BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013J20

Length=396
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006488759.1|  PREDICTED: methyltransferase-like protein 13...    101   4e-24   
ref|XP_008438981.1|  PREDICTED: methyltransferase-like protein 13...    103   7e-24   Cucumis melo [Oriental melon]
ref|XP_008438982.1|  PREDICTED: methyltransferase-like protein 13...    102   8e-24   
ref|XP_010235323.1|  PREDICTED: methyltransferase-like protein 13...    101   1e-23   
ref|XP_004147623.1|  PREDICTED: methyltransferase-like protein 13...    102   2e-23   Cucumis sativus [cucumbers]
ref|XP_004973949.1|  PREDICTED: methyltransferase-like protein 13...    101   2e-23   Setaria italica
ref|XP_006419270.1|  hypothetical protein CICLE_v10005764mg             100   2e-23   Citrus clementina [clementine]
ref|XP_010235322.1|  PREDICTED: methyltransferase-like protein 13...    101   3e-23   Brachypodium distachyon [annual false brome]
ref|XP_010235321.1|  PREDICTED: methyltransferase-like protein 13...    101   3e-23   Brachypodium distachyon [annual false brome]
ref|XP_006488757.1|  PREDICTED: methyltransferase-like protein 13...    101   3e-23   Citrus sinensis [apfelsine]
ref|XP_006419271.1|  hypothetical protein CICLE_v10005764mg             100   3e-23   Citrus clementina [clementine]
tpg|DAA48112.1|  TPA: hypothetical protein ZEAMMB73_561213            98.2    5e-23   
gb|EMT31220.1|  Methyltransferase-like protein 13                       100   7e-23   
ref|XP_010649676.1|  PREDICTED: methyltransferase-like protein 13...  97.8    7e-23   
gb|ACN26832.1|  unknown                                               97.1    8e-23   Zea mays [maize]
ref|XP_010505446.1|  PREDICTED: methyltransferase-like protein 13...  97.8    9e-23   
ref|XP_010489895.1|  PREDICTED: methyltransferase-like protein 13     96.3    1e-22   
ref|XP_002519302.1|  S-adenosylmethionine-dependent methyltransfe...  99.8    1e-22   Ricinus communis
ref|XP_007138845.1|  hypothetical protein PHAVU_009G242300g           99.0    2e-22   Phaseolus vulgaris [French bean]
ref|XP_007223746.1|  hypothetical protein PRUPE_ppa010512mg           99.0    2e-22   Prunus persica
emb|CDY69882.1|  BnaCnng65760D                                        98.6    3e-22   Brassica napus [oilseed rape]
ref|NP_001132547.1|  uncharacterized protein LOC100194012             98.6    3e-22   Zea mays [maize]
ref|XP_004297100.1|  PREDICTED: methyltransferase-like protein 13     98.2    4e-22   Fragaria vesca subsp. vesca
gb|EYU26202.1|  hypothetical protein MIMGU_mgv1a026709mg              97.8    4e-22   Erythranthe guttata [common monkey flower]
ref|XP_011100682.1|  PREDICTED: methyltransferase-like protein 13...  98.2    5e-22   Sesamum indicum [beniseed]
ref|XP_011100681.1|  PREDICTED: methyltransferase-like protein 13...  98.2    5e-22   
ref|XP_002265997.1|  PREDICTED: methyltransferase-like protein 13...  97.4    6e-22   Vitis vinifera
ref|XP_011011501.1|  PREDICTED: methyltransferase-like protein 13     97.8    6e-22   Populus euphratica
ref|XP_011100679.1|  PREDICTED: methyltransferase-like protein 13...  97.8    6e-22   
ref|NP_001241255.1|  uncharacterized protein LOC100788922             96.3    6e-22   Glycine max [soybeans]
ref|XP_011100684.1|  PREDICTED: methyltransferase-like protein 13...  97.8    7e-22   
ref|XP_006298441.1|  hypothetical protein CARUB_v10014513mg           97.4    8e-22   Capsella rubella
ref|XP_010505438.1|  PREDICTED: methyltransferase-like protein 13...  97.1    9e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010465786.1|  PREDICTED: methyltransferase-like protein 13...  97.1    9e-22   Camelina sativa [gold-of-pleasure]
gb|EYU33097.1|  hypothetical protein MIMGU_mgv1a012758mg              97.1    1e-21   Erythranthe guttata [common monkey flower]
ref|XP_002885207.1|  hypothetical protein ARALYDRAFT_898077           97.1    1e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_008367115.1|  PREDICTED: methyltransferase-like protein 13     94.7    1e-21   
ref|XP_009372047.1|  PREDICTED: methyltransferase-like protein 13     96.3    2e-21   
ref|XP_010672622.1|  PREDICTED: methyltransferase-like protein 13     96.7    2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007035956.1|  S-adenosyl-L-methionine-dependent methyltran...  95.5    2e-21   
emb|CDY48692.1|  BnaCnng16690D                                        96.3    2e-21   Brassica napus [oilseed rape]
ref|XP_010555152.1|  PREDICTED: methyltransferase-like protein 13...  95.9    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_010555151.1|  PREDICTED: methyltransferase-like protein 13...  95.9    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_002316072.1|  hypothetical protein POPTR_0010s16300g           95.9    3e-21   Populus trichocarpa [western balsam poplar]
dbj|BAB02741.1|  unnamed protein product                              97.1    5e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96913.1|  predicted protein                                    95.5    6e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007035955.1|  S-adenosyl-L-methionine-dependent methyltran...  95.1    8e-21   
ref|XP_007035953.1|  S-adenosyl-L-methionine-dependent methyltran...  95.1    1e-20   
ref|XP_009135524.1|  PREDICTED: methyltransferase-like protein 13     94.4    1e-20   Brassica rapa
ref|XP_007035954.1|  S-adenosyl-L-methionine-dependent methyltran...  94.7    1e-20   
gb|KFK39077.1|  hypothetical protein AALP_AA3G197500                  94.4    1e-20   Arabis alpina [alpine rockcress]
gb|AFK46134.1|  unknown                                               92.0    1e-20   Lotus japonicus
ref|XP_010270941.1|  PREDICTED: methyltransferase-like protein 13...  91.7    2e-20   
ref|XP_009114089.1|  PREDICTED: methyltransferase-like protein 13     93.6    2e-20   Brassica rapa
ref|XP_002445848.1|  hypothetical protein SORBIDRAFT_07g026860        93.6    2e-20   Sorghum bicolor [broomcorn]
ref|NP_001062244.1|  Os08g0517600                                     92.8    2e-20   
ref|XP_003546391.1|  PREDICTED: methyltransferase-like protein 13...  93.2    2e-20   Glycine max [soybeans]
ref|XP_006597757.1|  PREDICTED: methyltransferase-like protein 13...  93.2    3e-20   Glycine max [soybeans]
ref|XP_009349214.1|  PREDICTED: methyltransferase-like protein 13     93.2    3e-20   Pyrus x bretschneideri [bai li]
gb|KDP27990.1|  hypothetical protein JCGZ_19070                       93.6    3e-20   Jatropha curcas
ref|XP_006597756.1|  PREDICTED: methyltransferase-like protein 13...  93.2    3e-20   
gb|KCW61371.1|  hypothetical protein EUGRSUZ_H04109                   91.3    5e-20   Eucalyptus grandis [rose gum]
emb|CDX75912.1|  BnaC03g39950D                                        92.4    5e-20   
ref|XP_006406738.1|  hypothetical protein EUTSA_v10021424mg           92.0    6e-20   Eutrema salsugineum [saltwater cress]
dbj|BAD09975.1|  unknown protein                                      92.0    7e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83886.1|  hypothetical protein OsI_29891                        92.0    7e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_006840279.1|  hypothetical protein AMTR_s00045p00050880        92.0    8e-20   Amborella trichopoda
ref|XP_008390504.1|  PREDICTED: methyltransferase-like protein 13     92.0    8e-20   
ref|XP_010270940.1|  PREDICTED: methyltransferase-like protein 13...  90.9    9e-20   
ref|XP_009359766.1|  PREDICTED: methyltransferase-like protein 13     91.7    1e-19   Pyrus x bretschneideri [bai li]
ref|NP_566574.1|  S-adenosyl-L-methionine-dependent methyltransfe...  91.7    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45927.1|  unknown                                               91.3    1e-19   Lotus japonicus
ref|XP_010270938.1|  PREDICTED: methyltransferase-like protein 13...  90.9    2e-19   Nelumbo nucifera [Indian lotus]
ref|NP_001189917.1|  S-adenosyl-L-methionine-dependent methyltran...  91.3    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KCW61369.1|  hypothetical protein EUGRSUZ_H04109                   90.1    4e-19   Eucalyptus grandis [rose gum]
ref|XP_010024858.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  90.1    4e-19   
ref|XP_010465784.1|  PREDICTED: methyltransferase-like protein 13...  90.1    4e-19   Camelina sativa [gold-of-pleasure]
emb|CDO98708.1|  unnamed protein product                              90.1    4e-19   Coffea canephora [robusta coffee]
ref|XP_010465787.1|  PREDICTED: methyltransferase-like protein 13...  89.7    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003594886.1|  Methyltransferase-like protein                   89.7    5e-19   Medicago truncatula
gb|AFK47960.1|  unknown                                               89.7    5e-19   Medicago truncatula
ref|XP_008793315.1|  PREDICTED: methyltransferase-like protein 13     88.2    2e-18   
gb|KJB28819.1|  hypothetical protein B456_005G071000                  88.2    2e-18   Gossypium raimondii
gb|KJB28820.1|  hypothetical protein B456_005G071000                  87.8    3e-18   Gossypium raimondii
ref|XP_010938164.1|  PREDICTED: endothelin-converting enzyme 2        86.7    7e-18   Elaeis guineensis
ref|XP_009417774.1|  PREDICTED: methyltransferase-like protein 13     86.3    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84630.1|  unknown                                               85.9    1e-17   Medicago truncatula
gb|ADE77744.1|  unknown                                               85.5    2e-17   Picea sitchensis
ref|XP_011008276.1|  PREDICTED: methyltransferase-like protein 13...  80.1    6e-16   Populus euphratica
ref|XP_002876589.1|  hypothetical protein ARALYDRAFT_486567           80.1    2e-15   
ref|NP_191650.2|  S-adenosyl-L-methionine-dependent methyltransfe...  79.7    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011008275.1|  PREDICTED: methyltransferase-like protein 13...  79.3    3e-15   Populus euphratica
ref|XP_002298412.1|  hypothetical protein POPTR_0001s26830g           79.3    3e-15   
ref|XP_006369606.1|  hypothetical protein POPTR_0001s26830g           79.3    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011008274.1|  PREDICTED: methyltransferase-like protein 13...  79.3    3e-15   Populus euphratica
gb|KDP43608.1|  hypothetical protein JCGZ_16895                       77.8    4e-15   Jatropha curcas
gb|KHN26616.1|  Methyltransferase-like protein 13                     78.2    6e-15   Glycine soja [wild soybean]
ref|XP_006402529.1|  hypothetical protein EUTSA_v10006192mg           78.2    7e-15   Eutrema salsugineum [saltwater cress]
ref|XP_004516229.1|  PREDICTED: methyltransferase-like protein 13...  77.8    7e-15   
ref|XP_010523662.1|  PREDICTED: methyltransferase-like protein 13...  77.8    8e-15   Tarenaya hassleriana [spider flower]
ref|XP_010694736.1|  PREDICTED: methyltransferase-like protein 13...  77.0    1e-14   
ref|XP_010523661.1|  PREDICTED: methyltransferase-like protein 13...  77.8    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010523660.1|  PREDICTED: methyltransferase-like protein 13...  77.4    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_006291733.1|  hypothetical protein CARUB_v10017902mg           77.4    1e-14   Capsella rubella
ref|XP_004516228.1|  PREDICTED: methyltransferase-like protein 13...  77.4    1e-14   Cicer arietinum [garbanzo]
ref|XP_010694729.1|  PREDICTED: methyltransferase-like protein 13...  76.6    2e-14   
ref|XP_002527957.1|  S-adenosylmethionine-dependent methyltransfe...  76.3    2e-14   
ref|XP_002314063.1|  hypothetical protein POPTR_0009s06050g           76.6    2e-14   
ref|XP_001781361.1|  predicted protein                                76.6    2e-14   
emb|CDY45674.1|  BnaCnng13390D                                        76.6    3e-14   Brassica napus [oilseed rape]
ref|XP_009104282.1|  PREDICTED: methyltransferase-like protein 13     76.6    3e-14   Brassica rapa
ref|XP_004229675.1|  PREDICTED: methyltransferase-like protein 13     76.6    3e-14   Solanum lycopersicum
gb|EPS69326.1|  hypothetical protein M569_05441                       73.9    4e-14   Genlisea aurea
