosyltransferase ...    134   6e-34   Malus domestica [apple tree]
ref|XP_006437460.1|  hypothetical protein CICLE_v10031149mg             134   7e-34   Citrus clementina [clementine]
ref|XP_006484615.1|  PREDICTED: putative glucuronosyltransferase ...    134   7e-34   Citrus sinensis [apfelsine]
ref|XP_009343790.1|  PREDICTED: putative glucuronosyltransferase ...    134   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_011101631.1|  PREDICTED: inositol phosphorylceramide glucu...    135   1e-33   
gb|EPS68223.1|  hypothetical protein M569_06549                         133   1e-33   Genlisea aurea
gb|KDO49229.1|  hypothetical protein CISIN_1g008931mg                   132   2e-33   Citrus sinensis [apfelsine]
gb|KJB82307.1|  hypothetical protein B456_013G188300                    132   2e-33   Gossypium raimondii
ref|XP_009401946.1|  PREDICTED: putative glucuronosyltransferase ...    132   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675056.1|  PREDICTED: inositol phosphorylceramide glucu...    132   2e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB82306.1|  hypothetical protein B456_013G188300                    132   3e-33   Gossypium raimondii
gb|KDO49228.1|  hypothetical protein CISIN_1g008931mg                   132   4e-33   Citrus sinensis [apfelsine]
gb|KCW61484.1|  hypothetical protein EUGRSUZ_H04216                     131   4e-33   Eucalyptus grandis [rose gum]
ref|XP_010102196.1|  hypothetical protein L484_024477                   132   5e-33   
gb|ABR16625.1|  unknown                                                 132   5e-33   Picea sitchensis
ref|XP_003591002.1|  hypothetical protein MTR_1g080670                  124   6e-33   
ref|XP_009384656.1|  PREDICTED: LOW QUALITY PROTEIN: putative glu...    131   6e-33   
ref|XP_004302108.1|  PREDICTED: inositol phosphorylceramide glucu...    131   7e-33   Fragaria vesca subsp. vesca
ref|XP_010024933.1|  PREDICTED: putative glucuronosyltransferase ...    131   1e-32   Eucalyptus grandis [rose gum]
gb|ABZ89190.1|  hypothetical protein 46C02.16                           130   1e-32   Coffea canephora [robusta coffee]
emb|CDO99980.1|  unnamed protein product                                130   1e-32   Coffea canephora [robusta coffee]
ref|XP_006400396.1|  hypothetical protein EUTSA_v10013196mg             130   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_010247242.1|  PREDICTED: inositol phosphorylceramide glucu...    130   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006606473.1|  PREDICTED: putative glucuronosyltransferase ...    129   3e-32   Glycine max [soybeans]
ref|XP_008441775.1|  PREDICTED: putative glucuronosyltransferase ...    129   3e-32   Cucumis melo [Oriental melon]
ref|XP_009126256.1|  PREDICTED: putative glucuronosyltransferase ...    129   3e-32   Brassica rapa
ref|XP_004152810.1|  PREDICTED: putative glucuronosyltransferase ...    129   3e-32   Cucumis sativus [cucumbers]
ref|XP_003556480.1|  PREDICTED: putative glucuronosyltransferase ...    129   3e-32   Glycine max [soybeans]
emb|CDY58112.1|  BnaA02g35140D                                          129   4e-32   Brassica napus [oilseed rape]
emb|CDY21129.1|  BnaA01g33600D                                          129   4e-32   Brassica napus [oilseed rape]
emb|CAH67224.1|  OSIGBa0145M07.6                                        128   4e-32   Oryza sativa [red rice]
ref|XP_009125000.1|  PREDICTED: putative glucuronosyltransferase ...    129   4e-32   Brassica rapa
ref|XP_006653601.1|  PREDICTED: putative glucuronosyltransferase ...    129   4e-32   Oryza brachyantha
ref|XP_002446789.1|  hypothetical protein SORBIDRAFT_06g022680          129   6e-32   Sorghum bicolor [broomcorn]
gb|EEC77645.1|  hypothetical protein OsI_16652                          129   7e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_010463911.1|  PREDICTED: inositol phosphorylceramide glucu...    129   7e-32   Camelina sativa [gold-of-pleasure]
gb|AAL58891.1|AF462795_1  AT5g18480/F20L16_200                          128   7e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAE05448.4|  OSJNBa0073E02.8                                        128   8e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_197349.2|  plant glycogenin-like starch initiation protein 6     128   8e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70822.1|  BnaC03g09060D                                          128   9e-32   
ref|XP_008807617.1|  PREDICTED: putative glucuronosyltransferase ...    128   1e-31   Phoenix dactylifera
emb|CDX88935.1|  BnaA03g07140D                                          128   1e-31   
ref|XP_010922963.1|  PREDICTED: inositol phosphorylceramide glucu...    128   1e-31   Elaeis guineensis
ref|XP_004976232.1|  PREDICTED: putative glucuronosyltransferase ...    129   1e-31   Setaria italica
ref|XP_010413938.1|  PREDICTED: inositol phosphorylceramide glucu...    127   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007147201.1|  hypothetical protein PHAVU_006G104100g             127   1e-31   Phaseolus vulgaris [French bean]
ref|XP_010485804.1|  PREDICTED: inositol phosphorylceramide glucu...    127   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006297372.1|  hypothetical protein CARUB_v10013391mg             127   2e-31   Capsella rubella
dbj|BAJ88570.1|  predicted protein                                      127   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH24575.1|  glucuronosyltransferase PGSIP8                          127   2e-31   Medicago truncatula
ref|XP_007205021.1|  hypothetical protein PRUPE_ppa003817mg             127   2e-31   
emb|CDY02625.1|  BnaC02g08100D                                          127   3e-31   
ref|XP_007143949.1|  hypothetical protein PHAVU_007G116100g             127   3e-31   Phaseolus vulgaris [French bean]
gb|KFK37856.1|  hypothetical protein AALP_AA3G038100                    126   4e-31   Arabis alpina [alpine rockcress]
ref|XP_010558734.1|  PREDICTED: inositol phosphorylceramide glucu...    126   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_006287478.1|  hypothetical protein CARUB_v10000689mg             126   6e-31   Capsella rubella
ref|XP_010492852.1|  PREDICTED: inositol phosphorylceramide glucu...    126   6e-31   Camelina sativa [gold-of-pleasure]
emb|CDY29996.1|  BnaC01g40120D                                          126   6e-31   Brassica napus [oilseed rape]
ref|XP_010420611.1|  PREDICTED: inositol phosphorylceramide glucu...    126   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008661816.1|  PREDICTED: uncharacterized protein LOC100279...    125   6e-31   Zea mays [maize]
ref|NP_001146086.1|  uncharacterized protein LOC100279618 precursor     125   7e-31   Zea mays [maize]
ref|XP_010454088.1|  PREDICTED: inositol phosphorylceramide glucu...    125   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002873897.1|  hypothetical protein ARALYDRAFT_488728             125   8e-31   
ref|XP_004494729.1|  PREDICTED: putative glucuronosyltransferase ...    125   9e-31   Cicer arietinum [garbanzo]
ref|XP_006408197.1|  hypothetical protein EUTSA_v10020458mg             125   1e-30   Eutrema salsugineum [saltwater cress]
gb|AIL52751.1|  putative glucuronosyltransferase PGSIP6-like protein    125   1e-30   Dendrobium officinale
ref|XP_002522004.1|  glycogenin, putative                               126   2e-30   
gb|EYU19884.1|  hypothetical protein MIMGU_mgv1a004141mg                124   2e-30   Erythranthe guttata [common monkey flower]
gb|KHN43170.1|  Glycogenin-1                                            126   3e-30   Glycine soja [wild soybean]
gb|KFK26089.1|  hypothetical protein AALP_AA8G201300                    124   3e-30   Arabis alpina [alpine rockcress]
gb|AFK39755.1|  unknown                                                 124   4e-30   Lotus japonicus
ref|XP_003590989.1|  Glycogenin-1                                       123   8e-30   Medicago truncatula
ref|XP_006648850.1|  PREDICTED: putative glucuronosyltransferase ...    122   1e-29   Oryza brachyantha
gb|KHN14829.1|  Glycogenin-1                                            121   2e-29   Glycine soja [wild soybean]
ref|XP_003580141.1|  PREDICTED: inositol phosphorylceramide glucu...    121   3e-29   Brachypodium distachyon [annual false brome]
ref|XP_004495592.1|  PREDICTED: putative glucuronosyltransferase ...    121   3e-29   Cicer arietinum [garbanzo]
ref|XP_009131669.1|  PREDICTED: putative glucuronosyltransferase ...    120   5e-29   Brassica rapa
gb|EEC73629.1|  hypothetical protein OsI_08135                          120   9e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001047475.1|  Os02g0624400                                       120   1e-28   
ref|XP_010104622.1|  hypothetical protein L484_021999                   121   1e-28   
ref|XP_010104620.1|  hypothetical protein L484_021997                   119   3e-28   Morus notabilis
ref|XP_001784830.1|  predicted protein                                  117   9e-28   
ref|XP_010235727.1|  PREDICTED: LOW QUALITY PROTEIN: inositol pho...    117   2e-27   
dbj|BAK04525.1|  predicted protein                                      115   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002962043.1|  hypothetical protein SELMODRAFT_62883              114   1e-26   
ref|XP_002971046.1|  hypothetical protein SELMODRAFT_62885              114   1e-26   
ref|XP_001759731.1|  predicted protein                                  109   8e-25   
ref|XP_006852965.1|  hypothetical protein AMTR_s01206p00007610        90.9    1e-20   
gb|KGN61304.1|  hypothetical protein Csa_2G078080                     91.7    1e-20   
gb|KJB44790.1|  hypothetical protein B456_007G273500                  95.9    2e-20   Gossypium raimondii
gb|AFW58865.1|  hypothetical protein ZEAMMB73_149865                  89.4    8e-20   
gb|KDD73670.1|  hypothetical protein H632_c1943p0                     80.9    3e-15   Helicosporidium sp. ATCC 50920
ref|XP_001702759.1|  predicted protein                                75.9    2e-14   Chlamydomonas reinhardtii
ref|XP_005844956.1|  hypothetical protein CHLNCDRAFT_138328           79.0    6e-14   Chlorella variabilis
emb|CBN79165.1|  Glycosyltransferase, family GT8                      73.2    7e-12   Ectocarpus siliculosus
gb|EMS55946.1|  Glycogenin-1                                          71.2    2e-11   Triticum urartu
ref|XP_002954821.1|  hypothetical protein VOLCADRAFT_106550           71.2    2e-11   Volvox carteri f. nagariensis
ref|XP_010921630.1|  PREDICTED: putative UDP-glucuronate:xylan al...  62.0    3e-08   Elaeis guineensis
ref|XP_010921631.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  62.0    3e-08   Elaeis guineensis
ref|XP_010428781.1|  PREDICTED: putative UDP-glucuronate:xylan al...  62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010471900.1|  PREDICTED: putative UDP-glucuronate:xylan al...  62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010416641.1|  PREDICTED: putative UDP-glucuronate:xylan al...  62.0    3e-08   Camelina sativa [gold-of-pleasure]
gb|EMT33175.1|  hypothetical protein F775_16539                       62.0    3e-08   
ref|XP_006302009.1|  hypothetical protein CARUB_v10019986mg           59.7    2e-07   Capsella rubella
gb|AIA93768.1|  mannosyl_trans3                                       55.8    2e-07   uncultured bacterium
ref|XP_002992480.1|  hypothetical protein SELMODRAFT_135481           58.5    4e-07   
ref|XP_011466789.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  57.8    6e-07   Fragaria vesca subsp. vesca
ref|XP_003568405.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  57.4    9e-07   Brachypodium distachyon [annual false brome]
ref|XP_002889125.1|  hypothetical protein ARALYDRAFT_476876           57.0    1e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_003564767.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  56.6    1e-06   Brachypodium distachyon [annual false brome]
ref|XP_010674823.1|  PREDICTED: putative UDP-glucuronate:xylan al...  56.6    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006406580.1|  hypothetical protein EUTSA_v10020243mg           56.6    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006645120.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  56.6    2e-06   Oryza brachyantha
ref|NP_177838.2|  putative UDP-glucuronate:xylan alpha-glucuronos...  56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87020.1|  predicted protein                                    55.8    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS60482.1|  hypothetical protein M569_14321                       55.5    2e-06   Genlisea aurea
ref|XP_011406812.1|  PREDICTED: inositol phosphorylceramide glucu...  55.8    2e-06   Amphimedon queenslandica
gb|EEC79261.1|  hypothetical protein OsI_20036                        56.2    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010680250.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  56.2    2e-06   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA44094.1|  TPA: hypothetical protein ZEAMMB73_670696            55.8    2e-06   
gb|AAS90653.1|  putative glycogenin                                   56.2    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KCW62287.1|  hypothetical protein EUGRSUZ_H04942                   56.2    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010025567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  56.2    2e-06   Eucalyptus grandis [rose gum]
gb|AAC34345.1|  Unknown protein                                       56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|EEE63788.1|  hypothetical protein OsJ_18611                        56.2    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KFK39187.1|  hypothetical protein AALP_AA3G211300                  56.2    3e-06   Arabis alpina [alpine rockcress]
dbj|BAJ87861.1|  predicted protein                                    55.1    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008803691.1|  PREDICTED: putative UDP-glucuronate:xylan al...  55.8    3e-06   
gb|AGT16755.1|  glycogenin                                            55.5    4e-06   Saccharum hybrid cultivar R570
ref|XP_002280832.1|  PREDICTED: putative UDP-glucuronate:xylan al...  55.1    4e-06   Vitis vinifera
emb|CAN81983.1|  hypothetical protein VITISV_042631                   55.1    4e-06   Vitis vinifera
ref|NP_001189927.1|  plant glycogenin-like starch initiation prot...  55.5    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566615.1|  plant glycogenin-like starch initiation protein 1   55.5    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001030722.1|  plant glycogenin-like starch initiation prot...  55.5    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885270.1|  hypothetical protein ARALYDRAFT_479372           55.5    5e-06   
ref|XP_010487789.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  55.5    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010507061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  55.5    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009112567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  55.5    5e-06   Brassica rapa
emb|CDY18535.1|  BnaA01g26600D                                        55.5    5e-06   Brassica napus [oilseed rape]
ref|XP_010465976.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  55.5    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009112560.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  55.5    5e-06   Brassica rapa
ref|XP_006297149.1|  hypothetical protein CARUB_v10013152mg           55.5    5e-06   Capsella rubella
gb|EEC71899.1|  hypothetical protein OsI_04661                        55.1    5e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001044991.1|  Os01g0880200                                     55.1    5e-06   
ref|XP_011405481.1|  PREDICTED: inositol phosphorylceramide glucu...  54.7    5e-06   Amphimedon queenslandica
ref|XP_009404954.1|  PREDICTED: putative UDP-glucuronate:xylan al...  55.1    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404956.1|  PREDICTED: putative UDP-glucuronate:xylan al...  55.1    6e-06   
ref|XP_006588938.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.2    6e-06   
ref|XP_004985459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  54.7    7e-06   Setaria italica
gb|KHN09596.1|  Glycogenin-1                                          54.7    7e-06   Glycine soja [wild soybean]
ref|XP_002468380.1|  hypothetical protein SORBIDRAFT_01g044930        54.7    7e-06   Sorghum bicolor [broomcorn]
ref|XP_008674740.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  54.7    7e-06   
ref|XP_004985458.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  54.7    7e-06   Setaria italica
ref|XP_008654538.1|  PREDICTED: uncharacterized protein LOC100272...  54.7    8e-06   
ref|XP_002456736.1|  hypothetical protein SORBIDRAFT_03g041660        54.7    8e-06   Sorghum bicolor [broomcorn]
gb|KCW44877.1|  hypothetical protein EUGRSUZ_L01540                   54.3    8e-06   Eucalyptus grandis [rose gum]
ref|XP_009348497.1|  PREDICTED: putative UDP-glucuronate:xylan al...  54.7    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_006858468.1|  hypothetical protein AMTR_s00071p00107830        54.3    8e-06   Amborella trichopoda
tpg|DAA56540.1|  TPA: hypothetical protein ZEAMMB73_374443            54.3    9e-06   
ref|XP_008373920.1|  PREDICTED: putative UDP-glucuronate:xylan al...  54.3    9e-06   Malus domestica [apple tree]
ref|XP_010040835.1|  PREDICTED: putative UDP-glucuronate:xylan al...  54.3    9e-06   Eucalyptus grandis [rose gum]
ref|XP_010040834.1|  PREDICTED: putative UDP-glucuronate:xylan al...  54.3    9e-06   Eucalyptus grandis [rose gum]
gb|EYU29759.1|  hypothetical protein MIMGU_mgv1a017852mg              54.3    9e-06   Erythranthe guttata [common monkey flower]
emb|CDY53768.1|  BnaC01g43920D                                        54.3    9e-06   Brassica napus [oilseed rape]
gb|KHG12057.1|  Glycogenin-2                                          54.3    9e-06   Gossypium arboreum [tree cotton]
ref|NP_001049188.2|  Os03g0184300                                     54.3    9e-06   
gb|KDP24792.1|  hypothetical protein JCGZ_25413                       54.3    1e-05   Jatropha curcas
gb|EAY88814.1|  hypothetical protein OsI_10286                        54.3    1e-05   Oryza sativa Indica Group [Indian rice]
gb|AAK92624.1|AC079633_4  Putative glycogenin                         54.3    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABK25357.1|  unknown                                               53.9    1e-05   Picea sitchensis
gb|KHG15344.1|  Glycogenin-2                                          53.9    1e-05   Gossypium arboreum [tree cotton]
gb|KHN31133.1|  Glycogenin-2                                          53.9    1e-05   Glycine soja [wild soybean]
ref|XP_006581757.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.9    1e-05   Glycine max [soybeans]
ref|XP_006578795.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.9    1e-05   Glycine max [soybeans]
ref|XP_002441128.1|  hypothetical protein SORBIDRAFT_09g020930        53.9    1e-05   Sorghum bicolor [broomcorn]
ref|XP_010040896.1|  PREDICTED: putative UDP-glucuronate:xylan al...  53.5    1e-05   
tpg|DAA43741.1|  TPA: hypothetical protein ZEAMMB73_319049            53.5    1e-05   
ref|XP_008673893.1|  PREDICTED: hypothetical protein isoform X1       53.5    1e-05   Zea mays [maize]
dbj|BAJ85213.1|  predicted protein                                    53.5    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97980.1|  predicted protein                                    53.5    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001777541.1|  predicted protein                                53.5    1e-05   
ref|XP_001783069.1|  predicted protein                                53.5    2e-05   
ref|NP_001130837.1|  hypothetical protein                             53.5    2e-05   Zea mays [maize]
gb|EMT13493.1|  Glycogenin-1                                          53.5    2e-05   
dbj|BAJ87677.1|  predicted protein                                    53.5    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55920.1|  Glycogenin-1                                          53.5    2e-05   Triticum urartu
emb|CDM85463.1|  unnamed protein product                              53.5    2e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002990211.1|  hypothetical protein SELMODRAFT_131094           53.5    2e-05   
ref|XP_008647982.1|  PREDICTED: LOC100286027 isoform X2               53.5    2e-05   
gb|EMT19434.1|  Glycogenin-1                                          53.5    2e-05   
gb|EPS63087.1|  hypothetical protein M569_11696                       53.1    2e-05   Genlisea aurea
ref|XP_010040839.1|  PREDICTED: putative UDP-glucuronate:xylan al...  53.5    2e-05   Eucalyptus grandis [rose gum]
