BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013L04

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338584.1|  PREDICTED: cysteine-rich receptor-like prote...  76.3    7e-13   
ref|XP_004232315.1|  PREDICTED: cysteine-rich receptor-like prote...  73.9    4e-12   Solanum lycopersicum
ref|XP_009797283.1|  PREDICTED: cysteine-rich receptor-like prote...  73.6    6e-12   Nicotiana sylvestris
ref|XP_009761577.1|  PREDICTED: cysteine-rich receptor-like prote...  61.2    6e-08   Nicotiana sylvestris
ref|XP_009602876.1|  PREDICTED: cysteine-rich receptor-like prote...  60.8    8e-08   Nicotiana tomentosiformis
ref|XP_006338204.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    1e-07   Solanum tuberosum [potatoes]
emb|CDP02086.1|  unnamed protein product                              50.4    2e-04   Coffea canephora [robusta coffee]



>ref|XP_006338584.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=664

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = +2

Query  227  MHFLSSKFPFLKWVTTAVILLMSTASFCYAADPRIEEAAPMNCSLNRVSPTFIIPTFTRV  406
            M+   S FP L W    VILL++ A  C  ADPRI E+  + C  NR +P  IIP F ++
Sbjct  1    MNLSRSNFPLLNWT---VILLLNFALIC-EADPRISESG-LVCGTNRTTPAIIIPQFVKL  55

Query  407  MEFVSASVTDHGWGNSSTVTPNASMYAXS  493
            ME VS  VTD+ WGN    + N S+YA +
Sbjct  56   MEVVSQRVTDNNWGNHYVNSTNISIYALA  84



>ref|XP_004232315.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Solanum 
lycopersicum]
Length=668

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +2

Query  227  MHFLSSKFPFLKWVTTAVILLMSTASFCYAADPRIEEAAPMNCSLNRVSPTFIIPTFTRV  406
            M+  SS FP + W+   VILL++ A  C  ADPRI E+  + C  NR +   IIP F ++
Sbjct  5    MNISSSNFPLVNWM---VILLLNFALIC-EADPRISESG-LICGTNRTTAAIIIPQFVKL  59

Query  407  MEFVSASVTDHGWGNSSTVTPNASMYAXS  493
            ME VS  VTD+ WGN    + N S+YA +
Sbjct  60   MEVVSQRVTDNNWGNHGVNSTNISIYALA  88



>ref|XP_009797283.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
sylvestris]
Length=663

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +2

Query  227  MHFLSSKFPFLKWVTTAVILLMSTASFCYAADPRIEEAAPMNCSLNRVSPTFIIPTFTRV  406
            M+F S  F FLKW+   +I L+S    C  ADPRI EA  + C  NR SP+ IIP F ++
Sbjct  1    MNFSSLNFLFLKWI---MIFLVSFGLIC-EADPRISEAG-LVCGTNRTSPSVIIPQFVKL  55

Query  407  MEFVSASVTDHGWGNSSTVTPNASMYAXS  493
            ME VS  V + GWG+    + N S++A +
Sbjct  56   MEVVSQRVPEQGWGSHGVNSTNISIFALA  84



>ref|XP_009761577.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
sylvestris]
Length=515

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 9/92 (10%)
 Frame = +2

Query  227  MHFLSSKFPFLKWVTTAVILLMSTASFCYAADPRIEEAAPMNCSLNRVSPTFIIPTFTRV  406
            M F+   FPFLKW+   +I L++   F   ADPRI EA  +  + N  SP+ IIP +T  
Sbjct  1    MQFIGLIFPFLKWI---IIFLVNFGLFI-DADPRISEAGFVYGT-NMTSPSIIIPQYTEE  55

Query  407  MEFVSASVTDHGWGN---SSTVTPNASMYAXS  493
            M  ++  V  HGWG+   +ST+  N S+YA +
Sbjct  56   MHVITQLVKRHGWGSYAVNSTIN-NLSIYALA  86



>ref|XP_009602876.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
tomentosiformis]
Length=664

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +2

Query  290  MSTASFCYAADPRIEEAAPMNCSLNRVSPTFIIPTFTRVMEFVSASVTDHGWGNSSTVTP  469
            +S A  C  ADPRI EA  + C  NR +P  IIP F ++ME VS  V +HGWG+    + 
Sbjct  19   VSFALIC-EADPRISEAG-LVCGTNRTTPAVIIPQFVKLMEVVSQRVPEHGWGSHGVNST  76

Query  470  NASMYAXS  493
            N S++A +
Sbjct  77   NISIFALA  84



>ref|XP_006338204.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=641

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = +2

Query  239  SSKFPFLKWVTTAVILLMSTASFCYAADPRIEEAAPMNCSLNRVSPTFIIPTFTRVMEFV  418
            SS FPF  ++   ++LL    +FC  ADPRI EA  + C  N   P+ IIP +T+ M+ +
Sbjct  6    SSSFPF--YLKLIIVLL---GTFC-DADPRISEAGQV-CGTNMTLPSIIIPQYTKEMQVI  58

Query  419  SASVTDHGWGNSSTV-TPNASMYAXS  493
            +  V++HGWG+S  V + + S+YA +
Sbjct  59   TQLVSEHGWGSSYAVNSTDISIYALA  84



>emb|CDP02086.1| unnamed protein product [Coffea canephora]
Length=657

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +2

Query  227  MHFLSSKFPFLKWVTTAVILLMSTASFCYAADPRIEEAAPMNCSLNRVSP-TFIIPTFTR  403
            M F SS +P +   T  +I +++  SF ++ DPRI E+  + C LNR  P T  IP F +
Sbjct  1    MQF-SSLYP-VHLTTCLLIFILNLFSFTFS-DPRIGESG-LFCGLNRPPPNTSYIPLFVK  56

Query  404  VMEFVSASVTDHGWGNSSTVTPNASMYA  487
             ME +SA VTD+ WG+ +      S+YA
Sbjct  57   EMEKISALVTDNNWGHYAMNQTRISIYA  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510