ref|XP_010512425.1|  PREDICTED: methyltransferase-like protein 13     75.9    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010413503.1|  PREDICTED: methyltransferase-like protein 13     75.9    4e-14   Camelina sativa [gold-of-pleasure]
gb|EYU42983.1|  hypothetical protein MIMGU_mgv1a012357mg              75.9    5e-14   Erythranthe guttata [common monkey flower]
gb|KFK35288.1|  hypothetical protein AALP_AA5G265300                  75.9    5e-14   Arabis alpina [alpine rockcress]
ref|XP_010694725.1|  PREDICTED: methyltransferase-like protein 13...  75.5    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010103281.1|  hypothetical protein L484_007950                 75.5    6e-14   
ref|XP_002272409.1|  PREDICTED: methyltransferase-like protein 13     75.1    8e-14   Vitis vinifera
ref|XP_001780701.1|  predicted protein                                74.3    1e-13   
ref|XP_002969554.1|  hypothetical protein SELMODRAFT_410320           74.7    1e-13   Selaginella moellendorffii
ref|XP_002970823.1|  hypothetical protein SELMODRAFT_94369            74.7    1e-13   
gb|KHN47725.1|  Methyltransferase-like protein 13                     74.7    1e-13   Glycine soja [wild soybean]
ref|XP_008231550.1|  PREDICTED: methyltransferase-like protein 13...  73.9    1e-13   
ref|XP_010269735.1|  PREDICTED: methyltransferase-like protein 13     74.3    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_006482947.1|  PREDICTED: methyltransferase-like protein 13...  74.3    1e-13   Citrus sinensis [apfelsine]
ref|XP_006482948.1|  PREDICTED: methyltransferase-like protein 13...  74.3    1e-13   
ref|XP_006438924.1|  hypothetical protein CICLE_v10032531mg           74.3    1e-13   Citrus clementina [clementine]
ref|XP_010279519.1|  PREDICTED: methyltransferase-like protein 13...  74.3    2e-13   Nelumbo nucifera [Indian lotus]
gb|KDO83291.1|  hypothetical protein CISIN_1g025475mg                 74.3    2e-13   Citrus sinensis [apfelsine]
ref|XP_007220926.1|  hypothetical protein PRUPE_ppa023083mg           73.9    2e-13   
ref|XP_010279520.1|  PREDICTED: methyltransferase-like protein 13...  73.9    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_011091775.1|  PREDICTED: methyltransferase-like protein 13...  73.9    2e-13   Sesamum indicum [beniseed]
ref|XP_008349519.1|  PREDICTED: methyltransferase-like protein 13     72.8    3e-13   
ref|XP_008231549.1|  PREDICTED: methyltransferase-like protein 13...  73.6    3e-13   Prunus mume [ume]
ref|NP_001060507.1|  Os07g0656800                                     72.8    4e-13   
ref|XP_009391525.1|  PREDICTED: methyltransferase-like protein 13     73.2    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004136132.1|  PREDICTED: methyltransferase-like protein 13...  72.8    6e-13   Cucumis sativus [cucumbers]
gb|EEE67733.1|  hypothetical protein OsJ_25422                        73.2    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010469131.1|  PREDICTED: methyltransferase-like protein 13     72.8    6e-13   Camelina sativa [gold-of-pleasure]
gb|KJB24939.1|  hypothetical protein B456_004G168900                  72.0    7e-13   Gossypium raimondii
ref|XP_006345393.1|  PREDICTED: methyltransferase-like protein 13...  72.4    7e-13   Solanum tuberosum [potatoes]
ref|XP_007131399.1|  hypothetical protein PHAVU_011G010500g           72.0    9e-13   Phaseolus vulgaris [French bean]
ref|XP_006827494.1|  hypothetical protein AMTR_s00009p00167650        72.0    1e-12   Amborella trichopoda
ref|XP_007052437.1|  S-adenosyl-L-methionine-dependent methyltran...  71.6    2e-12   Theobroma cacao [chocolate]
ref|XP_009368053.1|  PREDICTED: methyltransferase-like protein 13...  71.2    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_009368054.1|  PREDICTED: methyltransferase-like protein 13...  71.2    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_008375217.1|  PREDICTED: methyltransferase-like protein 13...  71.2    2e-12   
ref|XP_008375216.1|  PREDICTED: methyltransferase-like protein 13...  71.2    2e-12   
ref|XP_003562541.1|  PREDICTED: methyltransferase-like protein 13     71.2    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_002461145.1|  hypothetical protein SORBIDRAFT_02g041600        71.2    2e-12   Sorghum bicolor [broomcorn]
ref|XP_008651009.1|  PREDICTED: hypothetical protein isoform X2       70.9    3e-12   
ref|NP_001136982.1|  hypothetical protein                             70.5    3e-12   
ref|XP_002993618.1|  hypothetical protein SELMODRAFT_449189           73.9    3e-12   
tpg|DAA63949.1|  TPA: hypothetical protein ZEAMMB73_090428            70.1    3e-12   
gb|ACR35085.1|  unknown                                               70.9    3e-12   Zea mays [maize]
gb|KHN32397.1|  Methyltransferase-like protein 13                     70.5    3e-12   Glycine soja [wild soybean]
gb|KJB24938.1|  hypothetical protein B456_004G168900                  70.5    4e-12   Gossypium raimondii
ref|XP_010906018.1|  PREDICTED: methyltransferase-like protein 13     70.5    4e-12   
ref|XP_003539878.1|  PREDICTED: methyltransferase-like protein 13...  70.1    4e-12   Glycine max [soybeans]
ref|XP_008783272.1|  PREDICTED: methyltransferase-like protein 13...  70.1    4e-12   Phoenix dactylifera
ref|NP_001235079.1|  uncharacterized protein LOC100527880             70.1    4e-12   Glycine max [soybeans]
ref|XP_002973436.1|  hypothetical protein SELMODRAFT_442094           73.2    5e-12   
ref|XP_008461358.1|  PREDICTED: methyltransferase-like protein 13...  70.1    5e-12   Cucumis melo [Oriental melon]
ref|XP_009602387.1|  PREDICTED: methyltransferase-like protein 13     69.7    6e-12   Nicotiana tomentosiformis
emb|CDP16366.1|  unnamed protein product                              69.7    6e-12   Coffea canephora [robusta coffee]
ref|XP_009790864.1|  PREDICTED: methyltransferase-like protein 13...  68.9    7e-12   Nicotiana sylvestris
ref|XP_008651008.1|  PREDICTED: hypothetical protein isoform X1       70.1    8e-12   
gb|KEH17674.1|  S-adenosylmethionine-dependent methyltransferase,...  68.6    8e-12   Medicago truncatula
ref|XP_010942058.1|  PREDICTED: methyltransferase-like protein 13     70.9    8e-12   
emb|CDW83771.1|  methyltransferase-like protein 13-like               69.3    8e-12   Stylonychia lemnae
ref|XP_004958544.1|  PREDICTED: endothelin-converting enzyme 2-like   69.3    9e-12   Setaria italica
ref|XP_009354367.1|  PREDICTED: methyltransferase-like protein 13     68.9    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_009790863.1|  PREDICTED: methyltransferase-like protein 13...  68.6    1e-11   Nicotiana sylvestris
ref|XP_001751905.1|  predicted protein                                68.9    2e-11   
gb|EXX70602.1|  See1p                                                 68.2    2e-11   Rhizophagus irregularis DAOM 197198w
ref|XP_009393889.1|  PREDICTED: methyltransferase-like protein 13...  68.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393890.1|  PREDICTED: methyltransferase-like protein 13...  68.2    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393891.1|  PREDICTED: methyltransferase-like protein 13...  68.2    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010067789.1|  PREDICTED: methyltransferase-like protein 13     68.6    2e-11   Eucalyptus grandis [rose gum]
gb|ESA21750.1|  hypothetical protein GLOINDRAFT_118540                67.8    2e-11   
gb|KCW65991.1|  hypothetical protein EUGRSUZ_G03283                   68.6    2e-11   Eucalyptus grandis [rose gum]
gb|KIY68899.1|  S-adenosyl-L-methionine-dependent methyltransferase   67.8    3e-11   Cylindrobasidium torrendii FP15055 ss-10
gb|KEH17673.1|  S-adenosylmethionine-dependent methyltransferase,...  67.4    3e-11   Medicago truncatula
emb|CDW78977.1|  protein kinase domain protein                        67.4    3e-11   Stylonychia lemnae
gb|EWM24648.1|  protein kinase domain protein                         68.2    4e-11   Nannochloropsis gaditana
ref|XP_007304464.1|  S-adenosyl-L-methionine-dependent methyltran...  67.0    5e-11   Stereum hirsutum FP-91666 SS1
gb|KFH67412.1|  hypothetical protein MVEG_06145                       66.6    6e-11   Mortierella verticillata NRRL 6337
emb|CBJ25742.1|  conserved unknown protein                            66.6    7e-11   Ectocarpus siliculosus
ref|XP_002946829.1|  hypothetical protein VOLCADRAFT_56160            66.6    7e-11   Volvox carteri f. nagariensis
ref|XP_009549301.1|  hypothetical protein HETIRDRAFT_323921           66.6    7e-11   Heterobasidion irregulare TC 32-1
ref|XP_002988875.1|  hypothetical protein SELMODRAFT_427489           66.6    1e-10   
ref|XP_003291807.1|  hypothetical protein DICPUDRAFT_10325            65.9    1e-10   Dictyostelium purpureum
emb|CCM00248.1|  predicted protein                                    65.5    1e-10   Fibroporia radiculosa
ref|XP_009405869.1|  PREDICTED: methyltransferase-like protein 13     66.2    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EJY82595.1|  hypothetical protein OXYTRI_19792                     66.2    1e-10   Oxytricha trifallax
gb|AFK36600.1|  unknown                                               66.2    1e-10   Lotus japonicus
ref|XP_001437949.1|  hypothetical protein                             65.5    2e-10   Paramecium tetraurelia strain d4-2
ref|XP_001455278.1|  hypothetical protein                             65.1    2e-10   Paramecium tetraurelia strain d4-2
ref|XP_001426247.1|  hypothetical protein                             64.7    3e-10   Paramecium tetraurelia strain d4-2
ref|XP_002781668.1|  methylase, putative                              64.7    3e-10   Perkinsus marinus ATCC 50983
ref|XP_001022399.2|  hypothetical protein TTHERM_00558360             64.7    3e-10   Tetrahymena thermophila SB210
ref|XP_002469246.1|  predicted protein                                64.7    3e-10   
ref|XP_004040127.1|  protein kinase domain protein                    64.3    5e-10   Ichthyophthirius multifiliis
ref|XP_008899110.1|  hypothetical protein PPTG_06818                  63.5    7e-10   Phytophthora parasitica INRA-310
ref|XP_002896114.1|  putative methyltransferase, putative             63.5    7e-10   Phytophthora infestans T30-4
ref|XP_001459460.1|  hypothetical protein                             63.5    7e-10   Paramecium tetraurelia strain d4-2
ref|XP_007368152.1|  S-adenosyl-L-methionine-dependent methyltran...  63.2    9e-10   Dichomitus squalens LYAD-421 SS1
gb|EFA78103.1|  hypothetical protein PPL_08751                        63.5    9e-10   Heterostelium album PN500
gb|EAR85248.3|  methyltransferase domain protein                      63.9    9e-10   Tetrahymena thermophila SB210
ref|XP_009527601.1|  hypothetical protein PHYSODRAFT_559298           63.2    1e-09   Phytophthora sojae
ref|XP_011091776.1|  PREDICTED: methyltransferase-like protein 13...  63.2    1e-09   Sesamum indicum [beniseed]
gb|EMD39276.1|  hypothetical protein CERSUDRAFT_64140                 62.8    1e-09   Gelatoporia subvermispora B
gb|KDQ61339.1|  hypothetical protein JAAARDRAFT_54716                 62.8    1e-09   Jaapia argillacea MUCL 33604
ref|XP_003885020.1|  hypothetical protein NCLIV_054190                62.8    1e-09   Neospora caninum Liverpool
gb|KIP02687.1|  hypothetical protein PHLGIDRAFT_32105                 62.4    2e-09   Phlebiopsis gigantea 11061_1 CR5-6
gb|EMT03115.1|  Methyltransferase-like protein 13                     63.9    2e-09   
ref|XP_008783273.1|  PREDICTED: methyltransferase-like protein 13...  62.8    2e-09   Phoenix dactylifera
ref|XP_007327517.1|  hypothetical protein AGABI1DRAFT_126009          62.0    2e-09   Agaricus bisporus var. burnettii JB137-S8
ref|XP_004962183.1|  PREDICTED: methyltransferase-like protein 13...  62.8    2e-09   Setaria italica
ref|XP_001032911.2|  Protein kinase domain containing protein         62.8    2e-09   
ref|XP_006461775.1|  hypothetical protein AGABI2DRAFT_118628          62.0    2e-09   Agaricus bisporus var. bisporus H97
ref|XP_001022873.1|  hypothetical protein TTHERM_00578720             62.4    2e-09   Tetrahymena thermophila SB210
ref|XP_003390871.1|  PREDICTED: methyltransferase-like protein 13     64.7    3e-09   Amphimedon queenslandica