gb|KJB71319.1|  hypothetical protein B456_011G116600                  53.5    2e-05   Gossypium raimondii
dbj|BAG90458.1|  unnamed protein product                              53.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001756144.1|  predicted protein                                53.5    2e-05   
ref|XP_008647980.1|  PREDICTED: LOC100286027 isoform X1               53.5    2e-05   
ref|NP_001152387.1|  LOC100286027                                     53.5    2e-05   
gb|KJB71320.1|  hypothetical protein B456_011G116600                  53.5    2e-05   Gossypium raimondii
emb|CDP15517.1|  unnamed protein product                              53.5    2e-05   Coffea canephora [robusta coffee]
gb|KDO58344.1|  hypothetical protein CISIN_1g006648mg                 53.5    2e-05   Citrus sinensis [apfelsine]
gb|EAZ14371.1|  hypothetical protein OsJ_04291                        53.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539696.1|  PREDICTED: putative UDP-glucuronate:xylan al...  53.5    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010539695.1|  PREDICTED: putative UDP-glucuronate:xylan al...  53.5    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_011078977.1|  PREDICTED: putative UDP-glucuronate:xylan al...  53.1    2e-05   
ref|XP_004499062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.1    2e-05   Cicer arietinum [garbanzo]
ref|XP_008441030.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.1    2e-05   Cucumis melo [Oriental melon]
gb|KGN48367.1|  hypothetical protein Csa_6G483470                     53.1    2e-05   Cucumis sativus [cucumbers]
ref|XP_004148647.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.1    2e-05   
ref|XP_004499061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.1    2e-05   Cicer arietinum [garbanzo]
ref|XP_004163053.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  53.1    2e-05   
ref|XP_010550282.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.1    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010550280.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  53.1    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_002453984.1|  hypothetical protein SORBIDRAFT_04g022700        53.1    2e-05   
ref|XP_004166220.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...  53.1    2e-05   
ref|XP_004148815.1|  PREDICTED: putative UDP-glucuronate:xylan al...  53.1    2e-05   Cucumis sativus [cucumbers]
gb|KJB40458.1|  hypothetical protein B456_007G064800                  53.1    3e-05   Gossypium raimondii
ref|XP_010244025.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_004972256.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.8    3e-05   Setaria italica
ref|XP_011007558.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.8    3e-05   Populus euphratica
ref|XP_010244020.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008441557.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    3e-05   Cucumis melo [Oriental melon]
ref|XP_007019401.1|  Plant glycogenin-like starch initiation prot...  52.8    3e-05   
gb|KJB60000.1|  hypothetical protein B456_009G284700                  52.8    3e-05   Gossypium raimondii
gb|KJB59999.1|  hypothetical protein B456_009G284700                  52.8    3e-05   Gossypium raimondii
ref|XP_008373921.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    3e-05   Malus domestica [apple tree]
gb|EYU18058.1|  hypothetical protein MIMGU_mgv1a018384mg              52.8    3e-05   Erythranthe guttata [common monkey flower]
ref|XP_010090867.1|  hypothetical protein L484_020727                 52.8    3e-05   
ref|XP_010911800.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    3e-05   Elaeis guineensis
ref|XP_010911799.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.8    3e-05   Elaeis guineensis
ref|XP_006427798.1|  hypothetical protein CICLE_v10025272mg           52.8    3e-05   
ref|XP_006464622.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.8    3e-05   Citrus sinensis [apfelsine]
ref|XP_002307022.2|  hypothetical protein POPTR_0005s06280g           52.8    3e-05   
ref|XP_002517237.1|  glycogenin, putative                             52.4    3e-05   
ref|XP_003589196.1|  Glycogenin glucosyltransferase                   52.4    3e-05   
ref|XP_006851095.1|  hypothetical protein AMTR_s00025p00245930        52.4    4e-05   
ref|XP_011007557.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.4    4e-05   Populus euphratica
ref|XP_011007559.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.4    4e-05   Populus euphratica
ref|XP_010108604.1|  hypothetical protein L484_006335                 52.4    4e-05   Morus notabilis
ref|XP_006383614.1|  hypothetical protein POPTR_0005s21030g           52.4    4e-05   
ref|XP_003525117.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.4    4e-05   Glycine max [soybeans]
ref|XP_004290562.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.4    4e-05   Fragaria vesca subsp. vesca
ref|XP_010110482.1|  hypothetical protein L484_003528                 52.4    4e-05   
gb|KHG14645.1|  Glycogenin-2                                          52.4    4e-05   Gossypium arboreum [tree cotton]
ref|XP_007048325.1|  Plant glycogenin-like starch initiation prot...  52.4    4e-05   
ref|XP_010999819.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.4    4e-05   Populus euphratica
gb|EMS63875.1|  Glycogenin-2                                          52.0    4e-05   Triticum urartu
ref|XP_002307480.2|  hypothetical protein POPTR_0005s21030g           52.4    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002680840.1|  predicted protein                                51.6    4e-05   Naegleria gruberi strain NEG-M
emb|CDX92257.1|  BnaA05g21500D                                        52.4    4e-05   
ref|XP_009396821.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   
ref|XP_003602583.1|  Secondary cell wall-related glycosyltransfer...  52.0    5e-05   Medicago truncatula
ref|XP_004502919.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   Cicer arietinum [garbanzo]
gb|KCW71171.1|  hypothetical protein EUGRSUZ_F04263                   51.6    5e-05   Eucalyptus grandis [rose gum]
emb|CDJ03150.1|  glycogenin 1                                         52.4    5e-05   
ref|XP_009776715.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   
ref|XP_009776714.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   
ref|XP_009776713.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   
ref|XP_009776712.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   
ref|XP_009414600.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   
gb|KFK44245.1|  hypothetical protein AALP_AA1G233800                  52.0    5e-05   
gb|KFK44246.1|  hypothetical protein AALP_AA1G233800                  52.0    5e-05   
ref|XP_010680014.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.0    5e-05   
ref|XP_004237736.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.0    6e-05   
ref|XP_009145872.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  52.0    6e-05   
ref|XP_002969245.1|  hypothetical protein SELMODRAFT_1169             51.6    6e-05   
gb|KDO83632.1|  hypothetical protein CISIN_1g043696mg                 51.6    6e-05   
emb|CDY50243.1|  BnaA06g15200D                                        52.0    7e-05   
ref|XP_004498382.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.6    7e-05   
emb|CDY04633.1|  BnaC05g16710D                                        51.6    7e-05   
gb|KHN34064.1|  Glycogenin-2                                          51.6    7e-05   
ref|XP_008786543.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.6    7e-05   
ref|XP_010916627.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.6    7e-05   
ref|XP_006485174.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.6    7e-05   
ref|XP_006472929.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.6    7e-05   
ref|XP_006434392.1|  hypothetical protein CICLE_v10003328mg           51.6    7e-05   
ref|XP_007048327.1|  Plant glycogenin-like starch initiation prot...  51.6    7e-05   
gb|EUB64857.1|  Glycogenin-1                                          49.3    7e-05   
ref|XP_007048326.1|  Plant glycogenin-like starch initiation prot...  51.6    7e-05   
ref|XP_002510223.1|  glycogenin, putative                             51.6    7e-05   
ref|XP_010916626.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.6    7e-05   
ref|XP_002997946.1|  glycosyl transferase, putative                   51.6    7e-05   
gb|KHN41007.1|  Glycogenin-2                                          51.6    7e-05   
ref|XP_003518352.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.6    7e-05   
gb|KJB80585.1|  hypothetical protein B456_013G105100                  51.2    8e-05   
gb|KDO84195.1|  hypothetical protein CISIN_1g007705mg                 51.2    8e-05   
ref|XP_006434785.1|  hypothetical protein CICLE_v10000658mg           51.2    8e-05   
ref|XP_002960603.1|  hypothetical protein SELMODRAFT_1168             51.2    8e-05   
ref|XP_006654430.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.2    8e-05   
gb|KHG03827.1|  Glycogenin-2                                          51.2    8e-05   
ref|XP_006473886.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.2    8e-05   
gb|KJB80584.1|  hypothetical protein B456_013G105100                  51.2    8e-05   
gb|KHG05573.1|  Glycogenin-2                                          51.2    8e-05   
ref|XP_009404011.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.2    8e-05   
ref|XP_006356283.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.2    8e-05   
ref|XP_006356282.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.2    8e-05   
ref|XP_009408314.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.2    9e-05   
ref|WP_017345907.1|  glycosyl transferase                             50.8    9e-05   
ref|XP_007137705.1|  hypothetical protein PHAVU_009G148800g           51.2    9e-05   
ref|XP_003589198.1|  Glycogenin glucosyltransferase                   51.2    9e-05   
ref|XP_010674757.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.2    9e-05   
ref|XP_011073953.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.2    9e-05   
emb|CDP18299.1|  unnamed protein product                              51.2    9e-05   
ref|XP_010255960.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.2    9e-05   
ref|XP_003589197.1|  Glycogenin glucosyltransferase                   51.2    9e-05   
gb|KDP43041.1|  hypothetical protein JCGZ_25227                       51.2    1e-04   
ref|XP_006851097.1|  hypothetical protein AMTR_s00025p00246110        50.8    1e-04   
ref|XP_008805263.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.2    1e-04   
ref|XP_010245814.1|  PREDICTED: putative UDP-glucuronate:xylan al...  51.2    1e-04   
ref|XP_010110483.1|  hypothetical protein L484_003529                 50.8    1e-04   
emb|CDP04731.1|  unnamed protein product                              51.2    1e-04   
ref|WP_013509686.1|  glycosyl transferase                             50.4    1e-04   
gb|KEH40452.1|  UDP-glucuronate:xylan alpha-glucuronosyltransferase   50.8    1e-04   
emb|CDX96589.1|  BnaA08g21320D                                        50.8    1e-04   
ref|XP_006416296.1|  hypothetical protein EUTSA_v10007050mg           50.8    1e-04   
ref|XP_009420264.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.8    1e-04   
ref|XP_009404013.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_010312475.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_006350978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_004249893.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_006350977.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_010692787.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_008891806.1|  hypothetical protein PPTG_02471                  50.8    1e-04   
gb|EPS62267.1|  hypothetical protein M569_12523                       50.8    1e-04   
ref|XP_005108197.1|  PREDICTED: SH3 domain-containing protein C23...  50.8    1e-04   
ref|XP_005108196.1|  PREDICTED: SH3 domain-containing protein C23...  50.8    1e-04   
ref|XP_009360736.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.8    1e-04   
ref|XP_009360735.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.8    1e-04   
ref|XP_009392557.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.8    1e-04   
ref|XP_009392550.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.8    1e-04   
ref|XP_010649390.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
emb|CBI37563.3|  unnamed protein product                              50.8    1e-04   
ref|XP_010692786.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_009149666.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.8    1e-04   
ref|XP_009149665.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.8    1e-04   
emb|CDP04730.1|  unnamed protein product                              50.8    1e-04   
ref|XP_002275240.2|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.8    1e-04   
ref|XP_010274299.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.4    1e-04   
ref|XP_002969246.1|  hypothetical protein SELMODRAFT_91619            50.4    1e-04   
ref|XP_010664887.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    1e-04   
ref|XP_010664886.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    1e-04   
ref|WP_043444333.1|  glycosyl transferase                             50.1    1e-04   
gb|EPS69985.1|  plant glycogenin-like starch initiation protein 3     50.4    2e-04   
ref|XP_003544084.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    2e-04   
ref|XP_006607044.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    2e-04   
gb|KHN04164.1|  Glycogenin-2                                          50.4    2e-04   
ref|XP_008798993.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    2e-04   
ref|XP_008798991.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    2e-04   
ref|XP_005108199.1|  PREDICTED: SH3 domain-containing protein C23...  50.4    2e-04   
ref|XP_005108198.1|  PREDICTED: SH3 domain-containing protein C23...  50.4    2e-04   
ref|XP_009350664.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.4    2e-04   
ref|XP_008375994.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.4    2e-04   
ref|XP_009763873.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    2e-04   
ref|XP_009629284.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.4    2e-04   
ref|XP_009350662.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.4    2e-04   
ref|XP_008375992.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.4    2e-04   
emb|CDY38807.1|  BnaC08g19810D                                        50.4    2e-04   
gb|EPS59757.1|  hypothetical protein M569_15049                       50.1    2e-04   
ref|XP_007161486.1|  hypothetical protein PHAVU_001G073100g           50.4    2e-04   
ref|XP_010263572.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.1    2e-04   
ref|XP_009390902.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.1    2e-04   
ref|XP_010263571.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.1    2e-04   
ref|XP_009360737.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.1    2e-04   
ref|XP_010063886.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.1    2e-04   
ref|XP_009390901.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  50.1    2e-04   
gb|EMS47724.1|  Glycogenin-1                                          50.1    2e-04   
ref|XP_010930628.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.1    2e-04   
ref|XP_002526157.1|  glycogenin, putative                             50.1    2e-04   
ref|XP_009414973.1|  PREDICTED: putative UDP-glucuronate:xylan al...  50.1    2e-04   
ref|XP_006374946.1|  hypothetical protein POPTR_0014s02980g           49.7    2e-04   
emb|CDS15613.1|  glycogenin 1                                         50.1    3e-04   
ref|XP_009594279.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_009594278.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_009594277.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_009594275.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_006578023.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_008373924.1|  PREDICTED: putative UDP-glucuronate:xylan al...  49.7    3e-04   
ref|XP_011022958.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_011022957.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_009348499.1|  PREDICTED: putative UDP-glucuronate:xylan al...  49.7    3e-04   
ref|XP_008373923.1|  PREDICTED: putative UDP-glucuronate:xylan al...  49.7    3e-04   
ref|XP_011022955.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_011022954.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_008373922.1|  PREDICTED: putative UDP-glucuronate:xylan al...  49.7    3e-04   
gb|KHN04505.1|  Hypothetical protein glysoja_019592                   49.7    3e-04   
ref|XP_011022956.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_003523601.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_008645791.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.7    3e-04   
ref|XP_007199738.1|  hypothetical protein PRUPE_ppa002694mg           49.7    3e-04   
ref|XP_007160847.1|  hypothetical protein PHAVU_001G021800g           49.7    3e-04   
ref|XP_006828387.1|  hypothetical protein AMTR_s00060p00013040        49.7    3e-04   
ref|XP_002960604.1|  hypothetical protein SELMODRAFT_73856            49.7    3e-04   
gb|AAX33316.1|  secondary cell wall-related glycosyltransferase f...  49.7    3e-04   
ref|XP_008782340.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    3e-04   
ref|XP_011030050.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    3e-04   
ref|XP_003544459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
ref|XP_011030042.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
gb|EHK49764.1|  glycosyltransferase family 8 protein                  49.3    4e-04   
ref|XP_008361006.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
emb|CCA16211.1|  glycosyl transferase putative                        49.3    4e-04   
ref|XP_008361004.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
ref|XP_011097062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
ref|XP_011097058.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
ref|XP_009348718.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
ref|XP_011458935.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  49.3    4e-04   
ref|XP_002310513.2|  hypothetical protein POPTR_0007s04030g           49.3    4e-04   
gb|AAX33317.1|  secondary cell wall-related glycosyltransferase f...  49.3    4e-04   
ref|XP_008237654.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.9    5e-04   
ref|XP_007199740.1|  hypothetical protein PRUPE_ppa002697mg           48.9    5e-04   
gb|KCW69223.1|  hypothetical protein EUGRSUZ_F02737                   48.9    5e-04   
ref|XP_010062155.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.9    5e-04   
ref|XP_010062154.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.9    5e-04   
ref|XP_008347148.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.9    5e-04   
ref|XP_006601291.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.9    5e-04   
ref|XP_004952800.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.9    5e-04   
ref|XP_003549400.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.9    5e-04   
ref|WP_042712221.1|  glycosyl transferase                             48.5    5e-04   
ref|XP_009390259.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.9    5e-04   
emb|CCI45428.1|  unnamed protein product                              48.9    5e-04   
ref|XP_008345680.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.5    6e-04   
ref|WP_039055465.1|  glycosyl transferase                             48.1    7e-04   
emb|CDP18101.1|  unnamed protein product                              48.5    7e-04   
ref|XP_004291114.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.5    7e-04   
ref|XP_011077916.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.5    7e-04   
gb|EYU36701.1|  hypothetical protein MIMGU_mgv1a005329mg              48.1    8e-04   
ref|XP_009600657.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.1    8e-04   
ref|XP_011099766.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.1    9e-04   
ref|XP_011099765.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  48.1    9e-04   
gb|KHN12781.1|  Glycogenin-1                                          48.1    0.001   
gb|KDR09903.1|  hypothetical protein L798_00340                       47.8    0.001   
gb|KDP38342.1|  hypothetical protein JCGZ_04267                       48.1    0.001   
gb|EMT12992.1|  Glycogenin-1                                          47.4    0.001   