gb|EPT02985.1|  hypothetical protein FOMPIDRAFT_1022607               62.0    3e-09   Fomitopsis pinicola FP-58527 SS1
emb|CCI45672.1|  unnamed protein product                              62.0    3e-09   Albugo candida
dbj|GAM24960.1|  hypothetical protein SAMD00019534_081350             61.6    3e-09   Acytostelium subglobosum LB1
ref|XP_005241283.1|  PREDICTED: methyltransferase-like protein 13...  64.3    3e-09   
ref|XP_004337328.1|  catalytic, putative                              61.6    3e-09   Acanthamoeba castellanii str. Neff
ref|XP_009043014.1|  hypothetical protein AURANDRAFT_35393            61.6    4e-09   Aureococcus anophagefferens
ref|XP_006438923.1|  hypothetical protein CICLE_v10032531mg           61.6    4e-09   
ref|XP_007865319.1|  S-adenosyl-L-methionine-dependent methyltran...  61.6    4e-09   Gloeophyllum trabeum ATCC 11539
ref|XP_007320856.1|  hypothetical protein SERLADRAFT_472997           60.8    4e-09   Serpula lacrymans var. lacrymans S7.9
ref|XP_009034759.1|  hypothetical protein AURANDRAFT_5839             61.2    4e-09   Aureococcus anophagefferens
ref|XP_001874602.1|  S-adenosylmethionine-dependent methyltransfe...  60.5    4e-09   Laccaria bicolor S238N-H82
gb|KDO83292.1|  hypothetical protein CISIN_1g025475mg                 61.6    4e-09   Citrus sinensis [apfelsine]
ref|XP_005435908.1|  PREDICTED: methyltransferase-like protein 13...  63.9    4e-09   
ref|XP_011469517.1|  PREDICTED: uncharacterized protein LOC101299...  61.6    5e-09   Fragaria vesca subsp. vesca
gb|KFP01687.1|  Methyltransferase-like 13                             63.9    5e-09   Calypte anna
dbj|BAJ88363.1|  predicted protein                                    61.6    5e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004307241.1|  PREDICTED: methyltransferase-like protein 13...  61.6    5e-09   Fragaria vesca subsp. vesca
ref|XP_007415069.1|  hypothetical protein MELLADRAFT_30587            60.1    6e-09   Melampsora larici-populina 98AG31
gb|KIJ61960.1|  hypothetical protein HYDPIDRAFT_115096                60.8    7e-09   Hydnomerulius pinastri MD-312
gb|EGN96704.1|  hypothetical protein SERLA73DRAFT_75577               60.5    7e-09   Serpula lacrymans var. lacrymans S7.3
ref|XP_002972255.1|  hypothetical protein SELMODRAFT_97591            60.8    7e-09   
gb|KDQ18894.1|  hypothetical protein BOTBODRAFT_63062                 60.5    8e-09   Botryobasidium botryosum FD-172 SS1
emb|CCA16443.1|  putative methyltransferase                           60.5    8e-09   Albugo laibachii Nc14
ref|XP_005147146.1|  PREDICTED: methyltransferase-like protein 13...  63.2    8e-09   Melopsittacus undulatus
ref|NP_001151561.1|  LOC100285195                                     61.2    8e-09   Zea mays [maize]
ref|XP_002984169.1|  hypothetical protein SELMODRAFT_234474           60.8    8e-09   
gb|KIK44688.1|  hypothetical protein CY34DRAFT_802448                 60.5    9e-09   Suillus luteus UH-Slu-Lm8-n1
ref|XP_005147145.1|  PREDICTED: methyltransferase-like protein 13...  63.2    9e-09   Melopsittacus undulatus
ref|XP_008886531.1|  methyltransferase, putative                      60.5    9e-09   
gb|KII87510.1|  hypothetical protein PLICRDRAFT_112521                60.5    9e-09   Plicaturopsis crispa FD-325 SS-3
ref|XP_009514571.1|  hypothetical protein PHYSODRAFT_476587           60.5    9e-09   Phytophthora sojae
ref|XP_002364253.1|  hypothetical protein TGME49_110070               60.5    9e-09   Toxoplasma gondii ME49
ref|XP_007770844.1|  S-adenosyl-L-methionine-dependent methyltran...  60.5    1e-08   Coniophora puteana RWD-64-598 SS2
gb|KIK26724.1|  hypothetical protein PISMIDRAFT_245221                60.5    1e-08   Pisolithus microcarpus 441
emb|CDJ45301.1|  Os11g0557700 protein, related                        60.5    1e-08   Eimeria tenella
ref|XP_011469516.1|  PREDICTED: uncharacterized protein LOC101299...  61.2    1e-08   Fragaria vesca subsp. vesca
ref|XP_001456988.1|  hypothetical protein                             60.5    1e-08   Paramecium tetraurelia strain d4-2
ref|XP_008038742.1|  S-adenosyl-L-methionine-dependent methyltran...  60.1    1e-08   Trametes versicolor FP-101664 SS1
ref|XP_007842929.1|  hypothetical protein Moror_17356                 60.1    1e-08   
ref|XP_002781320.1|  methylase, putative                              60.1    1e-08   Perkinsus marinus ATCC 50983
ref|XP_008783271.1|  PREDICTED: methyltransferase-like protein 13...  60.8    1e-08   
gb|AFW77892.1|  methylase                                             62.8    1e-08   
ref|XP_001636272.1|  predicted protein                                60.1    1e-08   Nematostella vectensis
emb|CDJ69298.1|  At4g34360, related                                   60.5    2e-08   Eimeria necatrix
ref|XP_004030792.1|  protein kinase domain protein                    59.7    2e-08   Ichthyophthirius multifiliis
ref|XP_006037821.1|  PREDICTED: methyltransferase-like protein 13...  62.0    2e-08   
ref|XP_010158837.1|  PREDICTED: methyltransferase-like protein 13     62.0    2e-08   Eurypyga helias
ref|XP_002768176.1|  methylase, putative                              59.7    2e-08   Perkinsus marinus ATCC 50983
gb|ETI33453.1|  hypothetical protein F443_19862                       59.7    2e-08   Phytophthora parasitica P1569
gb|ETO62210.1|  hypothetical protein F444_19852                       59.7    2e-08   Phytophthora parasitica P1976
ref|XP_002896243.1|  conserved hypothetical protein                   59.7    2e-08   Phytophthora infestans T30-4
ref|XP_001441647.1|  hypothetical protein                             59.7    2e-08   Paramecium tetraurelia strain d4-2
gb|EPB86228.1|  hypothetical protein HMPREF1544_06956                 59.3    2e-08   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006037820.1|  PREDICTED: methyltransferase-like protein 13...  62.0    2e-08   
ref|XP_001831464.1|  hypothetical protein CC1G_08993                  59.3    2e-08   
ref|XP_006037819.1|  PREDICTED: methyltransferase-like protein 13...  62.0    2e-08   
ref|XP_005241282.1|  PREDICTED: methyltransferase-like protein 13...  62.0    2e-08   
gb|ETL80461.1|  hypothetical protein L917_19036                       59.3    3e-08   
ref|XP_008913894.1|  hypothetical protein PPTG_17694                  59.3    3e-08   
gb|KIJ55653.1|  hypothetical protein M422DRAFT_151736                 58.9    3e-08   
emb|CCF50094.1|  uncharacterized protein UHOR_07068                   59.3    3e-08   
ref|XP_006998855.1|  PREDICTED: methyltransferase-like protein 13...  57.8    3e-08   
emb|CDJ56055.1|  hypothetical protein, conserved                      58.9    3e-08   
ref|XP_005435907.1|  PREDICTED: methyltransferase-like protein 13...  61.6    3e-08   
ref|XP_004226276.1|  PREDICTED: methyltransferase-like protein 13     59.3    3e-08   
ref|XP_004688539.1|  PREDICTED: methyltransferase-like protein 13...  61.2    3e-08   
ref|XP_005319866.1|  PREDICTED: methyltransferase-like protein 13...  61.2    3e-08   
ref|XP_009558159.1|  PREDICTED: methyltransferase-like protein 13...  61.2    3e-08   
ref|XP_009558160.1|  PREDICTED: methyltransferase-like protein 13...  61.2    3e-08   
dbj|GAN03475.1|  S-adenosyl-L-methionine dependent methyltransferase  58.9    3e-08   
gb|KIN96333.1|  hypothetical protein M404DRAFT_1006838                58.9    4e-08   
ref|XP_815863.1|  hypothetical protein                                59.7    4e-08   
ref|XP_009605029.1|  PREDICTED: methyltransferase-like protein 13     59.3    4e-08   
ref|XP_666066.1|  P0700D12.13                                         59.7    4e-08   
emb|CEJ02307.1|  Putative S-adenosyl-L-methionine-dependent methy...  58.9    4e-08   
gb|KEP53130.1|  S-adenosyl-L-methionine-dependent methyltransferase   58.5    4e-08   
ref|XP_005498902.1|  PREDICTED: methyltransferase-like protein 13...  60.8    4e-08   
ref|XP_001013595.1|  hypothetical protein TTHERM_00884640             60.5    4e-08   
ref|XP_626711.1|  methylase                                           59.7    4e-08   
ref|XP_010231444.1|  PREDICTED: methyltransferase-like protein 13...  58.2    4e-08   
ref|XP_008054436.1|  PREDICTED: methyltransferase-like protein 13...  60.8    4e-08   
ref|XP_004269808.1|  PREDICTED: methyltransferase-like protein 13...  60.8    4e-08   
ref|XP_007165384.1|  PREDICTED: methyltransferase-like protein 13...  60.8    4e-08   
ref|XP_005498901.1|  PREDICTED: methyltransferase-like protein 13...  60.8    4e-08   
gb|EMC79058.1|  Methyltransferase-like protein 13                     60.8    5e-08   
ref|XP_007446827.1|  PREDICTED: methyltransferase-like protein 13...  60.8    5e-08   
ref|XP_004312568.1|  PREDICTED: methyltransferase-like protein 13...  60.8    5e-08   
gb|KIK08922.1|  hypothetical protein K443DRAFT_671972                 57.4    5e-08   
ref|XP_008864702.1|  hypothetical protein H310_02822                  58.5    5e-08   
ref|XP_004223981.1|  methyltransferase                                58.2    5e-08   
gb|KDR80619.1|  hypothetical protein GALMADRAFT_222214                58.2    6e-08   
ref|XP_006075469.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
ref|XP_005957281.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
ref|XP_005902470.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
ref|XP_005690705.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
ref|XP_004013747.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
ref|XP_004688538.1|  PREDICTED: methyltransferase-like protein 13...  60.8    6e-08   
ref|XP_007165383.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
emb|CCA67884.1|  hypothetical protein PIIN_11839                      57.8    6e-08   
ref|XP_008607158.1|  hypothetical protein SDRG_03305                  58.2    6e-08   
ref|XP_006142418.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
ref|XP_007061258.1|  PREDICTED: methyltransferase-like protein 13...  60.5    6e-08   
gb|ESL08038.1|  hypothetical protein TRSC58_04267                     58.9    6e-08   
ref|XP_009844697.1|  hypothetical protein H257_17561                  58.2    6e-08   
ref|XP_004626862.1|  PREDICTED: methyltransferase-like protein 13...  60.5    7e-08   
gb|EKF28722.1|  hypothetical protein MOQ_007522                       58.9    7e-08   
emb|CEG74609.1|  Putative S-adenosyl-L-methionine-dependent methy...  58.2    7e-08   
ref|XP_010811520.1|  PREDICTED: methyltransferase-like protein 13...  60.5    7e-08   
ref|XP_008862996.1|  hypothetical protein H310_01617                  57.8    7e-08   
ref|XP_005071407.1|  PREDICTED: methyltransferase-like protein 13...  60.1    7e-08   
ref|XP_004269807.1|  PREDICTED: methyltransferase-like protein 13...  60.5    7e-08   
ref|XP_007400903.1|  hypothetical protein PHACADRAFT_200577           58.2    7e-08   
ref|XP_007122006.1|  PREDICTED: methyltransferase-like protein 13     60.5    7e-08   
ref|XP_005690703.1|  PREDICTED: methyltransferase-like protein 13...  60.5    7e-08   
gb|ELR51578.1|  Methyltransferase-like protein 13                     60.5    7e-08   
ref|XP_007446826.1|  PREDICTED: methyltransferase-like protein 13...  60.5    7e-08   
ref|XP_005957279.1|  PREDICTED: methyltransferase-like protein 13...  60.5    7e-08   
ref|XP_004013745.1|  PREDICTED: methyltransferase-like protein 13...  60.5    7e-08   
ref|XP_005690704.1|  PREDICTED: methyltransferase-like protein 13...  60.5    8e-08   
ref|XP_010850388.1|  PREDICTED: methyltransferase-like protein 13...  60.5    8e-08   
ref|NP_001092555.1|  methyltransferase-like protein 13                60.5    8e-08   
ref|XP_006075467.1|  PREDICTED: methyltransferase-like protein 13...  60.5    8e-08   
ref|XP_005902468.1|  PREDICTED: methyltransferase-like protein 13...  60.5    8e-08   
ref|XP_005957280.1|  PREDICTED: methyltransferase-like protein 13...  60.5    8e-08   
ref|XP_004013746.1|  PREDICTED: methyltransferase-like protein 13...  60.5    8e-08   
ref|XP_005216962.1|  PREDICTED: methyltransferase-like protein 13...  60.5    8e-08   
gb|KDO33364.1|  hypothetical protein SPRG_02171                       57.8    8e-08   
ref|XP_008615166.1|  hypothetical protein SDRG_10927                  57.8    8e-08   
ref|XP_009037188.1|  hypothetical protein AURANDRAFT_5924             57.4    8e-08   