>ref|XP_006361429.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Solanum tuberosum]
Length=533

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 83/98 (85%), Gaps = 8/98 (8%)
 Frame = +1

Query  172  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  351
            RFGV++L L  C++  YC         SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  352  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            MVVLVSDGVS YAKQLLQADGWIVE+I+LLANPNQVRP
Sbjct  59   MVVLVSDGVSQYAKQLLQADGWIVEKISLLANPNQVRP  96



>ref|XP_006361430.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Solanum tuberosum]
Length=527

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 83/98 (85%), Gaps = 8/98 (8%)
 Frame = +1

Query  172  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  351
            RFGV++L L  C++  YC         SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  352  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            MVVLVSDGVS YAKQLLQADGWIVE+I+LLANPNQVRP
Sbjct  59   MVVLVSDGVSQYAKQLLQADGWIVEKISLLANPNQVRP  96



>ref|XP_004236792.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like isoform X1 [Solanum lycopersicum]
Length=533

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 8/98 (8%)
 Frame = +1

Query  172  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  351
            RFGV++L L  C++  YC         S+EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSDEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  352  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            MVVLVSDGVS YAK LLQADGWIVE+I+LLANPNQVRP
Sbjct  59   MVVLVSDGVSQYAKHLLQADGWIVEKISLLANPNQVRP  96



>ref|XP_010319283.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like isoform X2 [Solanum lycopersicum]
Length=527

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 8/98 (8%)
 Frame = +1

Query  172  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  351
            RFGV++L L  C++  YC         S+EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSDEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  352  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            MVVLVSDGVS YAK LLQADGWIVE+I+LLANPNQVRP
Sbjct  59   MVVLVSDGVSQYAKHLLQADGWIVEKISLLANPNQVRP  96



>ref|XP_009779488.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
sylvestris]
Length=533

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            + LI+ +  NY V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIR++G+TKDMVVLVS
Sbjct  11   ISLIMFLSCNYWVIGASKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRESGSTKDMVVLVS  70

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS YA  LL+ADGWIVE+I+LL+NPNQVRP
Sbjct  71   DGVSQYANDLLRADGWIVEKISLLSNPNQVRP  102



>ref|XP_009606765.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
tomentosiformis]
Length=535

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            + LI+ +  NY V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIR++G+TKDMVVLVS
Sbjct  11   ISLIMFLSCNYWVIGASKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRESGSTKDMVVLVS  70

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS YA  LL+ADGWIVE+I+LL+NPNQVRP
Sbjct  71   DGVSQYANDLLRADGWIVEKISLLSNPNQVRP  102



>ref|XP_004239742.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Solanum lycopersicum]
Length=533

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  196  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  375
              L  L++  V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDG
Sbjct  12   FFLMFLSSNWVIGAIKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDG  71

Query  376  VSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VS YA  LL+ADGWIVE+I+LL+NPNQVRP
Sbjct  72   VSQYANDLLRADGWIVEKISLLSNPNQVRP  101



>ref|XP_006346008.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Solanum 
tuberosum]
Length=533

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = +1

Query  154  MGSFSGRFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRD  333
            M     R+G +     L  L++  V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIR+
Sbjct  1    MKEIDFRYGFL---FFLMFLSSNWVIGAIKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRN  57

Query  334  TGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            TG+TKDMVVLVSDGVS YA  LL+ADGWIVE+I+LL+NPNQVRP
Sbjct  58   TGSTKDMVVLVSDGVSQYANDLLRADGWIVEKISLLSNPNQVRP  101



>ref|XP_002319122.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 ref|XP_006375861.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 gb|EEE95045.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 gb|ERP53658.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
Length=546

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = +1

Query  202  LCVLNNYCVAGE-PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV  378
            L +++  C+A    RSQ +EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD+VVLVSDGV
Sbjct  15   LNLISYTCLAASIQRSQRTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDIVVLVSDGV  74

Query  379  SSYAKQLLQADGWIVEEITLLANPNQVRP  465
            S YAK+LL ADGWIVE+I+LLANPNQVRP
Sbjct  75   SDYAKKLLLADGWIVEKISLLANPNQVRP  103



>ref|XP_011038458.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 isoform X1 [Populus euphratica]
Length=549

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = +1

Query  202  LCVLNNYCVAGE-PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV  378
            L +++  C+A    RSQ +EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD+VVLVSDGV
Sbjct  15   LNLISYTCLAASIQRSQRTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDIVVLVSDGV  74

Query  379  SSYAKQLLQADGWIVEEITLLANPNQVRP  465
            S YAK+LL ADGWIVE+I+LLANPNQVRP
Sbjct  75   SDYAKKLLLADGWIVEKISLLANPNQVRP  103



>ref|XP_011038459.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 isoform X2 [Populus euphratica]
Length=543

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = +1

Query  202  LCVLNNYCVAGE-PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV  378
            L +++  C+A    RSQ +EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD+VVLVSDGV
Sbjct  15   LNLISYTCLAASIQRSQRTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDIVVLVSDGV  74

Query  379  SSYAKQLLQADGWIVEEITLLANPNQVRP  465
            S YAK+LL ADGWIVE+I+LLANPNQVRP
Sbjct  75   SDYAKKLLLADGWIVEKISLLANPNQVRP  103



>emb|CAN77613.1| hypothetical protein VITISV_036932 [Vitis vinifera]
Length=587

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 75/93 (81%), Gaps = 3/93 (3%)
 Frame = +1

Query  187  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  366
            W  LIL     +  +  P   S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLV
Sbjct  9    WFLLILLA---WIRSPSPVRASGSEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLV  65

Query  367  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            SDGVS YAK+LLQADGWIVE I+LLANPNQVRP
Sbjct  66   SDGVSDYAKKLLQADGWIVELISLLANPNQVRP  98



>ref|XP_008218517.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Prunus mume]
Length=510

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 78/100 (78%), Gaps = 6/100 (6%)
 Frame = +1

Query  184  VWLCLILCVL------NNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT  345
            VW  LI  VL      N    +   R Q+S EAYVTLLYGDEFLLGVRVLG SIRDTG+T
Sbjct  8    VWFVLIALVLAATIRPNGAFESSSSRHQTSTEAYVTLLYGDEFLLGVRVLGNSIRDTGST  67

Query  346  KDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            KDMV LVSDGVS+YA +LL+ADGWIVE+I+LLANPNQVRP
Sbjct  68   KDMVALVSDGVSNYAMKLLEADGWIVEKISLLANPNQVRP  107



>ref|XP_007030331.1| Plant glycogenin-like starch initiation protein 6 isoform 2 [Theobroma 
cacao]
 gb|EOY10833.1| Plant glycogenin-like starch initiation protein 6 isoform 2 [Theobroma 
cacao]
Length=525

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            + ++L  + +  V G     SS  AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVS
Sbjct  10   ILVVLITIQSKAVLGTKVQSSSTNAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVS  69

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS YAK+LL+ADGWIVE+I+LLANPNQVRP
Sbjct  70   DGVSDYAKRLLKADGWIVEKISLLANPNQVRP  101



>ref|XP_007030330.1| Plant glycogenin-like starch initiation protein 6 isoform 1 [Theobroma 
cacao]
 gb|EOY10832.1| Plant glycogenin-like starch initiation protein 6 isoform 1 [Theobroma 
cacao]
Length=536

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            + ++L  + +  V G     SS  AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVS
Sbjct  10   ILVVLITIQSKAVLGTKVQSSSTNAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVS  69

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS YAK+LL+ADGWIVE+I+LLANPNQVRP
Sbjct  70   DGVSDYAKRLLKADGWIVEKISLLANPNQVRP  101



>ref|XP_006408154.1| hypothetical protein EUTSA_v10021780mg [Eutrema salsugineum]
 gb|ESQ49607.1| hypothetical protein EUTSA_v10021780mg [Eutrema salsugineum]
Length=121

 Score =   128 bits (322),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = +1

Query  172  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT-K  348
            + G  W+ +IL  +      G   S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG++ K
Sbjct  3    KLGSFWVIIILLSIQ---FKGSFGSESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSSNK  59

Query  349  DMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DMVVLVSDGVS Y+K LL+ADGW VE ITLLANPNQV P
Sbjct  60   DMVVLVSDGVSDYSKLLLKADGWRVENITLLANPNQVHP  98



>ref|XP_002266145.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Vitis vinifera]
 emb|CBI22393.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 75/93 (81%), Gaps = 3/93 (3%)
 Frame = +1

Query  187  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  366
            W  LIL     +  +  P   S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLV
Sbjct  9    WFLLILLA---WIRSPSPVRASGSEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLV  65

Query  367  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            SDGVS YAK+LLQADGWIVE I+LLANPNQVRP
Sbjct  66   SDGVSDYAKKLLQADGWIVELISLLANPNQVRP  98



>ref|XP_008370762.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Malus domestica]
Length=549

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS+YA +LLQADGWI
Sbjct  33   RRQTSPEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSNYAMKLLQADGWI  92

Query  421  VEEITLLANPNQVRP  465
            VE+I+LLANPNQVRP
Sbjct  93   VEKISLLANPNQVRP  107



>ref|XP_009599298.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
tomentosiformis]
Length=530

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 7/99 (7%)
 Frame = +1

Query  172  RFGVV-WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTK  348
            R GV+ +L  +LC     C  G   S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TK
Sbjct  7    RLGVLLFLIFMLCD----CFIGA--SCKSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTK  60

Query  349  DMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DMVVLVSDGVS YAK+LL ADGWIVE+I+LLANPNQVRP
Sbjct  61   DMVVLVSDGVSQYAKELLLADGWIVEKISLLANPNQVRP  99



>ref|XP_006437461.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50701.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
Length=387

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQVRP
Sbjct  86   EKISLLANPNQVRP  99



>gb|KHN31485.1| Glycogenin-1 [Glycine soja]
Length=551

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 8/99 (8%)
 Frame = +1

Query  187  WLCLIL------CVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTK  348
            WLC IL      CV    CVA   +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ K
Sbjct  9    WLCSILVCIVLVCVQFEGCVAS--KTKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNK  66

Query  349  DMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DMVVLVSDGVS YAK LL+ADGWIVE I+LLANPN+VRP
Sbjct  67   DMVVLVSDGVSDYAKSLLRADGWIVEMISLLANPNRVRP  105



>gb|KDP23737.1| hypothetical protein JCGZ_23570 [Jatropha curcas]
Length=539

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +1

Query  154  MGSFSGRFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRD  333
            +  FS  F VV L LI             RSQ +++AYVTLLYGDEFLLGVRVLGKSIRD
Sbjct  3    LSKFSALFIVVALVLIQS-------GASLRSQRTQQAYVTLLYGDEFLLGVRVLGKSIRD  55

Query  334  TGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            TG+TKDMVVLVSDGVS YA +LL+ADGWIVE+I+LLANPN+VRP
Sbjct  56   TGSTKDMVVLVSDGVSDYAVKLLEADGWIVEKISLLANPNRVRP  99



>ref|XP_006604859.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Glycine max]
Length=551

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = +1

Query  187  WLCLILCVLNNYCVAGE----PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  354
            WLC IL  +   CV  E     +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ KDM
Sbjct  9    WLCSILFCIVLVCVQFEGCVGSKTKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNKDM  68

Query  355  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VVLVSDGVS YAK LL+ADGWIVE I+LLANPN+VRP
Sbjct  69   VVLVSDGVSDYAKSLLRADGWIVEMISLLANPNRVRP  105



>ref|XP_006604858.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Glycine max]
Length=552

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = +1

Query  187  WLCLILCVLNNYCVAGE----PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  354
            WLC IL  +   CV  E     +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ KDM
Sbjct  9    WLCSILFCIVLVCVQFEGCVGSKTKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNKDM  68

Query  355  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VVLVSDGVS YAK LL+ADGWIVE I+LLANPN+VRP
Sbjct  69   VVLVSDGVSDYAKSLLRADGWIVEMISLLANPNRVRP  105



>gb|KHG12487.1| Glycogenin-1 [Gossypium arboreum]
Length=542

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G     SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDGVS YAK+LL+AD
Sbjct  24   GVKAQSSSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDGVSDYAKKLLKAD  83

Query  412  GWIVEEITLLANPNQVRP  465
            GWIVE I+LLANPNQVRP
Sbjct  84   GWIVEMISLLANPNQVRP  101



>ref|XP_009379742.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Pyrus x bretschneideri]
Length=549

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS YA +LLQADGWI
Sbjct  33   RRQTSVEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSDYAMKLLQADGWI  92

Query  421  VEEITLLANPNQVRP  465
            VE+I+LLANPNQVRP
Sbjct  93   VEKISLLANPNQVRP  107



>ref|XP_008366883.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Malus domestica]
Length=549

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS YA +LLQADGWI
Sbjct  33   RRQTSVEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSDYAMKLLQADGWI  92

Query  421  VEEITLLANPNQVRP  465
            VE+I+LLANPNQVRP
Sbjct  93   VEKISLLANPNQVRP  107



>ref|XP_006437460.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50700.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
Length=548

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQVRP
Sbjct  86   EKISLLANPNQVRP  99



>ref|XP_006484615.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Citrus 
sinensis]
Length=548

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQVRP
Sbjct  86   EKISLLANPNQVRP  99



>ref|XP_009343790.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Pyrus x bretschneideri]
Length=549

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG TKDMV LVSDGVS+YA +LL+ADGWI
Sbjct  33   RRQTSPEAYVTLLYGDEFLLGVRVLGKSIRDTGATKDMVALVSDGVSNYAMKLLRADGWI  92

Query  421  VEEITLLANPNQVRP  465
            VE+I+LLANPNQVRP
Sbjct  93   VEKISLLANPNQVRP  107



>ref|XP_011101631.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Sesamum indicum]
Length=785

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            SQ+SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS+YAK+LLQADGWIV
Sbjct  30   SQNSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSNYAKKLLQADGWIV  89

Query  424  EEITLLANPNQVRP  465
            + I+LL NPNQVRP
Sbjct  90   KTISLLENPNQVRP  103



>gb|EPS68223.1| hypothetical protein M569_06549, partial [Genlisea aurea]
Length=515

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 74/91 (81%), Gaps = 3/91 (3%)
 Frame = +1

Query  193  CLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSD  372
            CLI        VAG   SQ+S EAYVTLLYGDEFLLGVRVLGKSIRD+G+TKDMV LVSD
Sbjct  4    CLIAAGFGWKGVAG---SQNSGEAYVTLLYGDEFLLGVRVLGKSIRDSGSTKDMVALVSD  60

Query  373  GVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            GVS YAK+LLQADGWIV  I+LL NPNQVRP
Sbjct  61   GVSDYAKKLLQADGWIVRAISLLENPNQVRP  91



>gb|KDO49229.1| hypothetical protein CISIN_1g008931mg [Citrus sinensis]
Length=387

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  424  EEITLLANPNQVRP  465
            E+I+LL NPNQVRP
Sbjct  86   EKISLLENPNQVRP  99



>gb|KJB82307.1| hypothetical protein B456_013G188300 [Gossypium raimondii]
Length=409

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G     SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+T+DMVVLVSDGVS YAK+LL+AD
Sbjct  24   GVKAQSSSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSTRDMVVLVSDGVSDYAKKLLKAD  83

Query  412  GWIVEEITLLANPNQVRP  465
            GW+VE I+LLANPNQVRP
Sbjct  84   GWMVEMISLLANPNQVRP  101



>ref|XP_009401946.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 82/104 (79%), Gaps = 6/104 (6%)
 Frame = +1

Query  154  MGSFSGRFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRD  333
            MGS   R G  +L ++L VL      G  R+++ E+AYVTLLYGDEFLLGVRVLGKSIRD
Sbjct  1    MGSPVARLG--FLAMVLLVLG---ATGCGRAKT-EDAYVTLLYGDEFLLGVRVLGKSIRD  54

Query  334  TGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            TG+TKDMVVLVSDGVS YA +LL ADGWIVE I+LLANPN VRP
Sbjct  55   TGSTKDMVVLVSDGVSDYAMKLLHADGWIVEHISLLANPNHVRP  98



>ref|XP_010675056.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = +1

Query  190  LCLILCVL---NNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVV  360
              LILC L   ++       RSQS++EAYVTLLYGDEF+LGVRVLGKSIRDTG+ KDMVV
Sbjct  11   FTLILCFLLLQSSILRIDAKRSQSTKEAYVTLLYGDEFVLGVRVLGKSIRDTGSKKDMVV  70

Query  361  LVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            LVSDGVS YAK LL+ADGWIVE I+LL NPN+VRP
Sbjct  71   LVSDGVSDYAKTLLEADGWIVEMISLLQNPNRVRP  105



>gb|KJB82306.1| hypothetical protein B456_013G188300 [Gossypium raimondii]
Length=542

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G     SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+T+DMVVLVSDGVS YAK+LL+AD
Sbjct  24   GVKAQSSSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSTRDMVVLVSDGVSDYAKKLLKAD  83

Query  412  GWIVEEITLLANPNQVRP  465
            GW+VE I+LLANPNQVRP
Sbjct  84   GWMVEMISLLANPNQVRP  101



>gb|KDO49228.1| hypothetical protein CISIN_1g008931mg [Citrus sinensis]
Length=548

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  424  EEITLLANPNQVRP  465
            E+I+LL NPNQVRP
Sbjct  86   EKISLLENPNQVRP  99



>gb|KCW61484.1| hypothetical protein EUGRSUZ_H04216 [Eucalyptus grandis]
Length=395

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            R  S  EAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV+ YAK+LL+ADGWI
Sbjct  34   RPSSLGEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVTDYAKKLLKADGWI  93

Query  421  VEEITLLANPNQVRP  465
            VE+I+LLANPNQ RP
Sbjct  94   VEKISLLANPNQKRP  108



>ref|XP_010102196.1| hypothetical protein L484_024477 [Morus notabilis]
 gb|EXB93139.1| hypothetical protein L484_024477 [Morus notabilis]
Length=561

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            + L L  + +  V G PR Q S+EAYVTLLYGDEFLLGVRVLGKSIRDT +TKDMVVLVS
Sbjct  11   VTLALVWIPSNGVFGSPR-QKSDEAYVTLLYGDEFLLGVRVLGKSIRDTRSTKDMVVLVS  69

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS YA +LL+ADGWIV +I+LLANPNQVRP
Sbjct  70   DGVSDYAMKLLEADGWIVTKISLLANPNQVRP  101



>gb|ABR16625.1| unknown [Picea sitchensis]
Length=567

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  238  PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGW  417
            PRS+ + EAY TLLYGDEFLLGVRVLGKSIRDTGTT+DMV LVSDGVS YA QLLQADGW
Sbjct  39   PRSRKTLEAYATLLYGDEFLLGVRVLGKSIRDTGTTRDMVALVSDGVSPYAVQLLQADGW  98

Query  418  IVEEITLLANPNQVRP  465
            IVE I LLANPNQ RP
Sbjct  99   IVEHIGLLANPNQKRP  114



>ref|XP_003591002.1| hypothetical protein MTR_1g080670 [Medicago truncatula]
Length=129

 Score =   124 bits (312),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = +1

Query  178  GVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMV  357
             ++W  +++  +N+        S+ +E AY +LLYGDEFLLGVRVLGKSIRDT + KDMV
Sbjct  3    ALLWFMILVFSVNSLG----SESKRTEVAYASLLYGDEFLLGVRVLGKSIRDTRSNKDMV  58

Query  358  VLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VLVSDGVS YAK LL+ADGWIVE+I+LL NPNQVRP
Sbjct  59   VLVSDGVSDYAKNLLKADGWIVEKISLLENPNQVRP  94



>ref|XP_009384656.1| PREDICTED: LOW QUALITY PROTEIN: putative glucuronosyltransferase 
PGSIP6 [Musa acuminata subsp. malaccensis]
Length=544

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 79/92 (86%), Gaps = 4/92 (4%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            L ++L VL    V+G  R+++ E+AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVS
Sbjct  11   LMMVLVVLG---VSGCGRAKT-EDAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVS  66

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS YAK+LL ADGWIV+ I+LLANPN VRP
Sbjct  67   DGVSEYAKKLLDADGWIVQHISLLANPNHVRP  98



>ref|XP_004302108.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Fragaria vesca subsp. vesca]
Length=539

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            Q + EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDGVS YA  LL+ADGWIVE
Sbjct  29   QRTPEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDGVSGYAMSLLKADGWIVE  88

Query  427  EITLLANPNQVRP  465
            +I+LLANPNQVRP
Sbjct  89   KISLLANPNQVRP  101



>ref|XP_010024933.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Eucalyptus 
grandis]
Length=538

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            R  S  EAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV+ YAK+LL+ADGWI
Sbjct  34   RPSSLGEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVTDYAKKLLKADGWI  93

Query  421  VEEITLLANPNQVRP  465
            VE+I+LLANPNQ RP
Sbjct  94   VEKISLLANPNQKRP  108



>gb|ABZ89190.1| hypothetical protein 46C02.16 [Coffea canephora]
Length=546

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
             S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YAK+LL+ADGWIVE
Sbjct  36   SSKGEAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSDYAKKLLKADGWIVE  95

Query  427  EITLLANPNQVRP  465
            +I+LLANPNQVRP
Sbjct  96   KISLLANPNQVRP  108



>emb|CDO99980.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  250  SSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEE  429
            S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YAK+LL+ADGWIVE+
Sbjct  37   SKGEAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSHYAKKLLKADGWIVEK  96

Query  430  ITLLANPNQVRP  465
            I+LLANPNQVRP
Sbjct  97   ISLLANPNQVRP  108



>ref|XP_006400396.1| hypothetical protein EUTSA_v10013196mg [Eutrema salsugineum]
 gb|ESQ41849.1| hypothetical protein EUTSA_v10013196mg [Eutrema salsugineum]
Length=540

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  184  VWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVL  363
            +W+ L    L +  + G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ +DMV L
Sbjct  8    LWVILFSIALVSIQMKGSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNRDMVAL  67

Query  364  VSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VSDGVS Y+K+LL+ADGW VE+I+LLANPNQV P
Sbjct  68   VSDGVSGYSKKLLKADGWKVEKISLLANPNQVHP  101



>ref|XP_010247242.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Nelumbo nucifera]
Length=546

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = +1

Query  172  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  351
            RF VV   L L  L +  +       S +EAY TLLYGDEFLLGVRVLGKSIRDT TTKD
Sbjct  9    RFLVVLFALFLFGLTDRVLG------SQKEAYATLLYGDEFLLGVRVLGKSIRDTRTTKD  62

Query  352  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            MVVLVSDGVS YAK+LL+ADGWIVE I+LLANPNQVRP
Sbjct  63   MVVLVSDGVSDYAKKLLKADGWIVEPISLLANPNQVRP  100



>ref|XP_006606473.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Glycine max]
Length=517

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S+ ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YA  LLQADGWIV
Sbjct  23   SERTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYANTLLQADGWIV  82

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQVRP
Sbjct  83   EKISLLANPNQVRP  96



>ref|XP_008441775.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Cucumis melo]
Length=546

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  256  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            +EAYVTLLYGDEFLLGVRVLGKSIRDTG++KDMV L+SDGVS YAK+LL+ADGWIVE+I+
Sbjct  35   DEAYVTLLYGDEFLLGVRVLGKSIRDTGSSKDMVALISDGVSEYAKRLLEADGWIVEKIS  94

Query  436  LLANPNQVRP  465
            LLANPNQVRP
Sbjct  95   LLANPNQVRP  104



>ref|XP_009126256.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=533

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  196  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  375
            L L V +   + G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDG
Sbjct  11   LWLLVFSIALLKGSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDG  70

Query  376  VSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VS Y+K+LL+ADGW VE+I+LLANPNQV P
Sbjct  71   VSDYSKKLLKADGWKVEKISLLANPNQVHP  100



>ref|XP_004152810.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cucumis 
sativus]
 ref|XP_004155109.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cucumis 
sativus]
Length=545

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  256  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            +EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV L+SDGVS YAK+LL+ADGWIVE+I+
Sbjct  35   DEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVALISDGVSEYAKKLLEADGWIVEKIS  94

Query  436  LLANPNQVRP  465
            LLANPNQVRP
Sbjct  95   LLANPNQVRP  104



>ref|XP_003556480.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Glycine max]
 gb|KHN14713.1| Glycogenin-1 [Glycine soja]
Length=541

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S+ ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YA  LLQADGWIV
Sbjct  23   SERTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYANTLLQADGWIV  82

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQVRP
Sbjct  83   EKISLLANPNQVRP  96



>emb|CDY58112.1| BnaA02g35140D [Brassica napus]
Length=530

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            LCL+L  +    + G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVS
Sbjct  8    LCLLLFSIA--LLKGSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVS  65

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS Y+K LL+ADGW VE I+LLANPNQV P
Sbjct  66   DGVSDYSKNLLKADGWKVERISLLANPNQVHP  97



>emb|CDY21129.1| BnaA01g33600D [Brassica napus]
Length=546

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G   SQS+ EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL AD
Sbjct  22   GSFASQSTNEAYVTLLYGDEFLLGVRVLGKSIRDTGSHKDMVVLVSDGVSDYSKKLLMAD  81

Query  412  GWIVEEITLLANPNQVRP  465
            GW VE+I+LLANPNQV P
Sbjct  82   GWKVEKISLLANPNQVHP  99



>emb|CAH67224.1| OSIGBa0145M07.6 [Oryza sativa Indica Group]
Length=372

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV  I
Sbjct  32   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVSHI  91

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  92   TLLANPNQVRP  102



>ref|XP_009125000.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=546

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G   SQS+ EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL AD
Sbjct  22   GSFASQSTNEAYVTLLYGDEFLLGVRVLGKSIRDTGSHKDMVVLVSDGVSDYSKKLLMAD  81

Query  412  GWIVEEITLLANPNQVRP  465
            GW VE+I+LLANPNQV P
Sbjct  82   GWKVEKISLLANPNQVHP  99



>ref|XP_006653601.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Oryza 
brachyantha]
Length=539

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV+ I
Sbjct  27   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVKHI  86

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  87   TLLANPNQVRP  97



>ref|XP_002446789.1| hypothetical protein SORBIDRAFT_06g022680 [Sorghum bicolor]
 gb|EES11117.1| hypothetical protein SORBIDRAFT_06g022680 [Sorghum bicolor]
Length=536

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LGVRVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  28   TEEAYVTLLYGDEFVLGVRVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  87

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  88   TLLANPNQVRP  98



>gb|EEC77645.1| hypothetical protein OsI_16652 [Oryza sativa Indica Group]
 gb|EEE61342.1| hypothetical protein OsJ_15472 [Oryza sativa Japonica Group]
Length=544

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV  I
Sbjct  32   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVSHI  91

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  92   TLLANPNQVRP  102



>ref|XP_010463911.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW +
Sbjct  28   SESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKI  87

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  88   EKISLLANPNQVHP  101



>gb|AAL58891.1|AF462795_1 AT5g18480/F20L16_200 [Arabidopsis thaliana]
 gb|AAN28860.1| At5g18480/F20L16_200 [Arabidopsis thaliana]
Length=537

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            L ++L  L +  + G   S+SS+ AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVS
Sbjct  8    LWVLLLALVSIQLNGSFGSESSKVAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVS  67

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS Y+K+LL+ADGW VE+I+LLANPNQV P
Sbjct  68   DGVSDYSKKLLKADGWKVEKISLLANPNQVHP  99



>emb|CAE05448.4| OSJNBa0073E02.8 [Oryza sativa Japonica Group]
Length=479

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV  I
Sbjct  32   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVSHI  91

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  92   TLLANPNQVRP  102



>ref|NP_197349.2| plant glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 sp|Q8GWB7.1|GUX6_ARATH RecName: Full=Inositol phosphorylceramide glucuronosyltransferase 
1; AltName: Full=Glycogenin-like protein 6; AltName: Full=Plant 
glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 dbj|BAC43531.1| unknown protein [Arabidopsis thaliana]
 gb|AED92569.1| plant glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 gb|AHL38620.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=537

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            L ++L  L +  + G   S+SS+ AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVS
Sbjct  8    LWVLLLALVSIQLNGSFGSESSKVAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVS  67

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS Y+K+LL+ADGW VE+I+LLANPNQV P
Sbjct  68   DGVSDYSKKLLKADGWKVEKISLLANPNQVHP  99



>emb|CDX70822.1| BnaC03g09060D [Brassica napus]
Length=532

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+AD
Sbjct  21   GSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKAD  80

Query  412  GWIVEEITLLANPNQVRP  465
            GW VE+I+LLANPNQV P
Sbjct  81   GWKVEKISLLANPNQVHP  98



>ref|XP_008807617.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Phoenix dactylifera]
 ref|XP_008807625.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Phoenix dactylifera]
Length=544

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query  199  ILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV  378
             L VL    +AG   +++ +EAYVTLLYGDEFLLGVRVLGKSIRDT +TKDMVVLVSDGV
Sbjct  10   FLAVLVAALMAGSCWAKT-DEAYVTLLYGDEFLLGVRVLGKSIRDTRSTKDMVVLVSDGV  68

Query  379  SSYAKQLLQADGWIVEEITLLANPNQVRP  465
            S YAK+LLQADGWIVE I+LLANPN VRP
Sbjct  69   SDYAKKLLQADGWIVEPISLLANPNLVRP  97



>emb|CDX88935.1| BnaA03g07140D [Brassica napus]
Length=534

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+AD
Sbjct  21   GSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKAD  80

Query  412  GWIVEEITLLANPNQVRP  465
            GW VE+I+LLANPNQV P
Sbjct  81   GWKVEKISLLANPNQVHP  98



>ref|XP_010922963.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Elaeis guineensis]
Length=543

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDGVS +AK+LL+ADGWIVE I
Sbjct  27   TDGAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDGVSDHAKKLLRADGWIVEPI  86

Query  433  TLLANPNQVRP  465
            +LLANPNQVRP
Sbjct  87   SLLANPNQVRP  97



>ref|XP_004976232.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Setaria 
italica]
Length=637

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LGVRVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  128  TEEAYVTLLYGDEFVLGVRVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  187

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  188  TLLANPNQVRP  198



>ref|XP_010413938.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW +
Sbjct  28   SASTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKI  87

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  88   EKISLLANPNQVHP  101



>ref|XP_007147201.1| hypothetical protein PHAVU_006G104100g, partial [Phaseolus vulgaris]
 gb|ESW19195.1| hypothetical protein PHAVU_006G104100g, partial [Phaseolus vulgaris]
Length=531

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = +1

Query  223  CVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLL  402
            CV    +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG++KDMVVLVSDGVS YAK LL
Sbjct  6    CVGS--KTKRTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSSKDMVVLVSDGVSDYAKSLL  63

Query  403  QADGWIVEEITLLANPNQVRP  465
            +ADGWIVE I+LLANPN+VRP
Sbjct  64   RADGWIVELISLLANPNRVRP  84



>ref|XP_010485804.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW +
Sbjct  28   SASTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKI  87

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  88   EKISLLANPNQVHP  101



>ref|XP_006297372.1| hypothetical protein CARUB_v10013391mg [Capsella rubella]
 gb|EOA30270.1| hypothetical protein CARUB_v10013391mg [Capsella rubella]
Length=548

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW  
Sbjct  28   SESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKA  87