ref|XP_005005910.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_004425098.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_007987689.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|NP_001007240.1|  methyltransferase-like protein 13 isoform 3      60.1    8e-08   
ref|XP_005540053.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_004596347.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_004027951.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_003925419.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_003893613.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_003258926.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_001146773.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
ref|XP_010369593.1|  PREDICTED: methyltransferase-like protein 13...  60.1    8e-08   
emb|CEF64898.1|  Methyltransferase-like protein 13                    60.1    8e-08   
ref|XP_006075468.1|  PREDICTED: methyltransferase-like protein 13...  60.1    9e-08   
dbj|GAM16938.1|  hypothetical protein SAMD00019534_001130             58.2    9e-08   
ref|XP_819912.1|  hypothetical protein                                58.5    9e-08   
ref|XP_006142419.1|  PREDICTED: methyltransferase-like protein 13...  60.1    9e-08   
emb|CEP16565.1|  hypothetical protein                                 60.1    9e-08   
ref|XP_005902469.1|  PREDICTED: methyltransferase-like protein 13...  60.1    9e-08   
ref|XP_006192136.1|  PREDICTED: methyltransferase-like protein 13...  59.7    9e-08   
ref|XP_005245313.1|  PREDICTED: methyltransferase-like protein 13...  60.1    9e-08   
ref|XP_010334434.1|  PREDICTED: methyltransferase-like protein 13...  60.1    9e-08   
emb|CDO69765.1|  hypothetical protein BN946_scf184766.g10             57.0    9e-08   
gb|EEE63614.1|  hypothetical protein OsJ_18431                        58.5    1e-07   
ref|XP_005653777.1|  PREDICTED: methyltransferase like 13 isoform X1  59.7    1e-07   
ref|XP_003474780.1|  PREDICTED: methyltransferase-like protein 13...  60.1    1e-07   
emb|CEG79643.1|  Putative S-adenosyl-L-methionine-dependent methy...  57.8    1e-07   
dbj|BAD97213.1|  KIAA0859 protein (Fragment) variant                  60.1    1e-07   
ref|XP_002760412.1|  PREDICTED: methyltransferase-like protein 13...  60.1    1e-07   
ref|XP_003925418.1|  PREDICTED: methyltransferase-like protein 13...  60.1    1e-07   
ref|XP_005374909.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_004626861.1|  PREDICTED: methyltransferase-like protein 13...  60.1    1e-07   
gb|EFA76649.1|  hypothetical protein PPL_09954                        58.2    1e-07   
ref|XP_005071406.1|  PREDICTED: methyltransferase-like protein 13...  60.1    1e-07   
gb|EEC79166.1|  hypothetical protein OsI_19841                        58.2    1e-07   
ref|XP_005854921.1|  protein kinase domain containing protein         55.5    1e-07   
dbj|BAC33403.1|  unnamed protein product                              58.9    1e-07   
ref|XP_005856135.1|  protein kinase domain containing protein         55.5    1e-07   
ref|XP_009239215.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_008262290.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
gb|KIY97779.1|  hypothetical protein MNEG_10181                       57.0    1e-07   
ref|XP_006655284.1|  PREDICTED: LOW QUALITY PROTEIN: decapping nu...  60.1    1e-07   
ref|XP_008983271.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_001100091.1|  PREDICTED: methyltransferase like 13             59.7    1e-07   
dbj|BAA74882.2|  KIAA0859 protein                                     59.7    1e-07   
gb|EKG06889.1|  hypothetical protein TCSYLVIO_001989                  58.5    1e-07   
ref|XP_003208635.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  59.7    1e-07   
ref|XP_010643297.1|  PREDICTED: methyltransferase-like protein 13     59.7    1e-07   
ref|XP_003893612.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|NP_057019.3|  methyltransferase-like protein 13 isoform 1         59.7    1e-07   
ref|XP_005540051.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
gb|EUC59072.1|  S-adenosyl-L-methionine-dependent methyltransferase   57.0    1e-07   
gb|KFV97106.1|  Methyltransferase-like 13                             59.7    1e-07   
gb|KIM63345.1|  hypothetical protein SCLCIDRAFT_117553                57.4    1e-07   
ref|XP_007987687.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_004596346.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
gb|EHH15819.1|  hypothetical protein EGK_01969                        59.7    1e-07   
ref|XP_003258925.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
dbj|BAF84429.1|  unnamed protein product                              59.7    1e-07   
ref|XP_001146989.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
gb|AAD27711.1|AF132936_1  CGI-01 protein                              59.7    1e-07   
dbj|BAG65285.1|  unnamed protein product                              59.7    1e-07   
ref|XP_010369592.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_004027950.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_002809841.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_004354400.1|  hypothetical protein DFA_10500                   57.8    1e-07   
ref|XP_003497701.1|  PREDICTED: methyltransferase-like protein 13     59.7    1e-07   
gb|KDO35701.1|  hypothetical protein SPRG_18855                       57.4    1e-07   
ref|XP_001615835.1|  hypothetical protein                             57.0    1e-07   
ref|XP_001323822.1|  hypothetical protein                             57.0    1e-07   
ref|XP_002715940.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_003785752.1|  PREDICTED: methyltransferase-like protein 13     59.7    1e-07   
ref|XP_005374908.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
dbj|BAG51342.1|  unnamed protein product                              59.7    1e-07   
ref|XP_008584203.1|  PREDICTED: methyltransferase-like protein 13     59.7    1e-07   
ref|XP_003641702.1|  PREDICTED: methyltransferase like 13 isoformX1   59.7    1e-07   
ref|XP_006192135.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_003999241.1|  PREDICTED: methyltransferase-like protein 13     59.7    1e-07   
ref|XP_010955049.1|  PREDICTED: methyltransferase-like protein 13...  59.7    1e-07   
ref|XP_004943249.1|  PREDICTED: methyltransferase like 13 isoform X3  59.3    1e-07   
gb|KFO24431.1|  Methyltransferase-like protein 13                     59.7    1e-07   
ref|XP_005103862.1|  PREDICTED: methyltransferase-like protein 13...  59.3    1e-07   
ref|XP_001698288.1|  hypothetical protein CHLREDRAFT_187588           58.5    2e-07   
ref|NP_001231655.1|  methyltransferase like 13                        59.3    2e-07   
dbj|BAC34288.1|  unnamed protein product                              58.5    2e-07   
ref|XP_003566288.1|  PREDICTED: methyltransferase-like protein 13...  57.8    2e-07   
ref|XP_002139574.1|  hypothetical protein                             57.0    2e-07   
gb|ABC97346.1|  conserved hypothetical protein                        57.0    2e-07   
ref|XP_010231442.1|  PREDICTED: methyltransferase-like protein 13...  57.8    2e-07   
ref|XP_008144070.1|  PREDICTED: methyltransferase-like protein 13...  58.9    2e-07   
ref|XP_004943248.1|  PREDICTED: methyltransferase like 13 isoform X2  59.3    2e-07   
ref|XP_009771817.1|  PREDICTED: methyltransferase-like protein 13     57.4    2e-07   
emb|CBJ31863.1|  conserved unknown protein                            57.4    2e-07   
ref|XP_004706788.1|  PREDICTED: methyltransferase-like protein 13...  58.9    2e-07   
ref|XP_003325480.1|  hypothetical protein PGTG_07313                  56.6    2e-07   
ref|XP_006088965.1|  PREDICTED: methyltransferase-like protein 13...  58.9    2e-07   
ref|XP_005528720.1|  PREDICTED: methyltransferase-like protein 13...  58.9    2e-07   
ref|XP_002260322.1|  methyltransferase                                56.6    2e-07   
dbj|BAE37077.1|  unnamed protein product                              58.5    2e-07   
ref|XP_861960.1|  PREDICTED: methyltransferase like 13 isoform 3      58.5    2e-07   
ref|XP_005528719.1|  PREDICTED: methyltransferase-like protein 13...  58.9    2e-07   
ref|XP_009096698.1|  PREDICTED: methyltransferase-like protein 13...  58.5    2e-07   
ref|XP_005364023.1|  PREDICTED: methyltransferase-like protein 13...  58.5    2e-07   
ref|XP_009096697.1|  PREDICTED: methyltransferase-like protein 13...  58.9    2e-07   
ref|XP_004658847.1|  PREDICTED: methyltransferase-like protein 13...  58.5    2e-07   
ref|XP_009820979.1|  hypothetical protein H257_00137                  56.2    2e-07   
gb|KIY48139.1|  S-adenosyl-L-methionine-dependent methyltransferase   56.2    2e-07   
ref|XP_004799424.1|  PREDICTED: methyltransferase-like protein 13     58.5    2e-07   
ref|XP_006277644.1|  PREDICTED: methyltransferase-like protein 13     58.9    3e-07   
ref|XP_008783274.1|  PREDICTED: methyltransferase-like protein 13...  56.6    3e-07   
ref|XP_004706787.1|  PREDICTED: methyltransferase-like protein 13...  58.5    3e-07   
gb|KIJ20728.1|  hypothetical protein PAXINDRAFT_106435                56.2    3e-07   
ref|XP_007348115.1|  S-adenosyl-L-methionine-dependent methyltran...  56.2    3e-07   
ref|XP_002194430.1|  PREDICTED: methyltransferase like 13 isoform 1   58.5    3e-07   
ref|XP_008144069.1|  PREDICTED: methyltransferase-like protein 13...  58.5    3e-07   
ref|XP_010579639.1|  PREDICTED: methyltransferase-like protein 13...  58.5    3e-07   
ref|XP_010185092.1|  PREDICTED: methyltransferase-like protein 13     58.5    3e-07   
emb|CDS50264.1|  methyltransferase, putative                          56.2    3e-07   
emb|CDH51270.1|  s-adenosyl-l-methionine-dependentmethyltransferase   56.2    3e-07   
gb|ETB56128.1|  hypothetical protein YYC_05611                        56.2    3e-07   
emb|CDU19847.1|  methyltransferase, putative                          56.2    3e-07   
ref|XP_004658846.1|  PREDICTED: methyltransferase-like protein 13...  58.5    3e-07   
ref|XP_003385256.1|  PREDICTED: methyltransferase-like protein 13     58.5    3e-07   
ref|XP_850646.1|  PREDICTED: methyltransferase like 13 isoform 2      58.5    3e-07   
emb|CDS13917.1|  hypothetical protein LRAMOSA06090                    56.2    3e-07   
ref|XP_727415.1|  hypothetical protein                                56.2    3e-07   
ref|XP_008622101.1|  hypothetical protein YYE_00191                   56.2    3e-07   
emb|CDR15458.1|  methyltransferase, putative                          56.2    3e-07   
emb|CCC49346.1|  conserved hypothetical protein                       57.0    3e-07   
ref|XP_008814070.1|  hypothetical protein C922_00231                  57.0    3e-07   
gb|KHN82179.1|  Methyltransferase-like protein 13                     58.2    4e-07   
dbj|BAD32322.1|  mKIAA0859 protein                                    58.2    4e-07   
gb|EUD71423.1|  hypothetical protein YYG_03480                        56.2    4e-07   
dbj|BAE41074.1|  unnamed protein product                              58.2    4e-07   
ref|NP_659126.1|  methyltransferase-like protein 13                   58.2    4e-07   
gb|EDL39301.1|  RIKEN cDNA 5630401D24, isoform CRA_b                  58.2    4e-07   
ref|XP_010593250.1|  PREDICTED: methyltransferase-like protein 13...  57.8    4e-07   
gb|KJA28183.1|  hypothetical protein HYPSUDRAFT_156631                55.8    5e-07   
ref|XP_005319865.1|  PREDICTED: methyltransferase-like protein 13...  57.8    5e-07   
gb|ELU43454.1|  methyltransferase domain-containing protein           55.5    5e-07   
emb|CBH12948.1|  hypothetical protein, conserved                      56.2    5e-07   
ref|XP_008846725.1|  PREDICTED: methyltransferase-like protein 13     57.8    5e-07   
ref|XP_006211185.1|  PREDICTED: methyltransferase-like protein 13...  57.8    5e-07   
ref|XP_008054435.1|  PREDICTED: methyltransferase-like protein 13...  57.8    5e-07   
gb|EGT53491.1|  hypothetical protein CAEBREN_08006                    57.4    5e-07   
ref|XP_003415277.1|  PREDICTED: methyltransferase-like protein 13...  57.8    6e-07   