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  88   EKISLLANPNQVHP  101



>dbj|BAJ88570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +DMVVLVSDGVS Y++ LL+ADGWIV  I
Sbjct  29   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRGLLEADGWIVNRI  88

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  89   TLLANPNQVRP  99



>gb|KEH24575.1| glucuronosyltransferase PGSIP8 [Medicago truncatula]
Length=549

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
             + EEAYVTLLYGDEFLLGVRVLGKSIRDT + KDMVVLVSDGVS++AK LL+ADGWIVE
Sbjct  31   SNDEEAYVTLLYGDEFLLGVRVLGKSIRDTRSNKDMVVLVSDGVSNFAKNLLRADGWIVE  90

Query  427  EITLLANPNQVRP  465
            +ITLLANPN+VRP
Sbjct  91   QITLLANPNRVRP  103



>ref|XP_007205021.1| hypothetical protein PRUPE_ppa003817mg [Prunus persica]
 gb|EMJ06220.1| hypothetical protein PRUPE_ppa003817mg [Prunus persica]
Length=546

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  259  EAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITL  438
            EAYVTLLYGDEFLLGVRVLG SIRDTG+TKDMV LVSDGVS+YA +LL+ADGWIVE+I+L
Sbjct  36   EAYVTLLYGDEFLLGVRVLGNSIRDTGSTKDMVALVSDGVSNYAMKLLEADGWIVEKISL  95

Query  439  LANPNQVRP  465
            LANPNQVRP
Sbjct  96   LANPNQVRP  104



>emb|CDY02625.1| BnaC02g08100D [Brassica napus]
Length=533

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G   S+SS+EAY+TLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K LL+AD
Sbjct  23   GSFGSESSKEAYITLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKNLLKAD  82

Query  412  GWIVEEITLLANPNQVRP  465
            GW VE+I+LLANPNQV P
Sbjct  83   GWKVEKISLLANPNQVHP  100



>ref|XP_007143949.1| hypothetical protein PHAVU_007G116100g [Phaseolus vulgaris]
 gb|ESW15943.1| hypothetical protein PHAVU_007G116100g [Phaseolus vulgaris]
Length=551

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S+ S+ AYVTLLYGDEFLLG+RVLGKSIRDTG+ KDMVVLVSDGVS YA  +L+ADGWI+
Sbjct  32   SERSDVAYVTLLYGDEFLLGIRVLGKSIRDTGSNKDMVVLVSDGVSDYANNVLKADGWII  91

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQVRP
Sbjct  92   EKISLLANPNQVRP  105



>gb|KFK37856.1| hypothetical protein AALP_AA3G038100 [Arabis alpina]
Length=545

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW V
Sbjct  25   SVSTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSQYSKKLLKADGWKV  84

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  85   EKISLLANPNQVHP  98



>ref|XP_010558734.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Tarenaya hassleriana]
Length=549

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +1

Query  187  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  366
            W+ LI   L +        SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLV
Sbjct  9    WVFLISIALLSTQFGVSVGSQSTKQAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLV  68

Query  367  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            SDGVS Y+K+LL+ADGW VE+I+LL NPNQV P
Sbjct  69   SDGVSDYSKKLLKADGWKVEKISLLENPNQVHP  101



>ref|XP_006287478.1| hypothetical protein CARUB_v10000689mg [Capsella rubella]
 gb|EOA20376.1| hypothetical protein CARUB_v10000689mg [Capsella rubella]
Length=531

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  23   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  82

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  83   EKISLLANPNQVHP  96



>ref|XP_010492852.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Camelina sativa]
Length=535

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  24   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  83

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  84   EKISLLANPNQVHP  97



>emb|CDY29996.1| BnaC01g40120D [Brassica napus]
Length=546

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            G   S S+ EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL AD
Sbjct  22   GSLGSISTNEAYVTLLYGDEFLLGVRVLGKSIRDTGSHKDMVVLVSDGVSDYSKKLLMAD  81

Query  412  GWIVEEITLLANPNQVRP  465
            GW VE+I+LLANPNQV P
Sbjct  82   GWKVEKISLLANPNQVHP  99



>ref|XP_010420611.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=535

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  24   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  83

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  84   EKISLLANPNQVHP  97



>ref|XP_008661816.1| PREDICTED: uncharacterized protein LOC100279618 isoform X1 [Zea 
mays]
Length=523

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LG RVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  28   TEEAYVTLLYGDEFVLGARVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  87

Query  433  TLLANPNQVRP  465
            TLLANPNQ RP
Sbjct  88   TLLANPNQFRP  98



>ref|NP_001146086.1| uncharacterized protein LOC100279618 precursor [Zea mays]
 gb|ACL53184.1| unknown [Zea mays]
 gb|ACN34651.1| unknown [Zea mays]
 gb|AFW58864.1| hypothetical protein ZEAMMB73_149865 [Zea mays]
Length=536

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EEAYVTLLYGDEF+LG RVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  28   TEEAYVTLLYGDEFVLGARVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  87

Query  433  TLLANPNQVRP  465
            TLLANPNQ RP
Sbjct  88   TLLANPNQFRP  98



>ref|XP_010454088.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=535

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  24   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  83

Query  424  EEITLLANPNQVRP  465
            E+I+LLANPNQV P
Sbjct  84   EKISLLANPNQVHP  97



>ref|XP_002873897.1| hypothetical protein ARALYDRAFT_488728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50156.1| hypothetical protein ARALYDRAFT_488728 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  196  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  375
            L+L ++++  + G   S+ S+ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDG
Sbjct  11   LLLALVSSIQLKGSFGSEPSKVAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVALVSDG  70

Query  376  VSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VS Y+K+LL+ADGW VE+I+LLANPNQV P
Sbjct  71   VSDYSKKLLKADGWKVEKISLLANPNQVHP  100



>ref|XP_004494729.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cicer 
arietinum]
Length=551

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +1

Query  190  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  369
            LC I+ +L+          + +++AYVTLLYGDEFLLGVRVLGKSIRDT + KDMVVLVS
Sbjct  13   LCFIISLLSLQFQGCFGSIKKTDDAYVTLLYGDEFLLGVRVLGKSIRDTRSNKDMVVLVS  72

Query  370  DGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            DGVS YAK LL ADGWIVE+I+LLANPN+VRP
Sbjct  73   DGVSDYAKNLLTADGWIVEQISLLANPNRVRP  104



>ref|XP_006408197.1| hypothetical protein EUTSA_v10020458mg [Eutrema salsugineum]
 gb|ESQ49650.1| hypothetical protein EUTSA_v10020458mg [Eutrema salsugineum]
Length=545

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 4/94 (4%)
 Frame = +1

Query  187  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT-KDMVVL  363
            W+ +IL  +      G   S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG++ KDMVVL
Sbjct  8    WVIIILLSIQ---FKGSFGSESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSSNKDMVVL  64

Query  364  VSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VSDGVS Y+K LL+ADGW VE ITLLANPNQV P
Sbjct  65   VSDGVSDYSKLLLKADGWRVENITLLANPNQVHP  98



>gb|AIL52751.1| putative glucuronosyltransferase PGSIP6-like protein [Dendrobium 
catenatum]
Length=549

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S  SEEAYVTLLYGDE +LG RVLGKSIRDTG++KDMVVLVSDGVS YAK LLQADGW V
Sbjct  24   SARSEEAYVTLLYGDELVLGARVLGKSIRDTGSSKDMVVLVSDGVSDYAKMLLQADGWKV  83

Query  424  EEITLLANPNQVRP  465
            E I+LL NPNQVRP
Sbjct  84   ELISLLTNPNQVRP  97



>ref|XP_002522004.1| glycogenin, putative [Ricinus communis]
 gb|EEF40408.1| glycogenin, putative [Ricinus communis]
Length=776

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            R Q +++AYVTLLYGDEFLLGVRVLGKSI+DTG+ KD VVLVSDGVS YA +LL+ADGWI
Sbjct  264  RLQKTDKAYVTLLYGDEFLLGVRVLGKSIKDTGSKKDRVVLVSDGVSDYAMKLLEADGWI  323

Query  421  VEEITLLANPNQVRP  465
            VE+ITLLANPNQ RP
Sbjct  324  VEKITLLANPNQARP  338



>gb|EYU19884.1| hypothetical protein MIMGU_mgv1a004141mg [Erythranthe guttata]
Length=542

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS  A++ LQADGWIV+
Sbjct  32   QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVALVSDGVSLSAQKQLQADGWIVK  91

Query  427  EITLLANPNQVRP  465
             I+LL NPNQVRP
Sbjct  92   TISLLENPNQVRP  104



>gb|KHN43170.1| Glycogenin-1 [Glycine soja]
Length=1248

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            ++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ KDMVVLVSDGVS YAK LL+ADGWIV
Sbjct  746  TKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNKDMVVLVSDGVSDYAKSLLRADGWIV  805

Query  424  EEITLLANPNQVRP  465
            E I+LLANPN+VRP
Sbjct  806  EMISLLANPNRVRP  819



>gb|KFK26089.1| hypothetical protein AALP_AA8G201300 [Arabis alpina]
Length=539

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +1

Query  232  GEPRSQSSEEA-YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G   S+SS+EA YVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+A
Sbjct  21   GSFGSESSKEAAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVALVSDGVSEYSKKLLKA  80

Query  409  DGWIVEEITLLANPNQVRP  465
            DGW VE+I+LLANPNQV P
Sbjct  81   DGWKVEKISLLANPNQVHP  99



>gb|AFK39755.1| unknown [Lotus japonicus]
Length=535

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  196  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  375
            L+ CV    C +    S+ ++EAYVTLLYGDEFLLGVRVLGKSI  T + KDMVVLVSDG
Sbjct  17   LVFCVQFQGCDSLGSTSKKNDEAYVTLLYGDEFLLGVRVLGKSICITRSNKDMVVLVSDG  76

Query  376  VSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VS YAK LL+ADGWIVE+I+LLANPN+VRP
Sbjct  77   VSDYAKNLLRADGWIVEKISLLANPNRVRP  106



>ref|XP_003590989.1| Glycogenin-1 [Medicago truncatula]
 gb|AES61240.1| glucuronosyltransferase PGSIP8 [Medicago truncatula]
Length=541

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
             S+ +E AY +LLYGDEFLLGVRVLGKSIRDT + KDMVVLVSDGVS YAK LL+ADGWI
Sbjct  20   ESKRTEVAYASLLYGDEFLLGVRVLGKSIRDTRSNKDMVVLVSDGVSDYAKNLLKADGWI  79

Query  421  VEEITLLANPNQVRP  465
            VE+I+LL NPNQVRP
Sbjct  80   VEKISLLENPNQVRP  94



>ref|XP_006648850.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Oryza 
brachyantha]
Length=524

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            ++EAYVTLLYGDEF+LGVRVLGKSIRD GT++D+VVLVSDGVS Y+++LL+ADG+IV+ I
Sbjct  13   ADEAYVTLLYGDEFVLGVRVLGKSIRDAGTSRDLVVLVSDGVSEYSRKLLEADGFIVKHI  72

Query  433  TLLANPNQVRP  465
            TLLANPNQVRP
Sbjct  73   TLLANPNQVRP  83



>gb|KHN14829.1| Glycogenin-1 [Glycine soja]
Length=519

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            S+ ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YA   LQADGWIV
Sbjct  23   SERTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYANTHLQADGWIV  82

Query  424  EEITLLANPNQV  459
            E+I+LLANPNQV
Sbjct  83   EKISLLANPNQV  94



>ref|XP_003580141.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=544

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  265  YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLA  444
            YVTLLYGDEF+LGVRVLGKSIRDTGT +DMVVLVSDGVS Y++ LL+ADGWIV+ ITLLA
Sbjct  35   YVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRGLLEADGWIVKRITLLA  94

Query  445  NPNQVRP  465
            NPNQVRP
Sbjct  95   NPNQVRP  101



>ref|XP_004495592.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cicer 
arietinum]
Length=546

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +1

Query  181  VVWLCLILCV-LNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMV  357
            ++W   I  + +N+ C  G   S+ ++ AY +LLYGDEFLLGVRVLGKSIRDT + KDMV
Sbjct  5    LLWFITIFILSVNSKCGFGS-ESKRTDVAYASLLYGDEFLLGVRVLGKSIRDTRSNKDMV  63

Query  358  VLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            VLVSDGVS YA  LL+ADGWIVE+I+LL NPNQVRP
Sbjct  64   VLVSDGVSDYANNLLEADGWIVEKISLLENPNQVRP  99



>ref|XP_009131669.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=539

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            S+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ K MV LVSDGVS Y+K+LL+ADGW VE+I
Sbjct  33   SKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKYMVALVSDGVSDYSKKLLKADGWKVEKI  92

Query  433  TLLANPNQVRP  465
            +LLANPNQV P
Sbjct  93   SLLANPNQVHP  103



>gb|EEC73629.1| hypothetical protein OsI_08135 [Oryza sativa Indica Group]
Length=547

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  256  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            +EAYVTLLYGDEF+LGVRVLGKSIRDT T++D+VVLVSDGVS Y+++LL+ADG+IV+ IT
Sbjct  37   DEAYVTLLYGDEFVLGVRVLGKSIRDTDTSRDLVVLVSDGVSEYSRKLLEADGFIVKHIT  96

Query  436  LLANPNQVRP  465
            LLANPNQVRP
Sbjct  97   LLANPNQVRP  106



>ref|NP_001047475.1| Os02g0624400 [Oryza sativa Japonica Group]
 dbj|BAD23777.1| putative glycogenin 1 [Oryza sativa Japonica Group]
 dbj|BAF09389.1| Os02g0624400 [Oryza sativa Japonica Group]
 gb|EEE57402.1| hypothetical protein OsJ_07584 [Oryza sativa Japonica Group]
Length=547

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  256  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            +EAYVTLLYGDEF+LGVRVLGKSIRDT T++D+VVLVSDGVS Y+++LL+ADG+IV+ IT
Sbjct  37   DEAYVTLLYGDEFVLGVRVLGKSIRDTDTSRDLVVLVSDGVSEYSRKLLEADGFIVKHIT  96

Query  436  LLANPNQVRP  465
            LLANPNQVRP
Sbjct  97   LLANPNQVRP  106



>ref|XP_010104622.1| hypothetical protein L484_021999 [Morus notabilis]
 gb|EXC01428.1| hypothetical protein L484_021999 [Morus notabilis]
Length=683

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +1

Query  175  FGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  354
            F +V L L+L +  N  V G PR Q ++EAYVTLLYG++FLLG RVLGKSI+DTG+TKDM
Sbjct  7    FVLVTLSLVLNIPFNGLVFGLPR-QKTDEAYVTLLYGNDFLLGARVLGKSIQDTGSTKDM  65

Query  355  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPN-QVRP  465
            V LV+DGVS YAK+LL+ADGWIV ++ L+ NPN +VRP
Sbjct  66   VALVTDGVSDYAKKLLEADGWIVTKVGLVENPNYEVRP  103



>ref|XP_010104620.1| hypothetical protein L484_021997 [Morus notabilis]
 gb|EXC01426.1| hypothetical protein L484_021997 [Morus notabilis]
Length=541

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  175  FGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  354
            F +V L L+L +  N  + G PR Q +EEAYVTLLYG++FLLG RVLGKSI+DTG+TKDM
Sbjct  7    FVLVTLSLVLNIPFNGLIFGLPR-QKTEEAYVTLLYGNDFLLGARVLGKSIQDTGSTKDM  65

Query  355  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPN-QVRP  465
            V LV+DGVS YA +LL+ADGWIV ++ L+ NPN +VRP
Sbjct  66   VALVTDGVSDYAMKLLEADGWIVTKVGLVENPNYEVRP  103



>ref|XP_001784830.1| predicted protein [Physcomitrella patens]
 gb|EDQ50340.1| predicted protein [Physcomitrella patens]
Length=560

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 3/80 (4%)
 Frame = +1

Query  226  VAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
            +AG+ RS   E AY TLLYGDEFLLGVRVLGKSIRDTG TKDMV LVSDGVS    +LL+
Sbjct  42   IAGQSRS---EHAYATLLYGDEFLLGVRVLGKSIRDTGVTKDMVALVSDGVSDAGIRLLE  98

Query  406  ADGWIVEEITLLANPNQVRP  465
            ADGWIV+ I LLANPN  RP
Sbjct  99   ADGWIVQRIELLANPNSKRP  118



>ref|XP_010235727.1| PREDICTED: LOW QUALITY PROTEIN: inositol phosphorylceramide glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=567

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  265  YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLA  444
            YVTLLYGDEF+LGVRVLGKSIRD GT +D+VVLVSDGVS Y+++LLQADG+IV+ ITLLA
Sbjct  32   YVTLLYGDEFVLGVRVLGKSIRDAGTRRDLVVLVSDGVSEYSRKLLQADGFIVKHITLLA  91

Query  445  NPNQVRP  465
            NPNQVRP
Sbjct  92   NPNQVRP  98



>dbj|BAK04525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  265  YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLA  444
            YVTLLYGDEF+LGVRVLGKSIRD GT +D+VVLVSDGVS Y+++LL+ADG+IV+ ITLLA
Sbjct  39   YVTLLYGDEFVLGVRVLGKSIRDMGTRRDLVVLVSDGVSDYSRKLLEADGFIVKHITLLA  98

Query  445  NPNQVRP  465
            NPNQVRP
Sbjct  99   NPNQVRP  105



>ref|XP_002962043.1| hypothetical protein SELMODRAFT_62883, partial [Selaginella moellendorffii]
 gb|EFJ37303.1| hypothetical protein SELMODRAFT_62883, partial [Selaginella moellendorffii]
Length=473

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  262  AYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLL  441
            AYVTLLYGDEFLLGVRVLGKSIRDTGT+KD+ VLVSDGVS  A +LL+ADGWIVE I LL
Sbjct  1    AYVTLLYGDEFLLGVRVLGKSIRDTGTSKDLAVLVSDGVSMDAIRLLEADGWIVERIELL  60

Query  442  ANPNQVRP  465
            +NPNQ RP
Sbjct  61   SNPNQQRP  68



>ref|XP_002971046.1| hypothetical protein SELMODRAFT_62885, partial [Selaginella moellendorffii]
 gb|EFJ27644.1| hypothetical protein SELMODRAFT_62885, partial [Selaginella moellendorffii]
Length=473

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  262  AYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLL  441
            AYVTLLYGDEFLLGVRVLGKSIRDTGT+KD+ VLVSDGVS  A +LL+ADGWIVE I LL
Sbjct  1    AYVTLLYGDEFLLGVRVLGKSIRDTGTSKDLAVLVSDGVSMDAIRLLEADGWIVERIELL  60

Query  442  ANPNQVRP  465
            +NPNQ RP
Sbjct  61   SNPNQQRP  68



>ref|XP_001759731.1| predicted protein [Physcomitrella patens]
 gb|EDQ75643.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            + S +AY TLLYGDEFLLGVRVLGKSIR+TG  KDMV LVSDGVS    +LL+ADGWIV+
Sbjct  46   KRSGQAYATLLYGDEFLLGVRVLGKSIRNTGVAKDMVALVSDGVSETGIRLLKADGWIVQ  105

Query  427  EITLLANPNQVRP  465
             I LLANPN  RP
Sbjct  106  RIKLLANPNSKRP  118



>ref|XP_006852965.1| hypothetical protein AMTR_s01206p00007610, partial [Amborella 
trichopoda]
 gb|ERN14432.1| hypothetical protein AMTR_s01206p00007610, partial [Amborella 
trichopoda]
Length=80

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  235  EPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
            E    S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDGVS YA +LL+
Sbjct  24   EKIHDSRPEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDGVSDYANRLLK  80



>gb|KGN61304.1| hypothetical protein Csa_2G078080 [Cucumis sativus]
Length=104

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  256  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADG  414
            +EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV L+SDGVS YAK+LL++ G
Sbjct  35   DEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVALISDGVSEYAKKLLESSG  87



>gb|KJB44790.1| hypothetical protein B456_007G273500 [Gossypium raimondii]
Length=419

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 66/100 (66%), Gaps = 15/100 (15%)
 Frame = +1

Query  172  RFGVVWLC--LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT  345
            +F  +W+   ++L  + +    G     SS++AYVTLLYGD              DTG+T
Sbjct  2    KFPKLWILFLVLLVTIQSKLALGAKAQYSSKQAYVTLLYGDG-------------DTGST  48

Query  346  KDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            K+MVVLVSDGVS YAK+LL+ADGWIVE I+LL NPNQVRP
Sbjct  49   KEMVVLVSDGVSDYAKKLLEADGWIVENISLLVNPNQVRP  88



>gb|AFW58865.1| hypothetical protein ZEAMMB73_149865 [Zea mays]
Length=82

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADG  414
            +EEAYVTLLYGDEF+LG RVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQ  G
Sbjct  28   TEEAYVTLLYGDEFVLGARVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQTVG  81



>gb|KDD73670.1| hypothetical protein H632_c1943p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=339

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 65/88 (74%), Gaps = 5/88 (6%)
 Frame = +1

Query  196  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVL-VSD  372
            L +C++   C AG    +SS+ AYV+LLYGD+FLL +RVLG+S+++T +T+DMV L VSD
Sbjct  9    LFVCIV---CCAGFVVGKSSQ-AYVSLLYGDDFLLALRVLGQSLKETDSTRDMVALAVSD  64

Query  373  GVSSYAKQLLQADGWIVEEITLLANPNQ  456
             VS+ A+++L  +GW V  ++ ++NP +
Sbjct  65   SVSAEAEEILSLEGWHVRRVSAISNPGR  92



>ref|XP_001702759.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06538.1| predicted protein [Chlamydomonas reinhardtii]
Length=128

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            + EAY TL+YG++F+LG RVLG+S+R+ GTT+DMV L +  +S+ ++  L +DGW V  +
Sbjct  31   APEAYATLVYGEDFVLGARVLGQSLREAGTTRDMVALTTGSLSAASELTLASDGWRVIHV  90

Query  433  TLLANPNQ  456
              +ANP +
Sbjct  91   APVANPGK  98



>ref|XP_005844956.1| hypothetical protein CHLNCDRAFT_138328 [Chlorella variabilis]
 gb|EFN52854.1| hypothetical protein CHLNCDRAFT_138328 [Chlorella variabilis]
Length=650

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            AG     ++ EA+ TL+Y D FLLG RVLG+S+R+TGTT+D+V LV++ VS  A   L  
Sbjct  42   AGARIHPTAAEAFATLVYSDLFLLGARVLGQSLRETGTTRDLVALVTESVSQQAADTLAL  101

Query  409  DGWIVEEITLLANP  450
            DGW V+ + L+ NP
Sbjct  102  DGWKVQRVGLVTNP  115



>emb|CBN79165.1| Glycosyltransferase, family GT8 [Ectocarpus siliculosus]
Length=837

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +Q S  AY TLLY D F+ G R LG+S+R++GT+ D VVLV+  V    +Q L  DGWIV
Sbjct  102  AQPSRRAYATLLYSD-FIEGTRALGQSLRESGTSADTVVLVTPDVRQETRQKLAEDGWIV  160

Query  424  EEITLLANPNQ  456
              + +  NPNQ
Sbjct  161  RPVAVETNPNQ  171



>gb|EMS55946.1| Glycogenin-1 [Triticum urartu]
Length=480

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  337  GTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRP  465
            GT +D+VVLVSDGVS Y+++LL+ADG+IV+ ITLLANPNQVRP
Sbjct  2    GTRRDLVVLVSDGVSDYSRKLLEADGFIVKHITLLANPNQVRP  44



>ref|XP_002954821.1| hypothetical protein VOLCADRAFT_106550 [Volvox carteri f. nagariensis]
 gb|EFJ44020.1| hypothetical protein VOLCADRAFT_106550 [Volvox carteri f. nagariensis]
Length=599

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            S EAY TL+YG++F+L  RVLG+S+R++GTT+DMV L +  + + ++  L ADGW V  +
Sbjct  32   SSEAYATLVYGEDFVLAARVLGQSLRESGTTRDMVALTTGSLKASSELTLAADGWRVVHV  91

Query  433  TLLANP  450
              + NP
Sbjct  92   APVKNP  97



>ref|XP_010921630.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=659

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 50/77 (65%), Gaps = 2/77 (3%)
 Frame = +1

Query  238  PRSQSSE-EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            PRS++ + EAYVT+L+  D ++ G     +SIR TG+TKD+V+LV + +S++ +  L+A 
Sbjct  331  PRSKTGQREAYVTILHSADAYVCGAITAAQSIRLTGSTKDLVILVDETISNHHRSGLEAA  390

Query  412  GWIVEEITLLANPNQVR  462
            GW V  I  + NP   R
Sbjct  391  GWKVRTIQRIRNPKAKR  407



>ref|XP_010921631.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
 ref|XP_010921632.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
Length=633

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 50/77 (65%), Gaps = 2/77 (3%)
 Frame = +1

Query  238  PRSQSSE-EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            PRS++ + EAYVT+L+  D ++ G     +SIR TG+TKD+V+LV + +S++ +  L+A 
Sbjct  305  PRSKTGQREAYVTILHSADAYVCGAITAAQSIRLTGSTKDLVILVDETISNHHRSGLEAA  364

Query  412  GWIVEEITLLANPNQVR  462
            GW V  I  + NP   R
Sbjct  365  GWKVRTIQRIRNPKAKR  381



>ref|XP_010428781.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  421  VEEITLLANPNQV  459
            ++    + NPN V
Sbjct  340  IQMFQRIRNPNAV  352



>ref|XP_010471900.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  421  VEEITLLANPNQV  459
            ++    + NPN V
Sbjct  340  IQMFQRIRNPNAV  352



>ref|XP_010416641.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  421  VEEITLLANPNQV  459
            ++    + NPN V
Sbjct  340  IQMFQRIRNPNAV  352



>gb|EMT33175.1| hypothetical protein F775_16539 [Aegilops tauschii]
Length=713

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 8/51 (16%)
 Frame = +1

Query  337  GTTKDMVVLVSDGVSSYAKQLLQ--------ADGWIVEEITLLANPNQVRP  465
            GT +D+VVLVSDGVS Y+++LL+        ADG+IV+ I LLANPNQVRP
Sbjct  2    GTRRDLVVLVSDGVSDYSRKLLEGIDRETRGADGFIVKHIILLANPNQVRP  52



>ref|XP_006302009.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
 gb|EOA34907.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
Length=618

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            +    EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASEKREAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  421  VEEITLLANPNQV  459
            +     + NPN +
Sbjct  340  IHMFQRIRNPNAI  352



>gb|AIA93768.1| mannosyl_trans3, partial [uncultured bacterium]
Length=125

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +1

Query  256  EEAYVTLL-YGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            E AYVT L  GD ++ GV  LGKS+  TGT +  VVLV+  V   A+ LL + GW + +I
Sbjct  2    ETAYVTTLCNGDGYVPGVEALGKSLDLTGTKRPKVVLVTPDVPDSARALLSSQGWWIRDI  61

Query  433  TLLANPNQ  456
              ++NP++
Sbjct  62   EPISNPSE  69



>ref|XP_002992480.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
 gb|EFJ06418.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
Length=516

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  238  PRSQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADG  414
            PR  +S EAY T+L+  +F + G   L +SIR +G+ +D+V+LV + +  + ++ L+A G
Sbjct  178  PRKHASREAYATILHSAQFYVCGAISLARSIRMSGSKRDLVILVDENIHPHHREGLEAAG  237

Query  415  WIVEEITLLANP  450
            W V +I  + NP
Sbjct  238  WRVIQIQRIRNP  249



>ref|XP_011466789.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Fragaria vesca subsp. vesca]
Length=634

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +  EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + +S Y +  LQA GWIV+
Sbjct  298  ARREAYATILHSADVYVCGAISAAQSIRMAGSTRDLVILVDETISGYHRSGLQAAGWIVK  357

Query  427  EITLLANP  450
             I  + NP
Sbjct  358  TIQRIRNP  365



>ref|XP_003568405.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=628

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  256  EEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
             EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I
Sbjct  299  REAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDSISDHHRKGLEAAGWKVRII  358

Query  433  TLLANPNQVR  462
              + NP   R
Sbjct  359  QRIRNPKAER  368



>ref|XP_002889125.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65384.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
Length=618

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  L A GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDTISEYHKSGLVAAGWK  339

Query  421  VEEITLLANPNQV  459
            +     + NPN +
Sbjct  340  IHMFQRIRNPNAI  352



>ref|XP_003564767.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=632

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L+A GW V  I 
Sbjct  304  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDDTISEHHRKGLEAAGWKVRIIE  363

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  364  RIRNPKAER  372



>ref|XP_010674823.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
4 [Beta vulgaris subsp. vulgaris]
Length=513

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
              S EAYVT+L+  ++ + G   L +SI  T TTKD+V+L    +S +++Q L+A GW V
Sbjct  221  HKSREAYVTVLHSSQYYVCGAITLAQSILQTNTTKDLVLLADRTISKHSRQGLEAAGWKV  280

Query  424  EEITLLANPN  453
            + I  + +PN
Sbjct  281  KRIDRIRSPN  290



>ref|XP_006406580.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
 gb|ESQ48033.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
Length=658

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G PR     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  316  GNPR----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  371

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  372  AGWQIRTIQRIRNP  385



>ref|XP_006645120.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Oryza brachyantha]
Length=636

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L+A GW V  I 
Sbjct  307  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDDTISDHHRKGLEAAGWKVRIIQ  366

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  367  RIRNPKAER  375



>ref|NP_177838.2| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 sp|Q8W4A7.1|GUX3_ARATH RecName: Full=Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3; Short=UDP-GlcA:xylan glucuronyltransferase 
3; AltName: Full=Glycogenin-like protein 3; AltName: Full=Plant 
glycogenin-like starch initiation protein 2; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 3; Short=AtGUX3 
[Arabidopsis thaliana]
 gb|AAL32773.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47996.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35939.1| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 gb|AHL38869.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=618

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 6/83 (7%)
 Frame = +1

Query  214  NNYCVAGEPRSQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYA  390
            +N+  AG     + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV + +S Y 
Sbjct  275  DNFYSAG-----AKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDETISEYH  329

Query  391  KQLLQADGWIVEEITLLANPNQV  459
            K  L A GW ++    + NPN V
Sbjct  330  KSGLVAAGWKIQMFQRIRNPNAV  352



>dbj|BAJ87020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  35   EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  94

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  95   RIRNPKAER  103



>gb|EPS60482.1| hypothetical protein M569_14321, partial [Genlisea aurea]
Length=317

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+ GD ++ G  V  +SIR TG+T+D+V LV + +S Y K  L+  GW +  + 
Sbjct  11   EAYATILHSGDGYVCGAIVSAQSIRMTGSTRDLVALVDESISEYHKSGLREAGWKIRPLE  70

Query  436  LLANP  450
             + NP
Sbjct  71   PIMNP  75



>ref|XP_011406812.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Amphimedon queenslandica]
Length=478

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = +1

Query  196  LILCVLNNYCVAGEPRSQSSEE---AYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  366
            LI+ +L  Y   G    ++ E+   A VT+LYG  F LGVRVLG+SIR++ TT + VV+ 
Sbjct  8    LIILLLTFYFSEGVEYIKNEEQPRGALVTILYGTGFELGVRVLGQSIRESKTTLEYVVMC  67

Query  367  SDGVSSYAKQLLQADGWIVEEI  432
            +  V      +L+ DGW ++ I
Sbjct  68   TRDVPQETIAVLKKDGWKIKMI  89



>gb|EEC79261.1| hypothetical protein OsI_20036 [Oryza sativa Indica Group]
Length=671

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I 
Sbjct  347  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQ  406

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  407  RIRNPKAER  415



>ref|XP_010680250.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010680251.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=644

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 44/74 (59%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G PR     EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + +S+Y +  L+A
Sbjct  306  GNPR----REAYATILHSADVYVCGAIAAAQSIRMVGSTRDLVILVDESISAYYRSGLEA  361

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  362  AGWKIRTIQRIRNP  375



>tpg|DAA44094.1| TPA: hypothetical protein ZEAMMB73_670696 [Zea mays]
Length=503

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  362

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  363  RIRNPKAER  371



>gb|AAS90653.1| putative glycogenin [Oryza sativa Japonica Group]
Length=671

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I 
Sbjct  347  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQ  406

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  407  RIRNPKAER  415



>gb|KCW62287.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=633

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +  EAY T+L+  D ++ G     +SIR  G+T+D+V+LV D +S+Y +  L+A GW + 
Sbjct  298  ARREAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDDSISNYHRSGLEAAGWKIR  357

Query  427  EITLLANP  450
             I  + NP
Sbjct  358  TIQRIRNP  365



>ref|XP_010025567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 ref|XP_010025568.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 gb|KCW62286.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=639

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +  EAY T+L+  D ++ G     +SIR  G+T+D+V+LV D +S+Y +  L+A GW + 
Sbjct  304  ARREAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDDSISNYHRSGLEAAGWKIR  363

Query  427  EITLLANP  450
             I  + NP
Sbjct  364  TIQRIRNP  371



>gb|AAC34345.1| Unknown protein [Arabidopsis thaliana]
Length=1201

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            + + +EAY T+L+ D+ F+ G   + +SIR +G+T+++V+LV D +S Y +  L++ GW 
Sbjct  256  ANAKKEAYATILHSDDAFVCGAIAVAQSIRMSGSTRNLVILVDDSISEYHRSGLESAGWK  315

Query  421  VEEITLLANP  450
            +     + NP
Sbjct  316  IHTFQRIRNP  325


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 6/83 (7%)
 Frame = +1

Query  214  NNYCVAGEPRSQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYA  390
            +N+  AG     + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV + +S Y 
Sbjct  858  DNFYSAG-----AKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDETISEYH  912