>ref|XP_006488759.1| PREDICTED: methyltransferase-like protein 13-like isoform X3 
[Citrus sinensis]
Length=145

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHH-RVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y SLAPL++LYV  HH R+L+VGCGNSAFSEGM+DD
Sbjct  9    AYGEPWYWDNRYAHESGPFDWYQKYPSLAPLIKLYVPSHHQRILIVGCGNSAFSEGMVDD  68

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  69   GYEDVVNVDISSVVIEA  85



>ref|XP_008438981.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Cucumis 
melo]
Length=250

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW+ RY+ E  P+DWYQ YHSLAPL+ LYV  HHR+L VGCGNSAFSEGM+DDG
Sbjct  9    AYGEPSYWDNRYSNESGPFDWYQKYHSLAPLINLYVSRHHRILAVGCGNSAFSEGMVDDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y DV NVD SSVVIEA
Sbjct  69   YEDVVNVDISSVVIEA  84



>ref|XP_008438982.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Cucumis 
melo]
Length=241

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW+ RY+ E  P+DWYQ YHSLAPL+ LYV  HHR+L VGCGNSAFSEGM+DDG
Sbjct  9    AYGEPSYWDNRYSNESGPFDWYQKYHSLAPLINLYVSRHHRILAVGCGNSAFSEGMVDDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y DV NVD SSVVIEA
Sbjct  69   YEDVVNVDISSVVIEA  84



>ref|XP_010235323.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Brachypodium 
distachyon]
Length=197

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLYV PHHR+L+VGCGNS F E M+DDG
Sbjct  8    AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLRLYVRPHHRLLLVGCGNSVFGENMVDDG  67

Query  347  Y  349
            Y
Sbjct  68   Y  68



>ref|XP_004147623.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus]
 ref|XP_004164476.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus]
 gb|KGN57199.1| hypothetical protein Csa_3G171070 [Cucumis sativus]
Length=241

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW+ RY+ E  P+DWYQ YHSLAPL+ LYV  HHR L VGCGNSAFSEGM+DDG
Sbjct  9    AYGEPSYWDNRYSNESGPFDWYQKYHSLAPLVNLYVSRHHRTLAVGCGNSAFSEGMVDDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y DV NVD SSVVIEA
Sbjct  69   YEDVVNVDISSVVIEA  84



>ref|XP_004973949.1| PREDICTED: methyltransferase-like protein 13-like [Setaria italica]
Length=242

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLYV PHHR+L+VGCGNS F E M+DDG
Sbjct  10   AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLRLYVQPHHRLLLVGCGNSVFGENMVDDG  69

Query  347  Y  349
            Y
Sbjct  70   Y  70



>ref|XP_006419270.1| hypothetical protein CICLE_v10005764mg [Citrus clementina]
 ref|XP_006488758.1| PREDICTED: methyltransferase-like protein 13-like isoform X2 
[Citrus sinensis]
 gb|ESR32510.1| hypothetical protein CICLE_v10005764mg [Citrus clementina]
 gb|KDO72135.1| hypothetical protein CISIN_1g026558mg [Citrus sinensis]
Length=207

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHH-RVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y SLAPL++LYV  HH R+L+VGCGNSAFSEGM+DD
Sbjct  9    AYGEPWYWDNRYAHESGPFDWYQKYPSLAPLIKLYVPSHHQRILIVGCGNSAFSEGMVDD  68

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  69   GYEDVVNVDISSVVIEA  85



>ref|XP_010235322.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Brachypodium 
distachyon]
Length=241

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLYV PHHR+L+VGCGNS F E M+DDG
Sbjct  8    AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLRLYVRPHHRLLLVGCGNSVFGENMVDDG  67

Query  347  Y  349
            Y
Sbjct  68   Y  68



>ref|XP_010235321.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Brachypodium 
distachyon]
Length=242

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLYV PHHR+L+VGCGNS F E M+DDG
Sbjct  8    AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLRLYVRPHHRLLLVGCGNSVFGENMVDDG  67

Query  347  Y  349
            Y
Sbjct  68   Y  68



>ref|XP_006488757.1| PREDICTED: methyltransferase-like protein 13-like isoform X1 
[Citrus sinensis]
 gb|KDO72134.1| hypothetical protein CISIN_1g026558mg [Citrus sinensis]
Length=237

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHH-RVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y SLAPL++LYV  HH R+L+VGCGNSAFSEGM+DD
Sbjct  9    AYGEPWYWDNRYAHESGPFDWYQKYPSLAPLIKLYVPSHHQRILIVGCGNSAFSEGMVDD  68

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  69   GYEDVVNVDISSVVIEA  85



>ref|XP_006419271.1| hypothetical protein CICLE_v10005764mg [Citrus clementina]
 gb|ESR32511.1| hypothetical protein CICLE_v10005764mg [Citrus clementina]
Length=237

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHH-RVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y SLAPL++LYV  HH R+L+VGCGNSAFSEGM+DD
Sbjct  9    AYGEPWYWDNRYAHESGPFDWYQKYPSLAPLIKLYVPSHHQRILIVGCGNSAFSEGMVDD  68

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  69   GYEDVVNVDISSVVIEA  85



>tpg|DAA48112.1| TPA: hypothetical protein ZEAMMB73_561213 [Zea mays]
Length=143

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLY+ PH R+L+VGCGNS F E MIDDG
Sbjct  12   AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLRLYLAPHQRLLLVGCGNSVFGENMIDDG  71

Query  347  Y  349
            Y
Sbjct  72   Y  72



>gb|EMT31220.1| Methyltransferase-like protein 13 [Aegilops tauschii]
Length=237

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +EP P+DWYQ Y +LAPLLRLYV PH R+L+VGCGNS F E M+ DG
Sbjct  8    AYGEAWYWDERYRKEPGPFDWYQKYPALAPLLRLYVRPHQRLLLVGCGNSVFGENMVQDG  67

Query  347  Y  349
            Y
Sbjct  68   Y  68



>ref|XP_010649676.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Vitis 
vinifera]
Length=144

 Score = 97.8 bits (242),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW++RY+ E  P+DWYQ Y++LAPLL LY+  HHRVLVVGCGNSAFSEGM++DG
Sbjct  9    AYGEPSYWDERYSHESGPFDWYQKYNALAPLLHLYIPLHHRVLVVGCGNSAFSEGMVNDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y +V N+D SSVVI+A
Sbjct  69   YKEVVNIDISSVVIQA  84



>gb|ACN26832.1| unknown [Zea mays]
 tpg|DAA48113.1| TPA: hypothetical protein ZEAMMB73_561213 [Zea mays]
 tpg|DAA48114.1| TPA: hypothetical protein ZEAMMB73_561213 [Zea mays]
Length=115

 Score = 97.1 bits (240),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLY+ PH R+L+VGCGNS F E MIDDG
Sbjct  12   AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLRLYLAPHQRLLLVGCGNSVFGENMIDDG  71

Query  347  Y  349
            Y
Sbjct  72   Y  72



>ref|XP_010505446.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Camelina 
sativa]
Length=146

 Score = 97.8 bits (242),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SLAPL+ LYV H + RVLVVGCGNSAFSEGM+DD
Sbjct  10   SYSEKWYWDDRYTNESEPFDWYQKYPSLAPLINLYVPHRNQRVLVVGCGNSAFSEGMVDD  69

Query  344  GY  349
            GY
Sbjct  70   GY  71



>ref|XP_010489895.1| PREDICTED: methyltransferase-like protein 13 [Camelina sativa]
Length=100

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SLAPL+ LYV H + RVLVVGCGNSAFSEGM+DD
Sbjct  10   SYSEKWYWDDRYTNESEPFDWYQKYPSLAPLINLYVPHRNQRVLVVGCGNSAFSEGMVDD  69

Query  344  GY  349
            GY
Sbjct  70   GY  71



>ref|XP_002519302.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF43166.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=243

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHH--RVLVVGCGNSAFSEGMID  340
            AYG+ WYW+ RYA E  P+DWYQ Y SLAPL+ LY+  HH  R+LVVGCGNSAFS+GM+D
Sbjct  9    AYGESWYWDNRYANESGPFDWYQKYSSLAPLINLYIPRHHHPRILVVGCGNSAFSDGMVD  68

Query  341  DGYAdvxnvdsssvvIEA  394
            DGY DV N+D SSVVIEA
Sbjct  69   DGYDDVVNIDISSVVIEA  86



>ref|XP_007138845.1| hypothetical protein PHAVU_009G242300g [Phaseolus vulgaris]
 gb|ESW10839.1| hypothetical protein PHAVU_009G242300g [Phaseolus vulgaris]
Length=236

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  EP P+DWYQ Y +LAP++ LYV P HR+LVVGCGNSAFSEGM+ DG
Sbjct  7    AYGEPWYWDNRYTNEPGPFDWYQKYLTLAPIINLYVPPTHRILVVGCGNSAFSEGMVVDG  66



>ref|XP_007223746.1| hypothetical protein PRUPE_ppa010512mg [Prunus persica]
 ref|XP_008223460.1| PREDICTED: methyltransferase-like protein 13 [Prunus mume]
 gb|EMJ24945.1| hypothetical protein PRUPE_ppa010512mg [Prunus persica]
Length=247

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV----HPHHRVLVVGCGNSAFSEGM  334
            AYG+ WYW+ RYA E  P+DWYQ Y SLAPL+ LYV    + HHR+LVVGCGNSAFSEGM
Sbjct  10   AYGEPWYWDNRYANESGPFDWYQKYQSLAPLINLYVPRHSNQHHRILVVGCGNSAFSEGM  69

Query  335  IDDGYAdvxnvdsssvvIEA  394
             DDGY DV ++D SSVVI+A
Sbjct  70   ADDGYDDVVSIDISSVVIQA  89



>emb|CDY69882.1| BnaCnng65760D [Brassica napus]
Length=240

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SL+PL+ LY+ HP HR LV+GCGNSAFSEGM+DD
Sbjct  9    SYSEKWYWDDRYTNESDPFDWYQNYPSLSPLINLYLPHPTHRALVIGCGNSAFSEGMVDD  68

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV N+D SSVVI+A
Sbjct  69   GYGDVVNIDISSVVIDA  85



>ref|NP_001132547.1| uncharacterized protein LOC100194012 [Zea mays]
 gb|ACF81433.1| unknown [Zea mays]
 gb|ACG27198.1| methylase [Zea mays]
 gb|ACG34978.1| methylase [Zea mays]
 tpg|DAA48111.1| TPA: methylase [Zea mays]
Length=244

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLY+ PH R+L+VGCGNS F E MIDDG
Sbjct  12   AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLRLYLAPHQRLLLVGCGNSVFGENMIDDG  71

Query  347  Y  349
            Y
Sbjct  72   Y  72



>ref|XP_004297100.1| PREDICTED: methyltransferase-like protein 13 [Fragaria vesca 
subsp. vesca]
Length=248

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMID  340
            AYG+ WYW+ RY  E  P+DWYQ Y SLAP++ LYV  H  HRVLVVGCGNSAFSEGM D
Sbjct  13   AYGEPWYWDNRYTNESGPFDWYQKYQSLAPIINLYVPRHLRHRVLVVGCGNSAFSEGMAD  72

Query  341  DGYAdvxnvdsssvvIEA  394
            DGY DV ++D SSVVI+A
Sbjct  73   DGYEDVVSIDISSVVIQA  90



>gb|EYU26202.1| hypothetical protein MIMGU_mgv1a026709mg [Erythranthe guttata]
Length=235

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  +P  +DWYQ Y SL+PL+RLY   HH +LVVGCGNSAFSEGM++DG
Sbjct  16   AYGEAWYWDNRYTHDPSTFDWYQKYASLSPLIRLYAPRHHPILVVGCGNSAFSEGMVEDG  75

Query  347  YAdvxnvdsssvvIEA  394
            Y +V NVD SSVVIEA
Sbjct  76   YDEVVNVDISSVVIEA  91



>ref|XP_011100682.1| PREDICTED: methyltransferase-like protein 13 isoform X4 [Sesamum 
indicum]
 ref|XP_011100683.1| PREDICTED: methyltransferase-like protein 13 isoform X4 [Sesamum 
indicum]
Length=253

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMIDD  343
            YG+ WYW+ RYA +P  +DWYQ Y SLAPLLRLY    PHH +LVVGCGNSAFSEG++DD
Sbjct  17   YGESWYWDNRYAHDPSTFDWYQKYPSLAPLLRLYFPPTPHHPILVVGCGNSAFSEGLVDD  76

Query  344  GYAdvxnvdsssvvIEA  394
            GY +V N+D SSVVIEA
Sbjct  77   GYDEVVNIDISSVVIEA  93



>ref|XP_011100681.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Sesamum 
indicum]
Length=258

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMIDD  343
            YG+ WYW+ RYA +P  +DWYQ Y SLAPLLRLY    PHH +LVVGCGNSAFSEG++DD
Sbjct  27   YGESWYWDNRYAHDPSTFDWYQKYPSLAPLLRLYFPPTPHHPILVVGCGNSAFSEGLVDD  86

Query  344  GYAdvxnvdsssvvIEA  394
            GY +V N+D SSVVIEA
Sbjct  87   GYDEVVNIDISSVVIEA  103



>ref|XP_002265997.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Vitis 
vinifera]
 emb|CBI25999.3| unnamed protein product [Vitis vinifera]
Length=230

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW++RY+ E  P+DWYQ Y++LAPLL LY+  HHRVLVVGCGNSAFSEGM++DG
Sbjct  9    AYGEPSYWDERYSHESGPFDWYQKYNALAPLLHLYIPLHHRVLVVGCGNSAFSEGMVNDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y +V N+D SSVVI+A
Sbjct  69   YKEVVNIDISSVVIQA  84



>ref|XP_011011501.1| PREDICTED: methyltransferase-like protein 13 [Populus euphratica]
Length=241

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMID  340
            AYG+ WYW+KRY+ E  P+DWYQ Y SLAPL+ LY+  H H R+LVVGCGNSAFSEGM+ 
Sbjct  7    AYGEPWYWDKRYSSESGPFDWYQKYPSLAPLINLYIPRHVHPRILVVGCGNSAFSEGMVS  66

Query  341  DGYAdvxnvdsssvvIEA  394
            DGY DV N+D SSVVIEA
Sbjct  67   DGYEDVVNIDISSVVIEA  84



>ref|XP_011100679.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Sesamum 
indicum]
 ref|XP_011100680.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Sesamum 
indicum]
Length=263

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMIDD  343
            YG+ WYW+ RYA +P  +DWYQ Y SLAPLLRLY    PHH +LVVGCGNSAFSEG++DD
Sbjct  27   YGESWYWDNRYAHDPSTFDWYQKYPSLAPLLRLYFPPTPHHPILVVGCGNSAFSEGLVDD  86

Query  344  GYAdvxnvdsssvvIEA  394
            GY +V N+D SSVVIEA
Sbjct  87   GYDEVVNIDISSVVIEA  103



>ref|NP_001241255.1| uncharacterized protein LOC100788922 [Glycine max]
 gb|ACU17279.1| unknown [Glycine max]
Length=183

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGM-IDD  343
            AYG+ WYW+ RY+ EP P+DWYQ Y +LAP++ LYV P H VLVVGCGNSAFSEGM +D 
Sbjct  7    AYGEPWYWDNRYSNEPGPFDWYQKYLTLAPIINLYVPPSHPVLVVGCGNSAFSEGMVVDG  66

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV N+D SSVVIEA
Sbjct  67   GYTDVVNIDISSVVIEA  83



>ref|XP_011100684.1| PREDICTED: methyltransferase-like protein 13 isoform X5 [Sesamum 
indicum]
Length=248

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMIDD  343
            YG+ WYW+ RYA +P  +DWYQ Y SLAPLLRLY    PHH +LVVGCGNSAFSEG++DD
Sbjct  27   YGESWYWDNRYAHDPSTFDWYQKYPSLAPLLRLYFPPTPHHPILVVGCGNSAFSEGLVDD  86

Query  344  GYAdvxnvdsssvvIEA  394
            GY +V N+D SSVVIEA
Sbjct  87   GYDEVVNIDISSVVIEA  103



>ref|XP_006298441.1| hypothetical protein CARUB_v10014513mg [Capsella rubella]
 gb|EOA31339.1| hypothetical protein CARUB_v10014513mg [Capsella rubella]
Length=239

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SLAPL+ LYV H   RVLVVGCGNSAFSEGM+DD
Sbjct  9    SYSEKWYWDDRYTNESEPFDWYQKYSSLAPLINLYVPHRDQRVLVVGCGNSAFSEGMVDD  68

Query  344  GY  349
            GY
Sbjct  69   GY  70



>ref|XP_010505438.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Camelina 
sativa]
Length=240

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SLAPL+ LYV H + RVLVVGCGNSAFSEGM+DD
Sbjct  10   SYSEKWYWDDRYTNESEPFDWYQKYPSLAPLINLYVPHRNQRVLVVGCGNSAFSEGMVDD  69