Query  391  KQLLQADGWIVEEITLLANPNQV  459
            K  L A GW ++    + NPN V
Sbjct  913  KSGLVAAGWKIQMFQRIRNPNAV  935



>gb|EEE63788.1| hypothetical protein OsJ_18611 [Oryza sativa Japonica Group]
Length=684

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I 
Sbjct  360  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQ  419

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  420  RIRNPKAER  428



>gb|KFK39187.1| hypothetical protein AALP_AA3G211300 [Arabis alpina]
Length=1277

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 5/74 (7%)
 Frame = +1

Query  232   GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
             G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A
Sbjct  935   GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDENISSYHRSGLEA  990

Query  409   DGWIVEEITLLANP  450
              GW +  I  + NP
Sbjct  991   AGWQIRTIQRIRNP  1004



>dbj|BAJ87861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  19   EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIE  78

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  79   RIRNPKAER  87



>ref|XP_008803691.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Phoenix dactylifera]
Length=746

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  235  EPRSQSS-EEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            +P S++   EAY T+L+  D ++ G     +SIR TG+T+D+V+LV + +S++ +  L+A
Sbjct  433  QPYSKTGLREAYATVLHSADVYVCGAITAAQSIRLTGSTRDLVILVDETISNHHRSGLEA  492

Query  409  DGWIVEEITLLANPNQVR  462
             GW V  I  + NP   R
Sbjct  493  AGWKVRTIQRIRNPKAQR  510



>gb|AGT16755.1| glycogenin [Saccharum hybrid cultivar R570]
Length=631

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  256  EEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
             EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I
Sbjct  302  REAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRII  361

Query  433  TLLANPNQVR  462
              + NP   R
Sbjct  362  QRIRNPKAER  371



>ref|XP_002280832.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
4 [Vitis vinifera]
 emb|CBI36767.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 7/80 (9%)
 Frame = +1

Query  217  NYCVAGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAK  393
            NY +  +PR     EAY T+L+  E ++ G   L +SI  TG+TKD+V+L  + ++S + 
Sbjct  254  NYAI-NKPR-----EAYATILHSSEAYVCGAIALAQSITQTGSTKDLVLLADNSITSRSL  307

Query  394  QLLQADGWIVEEITLLANPN  453
            Q L+A GW ++ I  + +PN
Sbjct  308  QGLRAAGWKIKHIERIRSPN  327



>emb|CAN81983.1| hypothetical protein VITISV_042631 [Vitis vinifera]
Length=546

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 7/80 (9%)
 Frame = +1

Query  217  NYCVAGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAK  393
            NY +  +PR     EAY T+L+  E ++ G   L +SI  TG+TKD+V+L  + ++S + 
Sbjct  254  NYAI-NKPR-----EAYATILHSSEAYVCGAIALAQSITQTGSTKDLVLLADNSITSRSL  307

Query  394  QLLQADGWIVEEITLLANPN  453
            Q L+A GW ++ I  + +PN
Sbjct  308  QGLRAAGWKIKHIERIRSPN  327



>ref|NP_001189927.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AEE76129.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=654

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  312  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  367

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  368  AGWQIRTIQRIRNP  381



>ref|NP_566615.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AAL07212.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13228.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76127.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=655

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  313  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  368

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  369  AGWQIRTIQRIRNP  382



>ref|NP_001030722.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 sp|Q9LSB1.1|GUX1_ARATH RecName: Full=UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1; Short=UDP-GlcA:xylan glucuronyltransferase 1; AltName: 
Full=Glycogenin-like protein 1; AltName: Full=Plant glycogenin-like 
starch initiation protein 1; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 1; Short=AtGUX1 [Arabidopsis 
thaliana]
 dbj|BAB01792.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU93699.1| glycogenin-like starch initiation protein [Arabidopsis thaliana]
 gb|AEE76128.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AHL38759.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=659

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  373  AGWQIRTIQRIRNP  386



>ref|XP_002885270.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61529.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
Length=659

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  373  AGWQIRTIQRIRNP  386



>ref|XP_010487789.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=660

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  373  AGWQIRTIQRIRNP  386



>ref|XP_010507061.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Camelina sativa]
Length=660

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  373  AGWQIRTIQRIRNP  386



>ref|XP_009112567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Brassica rapa]
Length=660

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  316  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  371

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  372  AGWQIRTIQRIRNP  385



>emb|CDY18535.1| BnaA01g26600D [Brassica napus]
Length=660

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  316  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  371

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  372  AGWQIRTIQRIRNP  385



>ref|XP_010465976.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=661

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  318  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  373

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  374  AGWQIRTIQRIRNP  387



>ref|XP_009112560.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Brassica rapa]
Length=661

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  373  AGWQIRTIQRIRNP  386



>ref|XP_006297149.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
 gb|EOA30047.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
Length=664

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  321  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  376

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  377  AGWQIRTIQRIRNP  390



>gb|EEC71899.1| hypothetical protein OsI_04661 [Oryza sativa Indica Group]
Length=635

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  306  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  365

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  366  RIRNPKAER  374



>ref|NP_001044991.1| Os01g0880200 [Oryza sativa Japonica Group]
 dbj|BAD81673.1| glycogenin-like protein [Oryza sativa Japonica Group]
 dbj|BAF06905.1| Os01g0880200 [Oryza sativa Japonica Group]
Length=635

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  306  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  365

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  366  RIRNPKAER  374



>ref|XP_011405481.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Amphimedon queenslandica]
Length=408

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
             ++  +A VT+L+G  F LGVRVLG+SIR++ T  D VV+ +  V     Q+L+ DGW +
Sbjct  30   EKNKPDAIVTILFGKGFELGVRVLGQSIRESKTKLDYVVMCTHDVPPETIQVLKKDGWKI  89

Query  424  EEI  432
              I
Sbjct  90   RMI  92



>ref|XP_009404954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404955.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=644

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  256  EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
             EAY T+L+  E ++ G     +SIR +G+ +D+V+LV D +S + +  L+A GW V  +
Sbjct  315  REAYATILHSAERYVCGAIAAARSIRSSGSARDLVILVDDTISEHDRSGLEAAGWKVRTM  374

Query  433  TLLANPNQVR  462
              + NP   R
Sbjct  375  ERIRNPKAKR  384



>ref|XP_009404956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=641

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  256  EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
             EAY T+L+  E ++ G     +SIR +G+ +D+V+LV D +S + +  L+A GW V  +
Sbjct  312  REAYATILHSAERYVCGAIAAARSIRSSGSARDLVILVDDTISEHDRSGLEAAGWKVRTM  371

Query  433  TLLANPNQVR  462
              + NP   R
Sbjct  372  ERIRNPKAKR  381



>ref|XP_006588938.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=91

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGW  417
            EAY T+L+    ++ G   + +SIR +G+T+D+V+LV + +SSY +  L+A GW
Sbjct  17   EAYATILHSAHVYVCGAIAVAQSIRKSGSTRDLVILVDETISSYHRSGLEAAGW  70



>ref|XP_004985459.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X2 [Setaria italica]
Length=495

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
             G PR     EAY T+L+  D +L G  VL +SIR  G+T+D+++L    VS  A + L 
Sbjct  199  GGRPR----REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLILLHDHTVSKPALRALS  254

Query  406  ADGWIVEEITLLANPNQVR  462
            A GW   +I  + NP   R
Sbjct  255  AAGWTPRKIKRIRNPRAAR  273



>gb|KHN09596.1| Glycogenin-1 [Glycine soja]
Length=639

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            ++ EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V 
Sbjct  304  AAREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVR  363

Query  427  EITLLANP  450
             I  + NP
Sbjct  364  TIQRIRNP  371



>ref|XP_002468380.1| hypothetical protein SORBIDRAFT_01g044930 [Sorghum bicolor]
 gb|EER95378.1| hypothetical protein SORBIDRAFT_01g044930 [Sorghum bicolor]
Length=605

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
             G PR     EAY T+L+  D +L G  VL +SIR +G+T+D+++L    VS  A + L 
Sbjct  309  GGRPR----REAYATVLHSSDTYLCGAIVLAQSIRRSGSTRDLILLHDHTVSKPALRALT  364

Query  406  ADGWIVEEITLLANPNQVR  462
            A GW    I  + NP   R
Sbjct  365  AAGWTPRRIKRIRNPRAAR  383



>ref|XP_008674740.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Zea mays]
 tpg|DAA56541.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=634

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  362

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  363  RIRNPKAER  371



>ref|XP_004985458.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X1 [Setaria italica]
Length=634

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
             G PR     EAY T+L+  D +L G  VL +SIR  G+T+D+++L    VS  A + L 
Sbjct  338  GGRPR----REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLILLHDHTVSKPALRALS  393

Query  406  ADGWIVEEITLLANPNQVR  462
            A GW   +I  + NP   R
Sbjct  394  AAGWTPRKIKRIRNPRAAR  412



>ref|XP_008654538.1| PREDICTED: uncharacterized protein LOC100272808 isoform X1 [Zea 
mays]
 gb|AFW84389.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
 gb|AFW84390.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
Length=641

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  362

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  363  RIRNPKAER  371



>ref|XP_002456736.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
 gb|EES01856.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
Length=633

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIE  362

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  363  RIRNPKAER  371



>gb|KCW44877.1| hypothetical protein EUGRSUZ_L01540, partial [Eucalyptus grandis]
Length=482

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  I 
Sbjct  208  EAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHIH  267

Query  436  LLANPN  453
             + +PN
Sbjct  268  RIRSPN  273



>ref|XP_009348497.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348516.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=646

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +   EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + ++ Y ++ L+A GW +
Sbjct  310  KPHREAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKI  369

Query  424  EEITLLANP  450
              I  + NP
Sbjct  370  HTIQRIRNP  378



>ref|XP_006858468.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
 gb|ERN19935.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
Length=640

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
            AG PR     EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +SS+ +  L 
Sbjct  305  AGNPR----REAYATILHSAHIYVCGAIAAAQSIRLTGSTRDLVILVDETISSHHRSGLA  360

Query  406  ADGWIVEEITLLANP  450
            A GW +  I  + NP
Sbjct  361  AAGWKIRTIQRIRNP  375



>tpg|DAA56540.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=640

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  309  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  368

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  369  RIRNPKAER  377



>ref|XP_008373920.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +   EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + ++ Y ++ L+A GW +
Sbjct  310  KPHREAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKI  369

Query  424  EEITLLANP  450
              I  + NP
Sbjct  370  HTIQRIRNP  378



>ref|XP_010040835.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
5 isoform X2 [Eucalyptus grandis]
Length=584

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  I 
Sbjct  288  EAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHIH  347

Query  436  LLANPN  453
             + +PN
Sbjct  348  RIRSPN  353



>ref|XP_010040834.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
5 isoform X1 [Eucalyptus grandis]
Length=592

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  I 
Sbjct  296  EAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHIH  355

Query  436  LLANPN  453
             + +PN
Sbjct  356  RIRSPN  361



>gb|EYU29759.1| hypothetical protein MIMGU_mgv1a017852mg, partial [Erythranthe 
guttata]
Length=462

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            ++  EAY T+L+  ++++ G     +SIR +G+T+D+V+LV + +  + ++ LQ+ GW V
Sbjct  297  KTQREAYTTILHSANDYVCGAIAAAQSIRMSGSTRDLVILVDESIGDHHRRGLQSSGWKV  356

Query  424  EEITLLANP  450
              I  + NP
Sbjct  357  RTIKRIRNP  365



>emb|CDY53768.1| BnaC01g43920D [Brassica napus]
Length=660

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  232  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  408
            G P+     EAY T+L+    ++ G     +SIR +G+T D+V+LV D +S Y +  L+A
Sbjct  316  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTSDLVILVDDNISGYHRSGLEA  371

Query  409  DGWIVEEITLLANP  450
             GW +  I  + NP
Sbjct  372  AGWQIRTIQRIRNP  385



>gb|KHG12057.1| Glycogenin-2 [Gossypium arboreum]
Length=646

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
             ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW 
Sbjct  309  ERAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWK  368

Query  421  VEEITLLANP  450
            +  I  + NP
Sbjct  369  IYTIQRIRNP  378



>ref|NP_001049188.2| Os03g0184300 [Oryza sativa Japonica Group]
 gb|ABF94346.1| glycogenin glucosyltransferase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11102.2| Os03g0184300 [Oryza sativa Japonica Group]
Length=500

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
            AG PR     EAY T+L+  D +L G  VL +SIR  G+T+D+V+L    VS  A   L 
Sbjct  204  AGRPR----REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLVLLHDHTVSKPALAALV  259

Query  406  ADGWIVEEITLLANPNQVR  462
            A GW   +I  + NP   R
Sbjct  260  AAGWTPRKIKRIRNPRAER  278



>gb|KDP24792.1| hypothetical protein JCGZ_25413 [Jatropha curcas]
Length=630

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
            +G PR     EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y K  L+
Sbjct  292  SGNPR----REAYATILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDESISLYHKSGLE  347

Query  406  ADGWIVEEITLLANP  450
            A GW +  I  + NP
Sbjct  348  AAGWKIRTIQRIRNP  362



>gb|EAY88814.1| hypothetical protein OsI_10286 [Oryza sativa Indica Group]
Length=613

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
            AG PR     EAY T+L+  D +L G  VL +SIR  G+T+D+V+L    VS  A   L 
Sbjct  317  AGRPR----REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLVLLHDHTVSKPALAALV  372

Query  406  ADGWIVEEITLLANPNQVR  462
            A GW   +I  + NP   R
Sbjct  373  AAGWTPRKIKRIRNPRAER  391



>gb|AAK92624.1|AC079633_4 Putative glycogenin [Oryza sativa Japonica Group]
 gb|ABF94345.1| glycogenin glucosyltransferase, putative, expressed [Oryza sativa 
Japonica Group]
Length=614

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  405
            AG PR     EAY T+L+  D +L G  VL +SIR  G+T+D+V+L    VS  A   L 
Sbjct  318  AGRPR----REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLVLLHDHTVSKPALAALV  373

Query  406  ADGWIVEEITLLANPNQVR  462
            A GW   +I  + NP   R
Sbjct  374  AAGWTPRKIKRIRNPRAER  392



>gb|ABK25357.1| unknown [Picea sitchensis]
Length=611

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+  EF + G   L +SIR +G+ KD+++LV   V    ++ L+A GW V EI 
Sbjct  321  EAYATILHSSEFYVCGAIALAQSIRMSGSMKDLIILVDKKVGEEKREGLRAAGWQVREIR  380

Query  436  LLANP  450
             + NP
Sbjct  381  RIRNP  385



>gb|KHG15344.1| Glycogenin-2 [Gossypium arboreum]
Length=640

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +S +AY T+L+    ++ G   + +SIR +G+T+D+V+LV + +++Y K  L+A GW V 
Sbjct  305  ASRQAYATILHSAHVYVCGAIAVARSIRLSGSTRDLVILVDEMITAYHKSGLEAAGWKVR  364

Query  427  EITLLANP  450
             I  + NP
Sbjct  365  TIQRIRNP  372



>gb|KHN31133.1| Glycogenin-2 [Glycine soja]
Length=633

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +  EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V 
Sbjct  298  APREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVR  357

Query  427  EITLLANP  450
             I  + NP
Sbjct  358  TIQRIRNP  365



>ref|XP_006581757.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=639

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +  EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V 
Sbjct  304  APREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVR  363

Query  427  EITLLANP  450
             I  + NP
Sbjct  364  TIQRIRNP  371



>ref|XP_006578795.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Glycine max]
 ref|XP_006578796.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Glycine max]
Length=639

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +  EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V 
Sbjct  304  APREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVR  363

Query  427  EITLLANP  450
             I  + NP
Sbjct  364  TIQRIRNP  371



>ref|XP_002441128.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
 gb|EES19558.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
Length=631

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRIIQ  362

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  363  RIRNPKAER  371



>ref|XP_010040896.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
4, partial [Eucalyptus grandis]
Length=437

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  256  EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
             EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  +
Sbjct  210  REAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHM  269

Query  433  TLLANPN  453
              + +PN
Sbjct  270  QRIRSPN  276



>tpg|DAA43741.1| TPA: hypothetical protein ZEAMMB73_319049 [Zea mays]
Length=491

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +1

Query  208  VLNNYCVAGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSS  384
            VLN    +G  R +   EAY T+L+  D +L G  VL +SIR  G+T+D+V+L    VS 
Sbjct  186  VLNATSWSGGRRPR--REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLVLLHDHTVSR  243

Query  385  YAKQLLQADGWIVEEITLLANPNQVR  462
             A + L A GW    I  + NP   R
Sbjct  244  PALRALSAAGWTPRRIKRIRNPRAAR  269



>ref|XP_008673893.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR36345.1| unknown [Zea mays]
Length=493

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +1

Query  208  VLNNYCVAGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSS  384
            VLN    +G  R +   EAY T+L+  D +L G  VL +SIR  G+T+D+V+L    VS 
Sbjct  188  VLNATSWSGGRRPR--REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLVLLHDHTVSR  245