Query  344  GY  349
            GY
Sbjct  70   GY  71



>ref|XP_010465786.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Camelina 
sativa]
Length=240

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SLAPL+ LYV H + RVLVVGCGNSAFSEGM+DD
Sbjct  10   SYSEKWYWDDRYTNESEPFDWYQKYPSLAPLINLYVPHRNQRVLVVGCGNSAFSEGMVDD  69

Query  344  GY  349
            GY
Sbjct  70   GY  71



>gb|EYU33097.1| hypothetical protein MIMGU_mgv1a012758mg [Erythranthe guttata]
Length=241

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  +P  +DWYQ Y SL+PL+RLYV   H +LVVGCGNSAFSEGM++DG
Sbjct  16   AYGEAWYWDNRYTHDPSTFDWYQKYASLSPLIRLYVPRRHPILVVGCGNSAFSEGMVEDG  75

Query  347  YAdvxnvdsssvvIEA  394
            Y +V NVD SSVVIEA
Sbjct  76   YDEVVNVDISSVVIEA  91



>ref|XP_002885207.1| hypothetical protein ARALYDRAFT_898077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61466.1| hypothetical protein ARALYDRAFT_898077 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW++RY  E  P+DWYQ Y SLAPL+ LYV H + R LV+GCGNSAFSEGM+DD
Sbjct  9    SYSEKWYWDERYTNESEPFDWYQKYSSLAPLINLYVPHRNQRALVIGCGNSAFSEGMVDD  68

Query  344  GY  349
            GY
Sbjct  69   GY  70



>ref|XP_008367115.1| PREDICTED: methyltransferase-like protein 13 [Malus domestica]
Length=150

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPH--HRVLVVGCGNSAFSEGM  334
            AYG+ WYW+ RYA E   +DWYQ Y SLAPL+ LYV  HP+  +R+LVVGCGNSAFSEGM
Sbjct  11   AYGEPWYWDNRYANESGSFDWYQKYQSLAPLINLYVPRHPNQRNRILVVGCGNSAFSEGM  70

Query  335  IDDGYAdvxnvdsssvvIEA  394
             DDGY +V ++D SSVVI+A
Sbjct  71   ADDGYEEVVSIDISSVVIQA  90



>ref|XP_009372047.1| PREDICTED: methyltransferase-like protein 13 [Pyrus x bretschneideri]
Length=237

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 4/80 (5%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPH--HRVLVVGCGNSAFSEGM  334
            AYG+ WYW+ RYA E  P+DWYQ Y SLAPL+ LYV  HP+  +R+LVVGCGNSAFSEGM
Sbjct  11   AYGEPWYWDNRYANESGPFDWYQKYQSLAPLINLYVPRHPNQRNRILVVGCGNSAFSEGM  70

Query  335  IDDGYAdvxnvdsssvvIEA  394
             DDGY +V ++D SSVVI+A
Sbjct  71   ADDGYEEVVSIDISSVVIQA  90



>ref|XP_010672622.1| PREDICTED: methyltransferase-like protein 13 [Beta vulgaris subsp. 
vulgaris]
Length=244

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            +YG+  YW+KRY QE  P+DWYQ Y +LAPLL LY+ P HR+L +GCGNS FSEGM++DG
Sbjct  10   SYGEPSYWDKRYTQEDSPFDWYQKYTALAPLLHLYLSPSHRILAIGCGNSPFSEGMVEDG  69

Query  347  Y  349
            Y
Sbjct  70   Y  70



>ref|XP_007035956.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 4 [Theobroma cacao]
 gb|EOY06882.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 4 [Theobroma cacao]
Length=202

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y +LAPL+ LYV H H R+LVVGCGNS FSE M++D
Sbjct  66   AYGEPWYWDNRYAHESAPFDWYQKYPALAPLVHLYVPHRHQRILVVGCGNSVFSEDMVND  125

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  126  GYEDVVNVDISSVVIEA  142



>emb|CDY48692.1| BnaCnng16690D [Brassica napus]
Length=240

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SL+PL+ LYV H  HR LV+GCGNSAFSEGM+DD
Sbjct  9    SYSEKWYWDDRYTNESDPFDWYQNYPSLSPLINLYVPHRTHRALVIGCGNSAFSEGMVDD  68

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV N+D SSVVI+A
Sbjct  69   GYGDVVNIDISSVVIDA  85



>ref|XP_010555152.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Tarenaya 
hassleriana]
Length=227

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RY+ E  P+DWYQ Y SLAPL+ LYV H  H VLV+GCGNSAFSEGM+DD
Sbjct  10   AYGEAWYWDNRYSNESGPFDWYQKYPSLAPLINLYVPHRSHPVLVIGCGNSAFSEGMVDD  69

Query  344  GY  349
            GY
Sbjct  70   GY  71



>ref|XP_010555151.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Tarenaya 
hassleriana]
Length=232

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RY+ E  P+DWYQ Y SLAPL+ LYV H  H VLV+GCGNSAFSEGM+DD
Sbjct  10   AYGEAWYWDNRYSNESGPFDWYQKYPSLAPLINLYVPHRSHPVLVIGCGNSAFSEGMVDD  69

Query  344  GY  349
            GY
Sbjct  70   GY  71



>ref|XP_002316072.1| hypothetical protein POPTR_0010s16300g [Populus trichocarpa]
 gb|EEF02243.1| hypothetical protein POPTR_0010s16300g [Populus trichocarpa]
Length=241

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMID  340
            AYG+ WYW+ RY+ E  P+DWYQ Y SLAPL+ LY+  H H R+LVVGCGNSAFSEGM+ 
Sbjct  7    AYGEPWYWDNRYSSESGPFDWYQKYPSLAPLINLYIPRHVHPRILVVGCGNSAFSEGMVS  66

Query  341  DGYAdvxnvdsssvvIEA  394
            DGY DV N+D SSVVIEA
Sbjct  67   DGYEDVVNIDISSVVIEA  84



>dbj|BAB02741.1| unnamed protein product [Arabidopsis thaliana]
Length=419

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y ++WYW+ RY  E  P+DWYQ Y  LAPL+ LYV   + RVLV+GCGNSAFSEGM+DD
Sbjct  191  SYSEQWYWDDRYKNESEPFDWYQKYSPLAPLINLYVPQRNQRVLVIGCGNSAFSEGMVDD  250

Query  344  GY  349
            GY
Sbjct  251  GY  252



>dbj|BAJ96913.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLLRLYV PH R+L+VGCGNS F E M+ DG
Sbjct  54   AYGEAWYWDERYRKESGPFDWYQKYPALAPLLRLYVRPHQRLLLVGCGNSVFGENMVHDG  113

Query  347  Y  349
            Y
Sbjct  114  Y  114



>ref|XP_007035955.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 3 [Theobroma cacao]
 gb|EOY06881.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 3 [Theobroma cacao]
Length=275

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y +LAPL+ LYV H H R+LVVGCGNS FSE M++D
Sbjct  66   AYGEPWYWDNRYAHESAPFDWYQKYPALAPLVHLYVPHRHQRILVVGCGNSVFSEDMVND  125

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  126  GYEDVVNVDISSVVIEA  142



>ref|XP_007035953.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY06879.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=291

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y +LAPL+ LYV H H R+LVVGCGNS FSE M++D
Sbjct  66   AYGEPWYWDNRYAHESAPFDWYQKYPALAPLVHLYVPHRHQRILVVGCGNSVFSEDMVND  125

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  126  GYEDVVNVDISSVVIEA  142



>ref|XP_009135524.1| PREDICTED: methyltransferase-like protein 13 [Brassica rapa]
 emb|CDX82372.1| BnaA03g34490D [Brassica napus]
Length=236

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y ++WYW++RY  E  P+DWYQ Y SLAPL+ LYV H  H VLV+GCGNSAFSEGM+DD
Sbjct  10   SYSEQWYWDERYTNESDPFDWYQNYASLAPLINLYVPHRPHPVLVIGCGNSAFSEGMVDD  69

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV ++D SSVVI+A
Sbjct  70   GYEDVVSIDISSVVIDA  86



>ref|XP_007035954.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
 gb|EOY06880.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
Length=294

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y +LAPL+ LYV H H R+LVVGCGNS FSE M++D
Sbjct  66   AYGEPWYWDNRYAHESAPFDWYQKYPALAPLVHLYVPHRHQRILVVGCGNSVFSEDMVND  125

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD SSVVIEA
Sbjct  126  GYEDVVNVDISSVVIEA  142



>gb|KFK39077.1| hypothetical protein AALP_AA3G197500 [Arabis alpina]
Length=239

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y ++WYW++RY  E  P+DWYQ Y SLAPL+ LY  H +H VLV+GCGNSAFSEGM+DD
Sbjct  9    SYSEQWYWDERYTNESEPFDWYQKYSSLAPLINLYAPHRNHPVLVIGCGNSAFSEGMVDD  68

Query  344  GY  349
            GY
Sbjct  69   GY  70



>gb|AFK46134.1| unknown [Lotus japonicus]
Length=143

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  EP P+DWYQ Y +LAP++ LYV  +H +LVVG GNSAFSEG++D+G
Sbjct  7    AYGESWYWDNRYTNEPGPFDWYQKYITLAPIINLYVPQNHSILVVGSGNSAFSEGLVDEG  66



>ref|XP_010270941.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Nelumbo 
nucifera]
Length=144

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
             YG+  YW+ RY Q+  P+DWYQ Y +LAPLL  YV   HR LVVGCGNSAFSEGM++DG
Sbjct  9    GYGEPSYWDDRYTQDTGPFDWYQKYPALAPLLNFYVPRDHRTLVVGCGNSAFSEGMVNDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y DV N+D SSVVIEA
Sbjct  69   YEDVINIDISSVVIEA  84



>ref|XP_009114089.1| PREDICTED: methyltransferase-like protein 13 [Brassica rapa]
Length=240

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y +KWYW+ RY  E  P+DWYQ Y SL+PL+ LY+ H  HR LV+GCGNSAFSEGM+DD
Sbjct  9    SYSEKWYWDDRYTNESDPFDWYQNYPSLSPLINLYLPHRTHRPLVIGCGNSAFSEGMVDD  68

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV N+D SSVVI+A
Sbjct  69   GYGDVVNIDISSVVIDA  85



>ref|XP_002445848.1| hypothetical protein SORBIDRAFT_07g026860 [Sorghum bicolor]
 gb|EES15343.1| hypothetical protein SORBIDRAFT_07g026860 [Sorghum bicolor]
Length=244

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  182  WYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            WYW++RY +E  P+DWYQ Y +LAPLLRLYV PH R+L+VGCGNS F E MIDDGY
Sbjct  17   WYWDERYRKEAGPFDWYQKYPALAPLLRLYVAPHQRLLLVGCGNSVFGENMIDDGY  72



>ref|NP_001062244.1| Os08g0517600 [Oryza sativa Japonica Group]
 dbj|BAD09976.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24158.1| Os08g0517600 [Oryza sativa Japonica Group]
Length=197

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLL +YV  HHR+L+ GCGNS F E M+DDG
Sbjct  15   AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLAVYVRRHHRLLLAGCGNSVFGENMVDDG  74

Query  347  Y  349
            Y
Sbjct  75   Y  75



>ref|XP_003546391.1| PREDICTED: methyltransferase-like protein 13-like isoform X1 
[Glycine max]
Length=236

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY+ EP P+DWYQ Y +LAP+  LYV P   VLVVGCGNSAFSEGM+ DG
Sbjct  7    AYGEPWYWDNRYSNEPGPFDWYQKYLTLAPITNLYVPPAQPVLVVGCGNSAFSEGMVVDG  66