Query  385  YAKQLLQADGWIVEEITLLANPNQVR  462
             A + L A GW    I  + NP   R
Sbjct  246  PALRALSAAGWTPRRIKRIRNPRAAR  271



>dbj|BAJ85213.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=628

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  300  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIE  359

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  360  RIRNPKAER  368



>dbj|BAJ97980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 5/96 (5%)
 Frame = +1

Query  178  GVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDM  354
            G   L + L  L    V+  PR     EAY T+L+ ++ +  G  V  +SIR  G+ +DM
Sbjct  296  GSCRLAMPLRALGEAYVSAAPR----REAYATILHSEQLYACGAMVAAQSIRMAGSDRDM  351

Query  355  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVR  462
            V LV + +S   +  L+A GW V  I  + NP   R
Sbjct  352  VALVDETISERHRSALEAAGWKVRAIRRIRNPRASR  387



>ref|XP_001777541.1| predicted protein [Physcomitrella patens]
 gb|EDQ57584.1| predicted protein [Physcomitrella patens]
Length=535

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +1

Query  244  SQSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            S S +EAY T+L+ G +++ G      SIR +G+T+D+V+LV   +S   +Q LQ  GW 
Sbjct  211  SDSQKEAYATILHSGSDYVCGAIATAHSIRKSGSTRDLVILVDSSISPEQRQALQEAGWK  270

Query  421  VEEI  432
            V ++
Sbjct  271  VRDL  274



>ref|XP_001783069.1| predicted protein [Physcomitrella patens]
 gb|EDQ52138.1| predicted protein [Physcomitrella patens]
Length=542

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  256  EEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  432
            +EAYVT+L+ G +++ G  V   SIR TG+TKD+V+LV   +S   +Q L   GW V ++
Sbjct  225  KEAYVTILHSGADYVCGAIVTAHSIRKTGSTKDLVILVDSSISPEQRQALGEAGWEVRDL  284

Query  433  TLLANPNQVR  462
              +   N V 
Sbjct  285  ERIYKSNIVE  294



>ref|NP_001130837.1| hypothetical protein [Zea mays]
 gb|ACF79205.1| unknown [Zea mays]
 tpg|DAA43740.1| TPA: hypothetical protein ZEAMMB73_319049 [Zea mays]
Length=593

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +1

Query  208  VLNNYCVAGEPRSQSSEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSS  384
            VLN    +G  R +   EAY T+L+  D +L G  VL +SIR  G+T+D+V+L    VS 
Sbjct  288  VLNATSWSGGRRPR--REAYATVLHSSDTYLCGAIVLAQSIRRAGSTRDLVLLHDHTVSR  345

Query  385  YAKQLLQADGWIVEEITLLANPNQVR  462
             A + L A GW    I  + NP   R
Sbjct  346  PALRALSAAGWTPRRIKRIRNPRAAR  371



>gb|EMT13493.1| Glycogenin-1 [Aegilops tauschii]
Length=685

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  355  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIE  414

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  415  RIRNPKAER  423



>dbj|BAJ87677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=633

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  304  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  363

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  364  RIRNPKAER  372



>gb|EMS55920.1| Glycogenin-1 [Triticum urartu]
Length=622

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  292  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  351

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  352  RIRNPKAER  360



>emb|CDM85463.1| unnamed protein product [Triticum aestivum]
Length=634

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  304  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  363

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  364  RIRNPKAER  372



>ref|XP_002990211.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
 gb|EFJ08771.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
Length=528

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            + +S EAY T+L+  +F + G   L +SIR +G+ +D+V+LV + +  + ++ L+A GW 
Sbjct  192  AHASREAYATILHSAQFYVCGAISLARSIRMSGSKRDLVILVDENIHPHHREGLEAAGWR  251

Query  421  VEEITLLANP  450
            V +I  + NP
Sbjct  252  VIQIQRIRNP  261



>ref|XP_008647982.1| PREDICTED: LOC100286027 isoform X2 [Zea mays]
 gb|ACR37754.1| unknown [Zea mays]
Length=546

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  221  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQ  280

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  281  RIRNPKAER  289



>gb|EMT19434.1| Glycogenin-1 [Aegilops tauschii]
Length=642

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  312  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  371

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  372  RIRNPKAER  380



>gb|EPS63087.1| hypothetical protein M569_11696, partial [Genlisea aurea]
Length=329

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+  + ++ G  V  +SIR TG+T+D+V+LV   +S + +  L+A GW +  I 
Sbjct  6    EAYATILHSAQVYVCGAIVAAQSIRMTGSTRDLVILVDSTISEHHRSGLRAAGWKIHTIE  65

Query  436  LLANP  450
             + NP
Sbjct  66   RIKNP  70



>ref|XP_010040839.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
4 [Eucalyptus grandis]
Length=585

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  + 
Sbjct  289  EAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHMQ  348

Query  436  LLANPN  453
             + +PN
Sbjct  349  RIRSPN  354



>gb|KJB71319.1| hypothetical protein B456_011G116600 [Gossypium raimondii]
Length=574

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +S EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y +  L+A GW V 
Sbjct  239  ASREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISVYHRSGLEAAGWKVR  298

Query  427  EITLLANP  450
             I  + NP
Sbjct  299  TIQRIRNP  306



>dbj|BAG90458.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  246  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  305

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  306  RIRNPKAER  314



>ref|XP_001756144.1| predicted protein [Physcomitrella patens]
 gb|EDQ79010.1| predicted protein [Physcomitrella patens]
Length=552

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGD-EFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            +AYV++++ D  ++ G  VL  SIR +G+T+D+V+LV   +    ++ LQA GW V EI 
Sbjct  238  QAYVSMVHTDASYVCGAIVLAHSIRLSGSTRDLVMLVDSSILPEQRRALQAAGWQVREIE  297

Query  436  LLANP  450
             + NP
Sbjct  298  RIRNP  302



>ref|XP_008647980.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 ref|XP_008647981.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 gb|ACR35990.1| unknown [Zea mays]
 gb|AFW78066.1| secondary cell wall glycosyltransferase family 8 isoform 1 [Zea 
mays]
 gb|AFW78067.1| secondary cell wall glycosyltransferase family 8 isoform 2 [Zea 
mays]
Length=632

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  307  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQ  366

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  367  RIRNPKAER  375



>ref|NP_001152387.1| LOC100286027 [Zea mays]
 gb|ACG47359.1| secondary cell wall-related glycosyltransferase family 8 [Zea 
mays]
Length=633

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  308  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQ  367

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  368  RIRNPKAER  376



>gb|KJB71320.1| hypothetical protein B456_011G116600 [Gossypium raimondii]
Length=643

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +S EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y +  L+A GW V 
Sbjct  308  ASREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISVYHRSGLEAAGWKVR  367

Query  427  EITLLANP  450
             I  + NP
Sbjct  368  TIQRIRNP  375



>emb|CDP15517.1| unnamed protein product [Coffea canephora]
Length=544

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +1

Query  235  EPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  411
            +PR     EAYVT+L+  E ++ G   L +SI  + +TKD+V+L  D +S  + Q L+A 
Sbjct  258  QPR-----EAYVTILHSSEAYVCGAIALAQSIIQSNSTKDLVLLADDSISKKSLQGLKAA  312

Query  412  GWIVEEITLLANPNQVR  462
            GW ++ IT + +P+  +
Sbjct  313  GWKIKRITRIRSPHAAK  329



>gb|KDO58344.1| hypothetical protein CISIN_1g006648mg [Citrus sinensis]
Length=637

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S+Y +  L+A GW V  I 
Sbjct  305  EAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISAYHRSGLEAAGWKVRTIQ  364

Query  436  LLANP  450
             + NP
Sbjct  365  RIRNP  369



>gb|EAZ14371.1| hypothetical protein OsJ_04291 [Oryza sativa Japonica Group]
Length=651

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  259  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  322  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  381

Query  436  LLANPNQVR  462
             + NP   R
Sbjct  382  RIRNPKAER  390



>ref|XP_010539696.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Tarenaya hassleriana]
Length=640

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            +++  EAY T+L+   F + G     +SIR  G+T+D+V+LV + +S Y +  L+A GW 
Sbjct  302  ARAKREAYATILHSAHFYVCGAITAAQSIRMAGSTRDLVILVDESISDYHRGGLEAAGWK  361

Query  421  VEEITLLANP  450
            +  I  + NP
Sbjct  362  IHTIQRIRNP  371



>ref|XP_010539695.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Tarenaya hassleriana]
Length=644

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query  244  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  420
            +++  EAY T+L+   F + G     +SIR  G+T+D+V+LV + +S Y +  L+A GW 
Sbjct  306  ARAKREAYATILHSAHFYVCGAITAAQSIRMAGSTRDLVILVDESISDYHRGGLEAAGWK  365

Query  421  VEEITLLANP  450
            +  I  + NP
Sbjct  366  IHTIQRIRNP  375



>ref|XP_011078977.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
5 [Sesamum indicum]
Length=543

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +1

Query  253  SEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEE  429
            ++EAYV++L+  E ++ G   L +SI  + +TKD+++LV D +S+ + Q L+A GW ++ 
Sbjct  262  AKEAYVSVLHSSEDYVCGAIALAQSIIRSNSTKDLILLVDDSISTKSLQGLKAAGWKIKH  321

Query  430  ITLLANPN  453
            IT + +P+
Sbjct  322  ITRIRSPH  329



>ref|XP_004499062.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X2 [Cicer arietinum]
Length=544

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            ++  EAY T+L+  E ++ G  +L +S++ TGT +D+++L+   +S   +  L A GW +
Sbjct  245  RAKREAYATVLHSSESYVCGAIMLAQSLQKTGTKRDLIILIDKSISVRKRHALSAAGWKI  304

Query  424  EEITLLANP  450
              IT + NP
Sbjct  305  RTITRIRNP  313



>ref|XP_008441030.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Cucumis melo]
 ref|XP_008441032.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Cucumis melo]
Length=628

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY K  L+A GW +  I 
Sbjct  297  EAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQ  356

Query  436  LLANP  450
             + NP
Sbjct  357  RIRNP  361



>gb|KGN48367.1| hypothetical protein Csa_6G483470 [Cucumis sativus]
Length=630

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY K  L+A GW +  I 
Sbjct  297  EAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQ  356

Query  436  LLANP  450
             + NP
Sbjct  357  RIRNP  361



>ref|XP_004148647.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cucumis sativus]
Length=630

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY K  L+A GW +  I 
Sbjct  297  EAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQ  356

Query  436  LLANP  450
             + NP
Sbjct  357  RIRNP  361



>ref|XP_004499061.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X1 [Cicer arietinum]
Length=597

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            ++  EAY T+L+  E ++ G  +L +S++ TGT +D+++L+   +S   +  L A GW +
Sbjct  298  RAKREAYATVLHSSESYVCGAIMLAQSLQKTGTKRDLIILIDKSISVRKRHALSAAGWKI  357

Query  424  EEITLLANP  450
              IT + NP
Sbjct  358  RTITRIRNP  366



>ref|XP_004163053.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cucumis sativus]
Length=681

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  259  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  435
            EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY K  L+A GW +  I 
Sbjct  303  EAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQ  362

Query  436  LLANP  450
             + NP
Sbjct  363  RIRNP  367



>ref|XP_010550282.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Tarenaya hassleriana]
Length=653

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 5/78 (6%)
 Frame = +1

Query  232  GEPRSQSSE----EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQ  396
            G    +SSE    EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y + 
Sbjct  306  GVTERRSSENPRREAYATILHSAHVYVCGAIAAAESIRQSGSTRDLVILVDENISPYHRS  365

Query  397  LLQADGWIVEEITLLANP  450
             L+A GW +  I  + NP
Sbjct  366  GLEAAGWKIRTIQRIRNP  383



>ref|XP_010550280.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Tarenaya hassleriana]
Length=654

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 45/78 (58%), Gaps = 5/78 (6%)
 Frame = +1

Query  232  GEPRSQSSE----EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQ  396
            G    +SSE    EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y + 
Sbjct  307  GVTERRSSENPRREAYATILHSAHVYVCGAIAAAESIRQSGSTRDLVILVDENISPYHRS  366

Query  397  LLQADGWIVEEITLLANP  450
             L+A GW +  I  + NP
Sbjct  367  GLEAAGWKIRTIQRIRNP  384



>ref|XP_002453984.1| hypothetical protein SORBIDRAFT_04g022700 [Sorghum bicolor]
 gb|EES06960.1| hypothetical protein SORBIDRAFT_04g022700 [Sorghum bicolor]
Length=644

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 3/80 (4%)
 Frame = +1

Query  232  GEPRSQSS--EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLL  402
            GEP   ++   EAY T+L+ ++ +  G     +SIR  G+ +DMV LV + +S+  +  L
Sbjct  306  GEPYVSAAPQREAYATILHSEQLYACGAITAARSIRMAGSGRDMVALVDETISARHRGAL  365

Query  403  QADGWIVEEITLLANPNQVR  462
            +A GW+V  I  + NP   R
Sbjct  366  EAAGWVVRTIRRIRNPRASR  385



>ref|XP_004166220.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3-like [Cucumis sativus]
Length=634

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +++ EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +S Y +  L+A GW +
Sbjct  297  RANREAYATILHSAHMYVCGAIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWKI  356

Query  424  EEITLLANPNQVR  462
              I  + NP   R
Sbjct  357  LTIQRIRNPKAER  369



>ref|XP_004148815.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Cucumis sativus]
 gb|KGN47482.1| hypothetical protein Csa_6G338140 [Cucumis sativus]
Length=634

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +++ EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +S Y +  L+A GW +
Sbjct  297  RANREAYATILHSAHMYVCGAIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWKI  356

Query  424  EEITLLANPNQVR  462
              I  + NP   R
Sbjct  357  LTIQRIRNPKAER  369



>gb|KJB40458.1| hypothetical protein B456_007G064800 [Gossypium raimondii]
Length=640

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  426
            +S +AY T+L+    ++ G   + +SIR +G+T+D+V+LV + +++Y +  L+A GW V 
Sbjct  305  ASRQAYATILHSAHVYVCGAIAVARSIRLSGSTRDLVILVDEMITAYHRSGLEAAGWKVR  364

Query  427  EITLLANP  450
             I  + NP
Sbjct  365  TIQRIRNP  372



>ref|XP_010244025.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
 ref|XP_010244026.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
Length=589

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +S  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + +S Y +  L+A GW +
Sbjct  253  KSHREAYATILHSAHVYVCGAIAAAQSIRMVGSTRDLVILVDETISEYHRGGLEAAGWKI  312

Query  424  EEITLLANPNQVR  462
              I  + NP   R
Sbjct  313  RTIQRIRNPKAER  325



>ref|XP_004972256.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Setaria italica]
Length=620

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +1

Query  229  AGEPRSQSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLV-SDGVSSYAKQLL  402
            A  PRS    +AYVT+L+  D ++ G   L +SIR +G+T+D+V LV ++ V +  +  L
Sbjct  315  ATPPRSSIGRQAYVTVLHSADAYVCGAIALAQSIRQSGSTRDLVALVDAENVGAEHRAAL  374

Query  403  QADGWIVEEITLLANPNQVR  462
               GW V     + NP   R
Sbjct  375  ATAGWQVRPAPRIRNPRAAR  394



>ref|XP_011007558.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=631

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  241  RSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGW  417
            +     EAYVT+L+    ++ G     +SIR +G+T+D+V+LV + +S Y +  L+A GW
Sbjct  293  KGNPHREAYVTILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGW  352

Query  418  IVEEITLLANP  450
             +  I  + NP
Sbjct  353  KIRTIQRIRNP  363



>ref|XP_010244020.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244021.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244022.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244023.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244024.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
Length=648

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +S  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + +S Y +  L+A GW +
Sbjct  312  KSHREAYATILHSAHVYVCGAIAAAQSIRMVGSTRDLVILVDETISEYHRGGLEAAGWKI  371

Query  424  EEITLLANPNQVR  462
              I  + NP   R
Sbjct  372  RTIQRIRNPKAER  384



>ref|XP_008441557.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Cucumis melo]
Length=634

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            +++ EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +S Y +  L+A GW +
Sbjct  297  RANREAYATILHSAHIYVCGAIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWKI  356

Query  424  EEITLLANPNQVR  462
              I  + NP   R
Sbjct  357  FTIQRIRNPKAER  369



>ref|XP_007019401.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
 gb|EOY16626.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
Length=644

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW +
Sbjct  308  RAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKI  367

Query  424  EEITLLANP  450
              I  + NP
Sbjct  368  YTIQRIRNP  376



>gb|KJB60000.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=645

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW +
Sbjct  309  RAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKI  368

Query  424  EEITLLANP  450
              I  + NP
Sbjct  369  YTIQRIRNP  377



>gb|KJB59999.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=646

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  423
            ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW +
Sbjct  310  RAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKI  369

Query  424  EEITLLANP  450
              I  + NP
Sbjct  370  YTIQRIRNP  378



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750