>ref|XP_006597757.1| PREDICTED: methyltransferase-like protein 13-like isoform X3 
[Glycine max]
Length=229

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY+ EP P+DWYQ Y +LAP+  LYV P   VLVVGCGNSAFSEGM+ DG
Sbjct  7    AYGEPWYWDNRYSNEPGPFDWYQKYLTLAPITNLYVPPAQPVLVVGCGNSAFSEGMVVDG  66



>ref|XP_009349214.1| PREDICTED: methyltransferase-like protein 13 [Pyrus x bretschneideri]
Length=247

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HP--HHRVLVVGCGNSAFSEGM  334
            AYG+  YW+ RYA E   +DWYQ Y SLAPL+ LYV  HP  H+R+LVVGCGNSAFSEGM
Sbjct  9    AYGESRYWDNRYANESGSFDWYQKYQSLAPLINLYVPRHPNQHNRILVVGCGNSAFSEGM  68

Query  335  IDDGY  349
            +DDGY
Sbjct  69   VDDGY  73



>gb|KDP27990.1| hypothetical protein JCGZ_19070 [Jatropha curcas]
Length=268

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HPHHRVLVVGCGNSAFSEGMID  340
            AYG+  YW+ RYA E  P+DWYQ Y SLAP++ LY+  H + RVLV+GCGNSAFSEGM+D
Sbjct  16   AYGEPSYWDNRYANESAPFDWYQKYASLAPVINLYIPRHLNPRVLVIGCGNSAFSEGMVD  75

Query  341  DGY  349
            DGY
Sbjct  76   DGY  78



>ref|XP_006597756.1| PREDICTED: methyltransferase-like protein 13-like isoform X2 
[Glycine max]
Length=249

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY+ EP P+DWYQ Y +LAP+  LYV P   VLVVGCGNSAFSEGM+ DG
Sbjct  7    AYGEPWYWDNRYSNEPGPFDWYQKYLTLAPITNLYVPPAQPVLVVGCGNSAFSEGMVVDG  66



>gb|KCW61371.1| hypothetical protein EUGRSUZ_H04109 [Eucalyptus grandis]
Length=181

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+ WYW++RY  +   +DWYQ Y +LAPL+ LYV    RVLVVGCGNS FSEGM+DDGY
Sbjct  14   YGEPWYWDRRYETDSGAFDWYQKYSALAPLVNLYVPREDRVLVVGCGNSEFSEGMVDDGY  73

Query  350  AdvxnvdsssvvIEA  394
             DV N+D SSVVIEA
Sbjct  74   EDVVNIDISSVVIEA  88



>emb|CDX75912.1| BnaC03g39950D [Brassica napus]
Length=236

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y ++WYW++RY  E  P+DWYQ Y SLAPL+ LYV    H VLV+GCGNSAFSEGM+DD
Sbjct  10   SYSEQWYWDERYTNESDPFDWYQNYTSLAPLINLYVPRRTHPVLVIGCGNSAFSEGMVDD  69

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV ++D SSVVI+A
Sbjct  70   GYEDVVSIDISSVVIDA  86



>ref|XP_006406738.1| hypothetical protein EUTSA_v10021424mg [Eutrema salsugineum]
 gb|ESQ48191.1| hypothetical protein EUTSA_v10021424mg [Eutrema salsugineum]
Length=239

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y ++WYW+ RY+ E  P+DWYQ Y +LAPL+ LYV   +H VLV+GCGNSAFSEGM+DD
Sbjct  9    SYSEQWYWDDRYSNESEPFDWYQKYSALAPLINLYVPRRNHPVLVIGCGNSAFSEGMVDD  68

Query  344  GY  349
            GY
Sbjct  69   GY  70



>dbj|BAD09975.1| unknown protein [Oryza sativa Japonica Group]
Length=241

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLL +YV  HHR+L+ GCGNS F E M+DDG
Sbjct  15   AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLAVYVRRHHRLLLAGCGNSVFGENMVDDG  74

Query  347  Y  349
            Y
Sbjct  75   Y  75



>gb|EEC83886.1| hypothetical protein OsI_29891 [Oryza sativa Indica Group]
 gb|EEE68998.1| hypothetical protein OsJ_27938 [Oryza sativa Japonica Group]
Length=249

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW++RY +E  P+DWYQ Y +LAPLL +YV  HHR+L+ GCGNS F E M+DDG
Sbjct  15   AYGEAWYWDERYRKEAGPFDWYQKYPALAPLLAVYVRRHHRLLLAGCGNSVFGENMVDDG  74

Query  347  Y  349
            Y
Sbjct  75   Y  75



>ref|XP_006840279.1| hypothetical protein AMTR_s00045p00050880 [Amborella trichopoda]
 gb|ERN01954.1| hypothetical protein AMTR_s00045p00050880 [Amborella trichopoda]
Length=240

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+KRY Q+P P+DWYQ Y +LAP+  LY+  +HR+L+ GCGN+A  E M++DG
Sbjct  9    AYGEPWYWDKRYKQDPGPFDWYQKYPALAPIFNLYLKHNHRILITGCGNAALGEDMVNDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y D+ N+D SSVVIEA
Sbjct  69   YQDIVNIDISSVVIEA  84



>ref|XP_008390504.1| PREDICTED: methyltransferase-like protein 13 [Malus domestica]
Length=246

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HP--HHRVLVVGCGNSAFSEGM  334
            AYG+  YW+ RYA E   +DWYQ Y SLAPL+ LYV  HP  H+R+LVVGCGNSAFSEGM
Sbjct  9    AYGESRYWDNRYANESESFDWYQKYQSLAPLINLYVPRHPNQHNRILVVGCGNSAFSEGM  68

Query  335  IDDGY  349
             DDGY
Sbjct  69   ADDGY  73



>ref|XP_010270940.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Nelumbo 
nucifera]
Length=186

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
             YG+  YW+ RY Q+  P+DWYQ Y +LAPLL  YV   HR LVVGCGNSAFSEGM++DG
Sbjct  9    GYGEPSYWDDRYTQDTGPFDWYQKYPALAPLLNFYVPRDHRTLVVGCGNSAFSEGMVNDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y DV N+D SSVVIEA
Sbjct  69   YEDVINIDISSVVIEA  84



>ref|XP_009359766.1| PREDICTED: methyltransferase-like protein 13 [Pyrus x bretschneideri]
Length=247

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV--HP--HHRVLVVGCGNSAFSEGM  334
            AYG+  YW+ RYA E   +DWYQ Y SLAPL+ LYV  HP  H+R+LVVGCGNSAF EGM
Sbjct  9    AYGESRYWDNRYANESGSFDWYQKYQSLAPLINLYVPRHPNQHNRILVVGCGNSAFGEGM  68

Query  335  IDDGY  349
            +DDGY
Sbjct  69   VDDGY  73



>ref|NP_566574.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAK93650.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67530.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75944.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=239

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y ++WYW+ RY  E  P+DWYQ Y  LAPL+ LYV   + RVLV+GCGNSAFSEGM+DD
Sbjct  9    SYSEQWYWDDRYKNESEPFDWYQKYSPLAPLINLYVPQRNQRVLVIGCGNSAFSEGMVDD  68

Query  344  GY  349
            GY
Sbjct  69   GY  70



>gb|AFK45927.1| unknown [Lotus japonicus]
Length=233

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  EP P+DWYQ Y +LAP++ LYV  +H +LVVG GNSAFSEG++D+G
Sbjct  7    AYGESWYWDNRYTNEPGPFDWYQKYITLAPIINLYVPQNHSILVVGSGNSAFSEGLVDEG  66



>ref|XP_010270938.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270939.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Nelumbo 
nucifera]
Length=235

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
             YG+  YW+ RY Q+  P+DWYQ Y +LAPLL  YV   HR LVVGCGNSAFSEGM++DG
Sbjct  9    GYGEPSYWDDRYTQDTGPFDWYQKYPALAPLLNFYVPRDHRTLVVGCGNSAFSEGMVNDG  68

Query  347  YAdvxnvdsssvvIEA  394
            Y DV N+D SSVVIEA
Sbjct  69   YEDVINIDISSVVIEA  84



>ref|NP_001189917.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AEE75945.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=277

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            +Y ++WYW+ RY  E  P+DWYQ Y  LAPL+ LYV   + RVLV+GCGNSAFSEGM+DD
Sbjct  9    SYSEQWYWDDRYKNESEPFDWYQKYSPLAPLINLYVPQRNQRVLVIGCGNSAFSEGMVDD  68

Query  344  GY  349
            GY
Sbjct  69   GY  70



>gb|KCW61369.1| hypothetical protein EUGRSUZ_H04109 [Eucalyptus grandis]
Length=230

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+ WYW++RY  +   +DWYQ Y +LAPL+ LYV    RVLVVGCGNS FSEGM+DDGY
Sbjct  14   YGEPWYWDRRYETDSGAFDWYQKYSALAPLVNLYVPREDRVLVVGCGNSEFSEGMVDDGY  73

Query  350  AdvxnvdsssvvIEA  394
             DV N+D SSVVIEA
Sbjct  74   EDVVNIDISSVVIEA  88



>ref|XP_010024858.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
13 [Eucalyptus grandis]
Length=248

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+ WYW++RY  +   +DWYQ Y +LAPL+ LYV    RVLVVGCGNS FSEGM+DDGY
Sbjct  14   YGEPWYWDRRYETDSGAFDWYQKYSALAPLVNLYVPREDRVLVVGCGNSEFSEGMVDDGY  73

Query  350  AdvxnvdsssvvIEA  394
             DV N+D SSVVIEA
Sbjct  74   EDVVNIDISSVVIEA  88



>ref|XP_010465784.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Camelina 
sativa]
 ref|XP_010465785.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Camelina 
sativa]
Length=247

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 8/69 (12%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNS-------AF  322
            +Y +KWYW+ RY  E  P+DWYQ Y SLAPL+ LYV H + RVLVVGCGNS       AF
Sbjct  10   SYSEKWYWDDRYTNESEPFDWYQKYPSLAPLINLYVPHRNQRVLVVGCGNSVFFWNNAAF  69

Query  323  SEGMIDDGY  349
            SEGM+DDGY
Sbjct  70   SEGMVDDGY  78



>emb|CDO98708.1| unnamed protein product [Coffea canephora]
Length=251

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 51/74 (69%), Gaps = 12/74 (16%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVP------------YDWYQTYHSLAPLLRLYVHPHHRVLVVGCG  310
            AYG+ WYW+KRYA                 +DWYQ Y SLAPLL LY+  HHRVLVVGCG
Sbjct  13   AYGESWYWDKRYASSSSGSGSGSGSESEASFDWYQKYPSLAPLLHLYIPRHHRVLVVGCG  72

Query  311  NSAFSEGMIDDGYA  352
            NSAFSEGM++DGYA
Sbjct  73   NSAFSEGMVNDGYA  86



>ref|XP_010465787.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Camelina 
sativa]
Length=239

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 8/69 (12%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNS-------AF  322
            +Y +KWYW+ RY  E  P+DWYQ Y SLAPL+ LYV H + RVLVVGCGNS       AF
Sbjct  10   SYSEKWYWDDRYTNESEPFDWYQKYPSLAPLINLYVPHRNQRVLVVGCGNSVFFWNNAAF  69

Query  323  SEGMIDDGY  349
            SEGM+DDGY
Sbjct  70   SEGMVDDGY  78



>ref|XP_003594886.1| Methyltransferase-like protein [Medicago truncatula]
 gb|AES65137.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=236

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  EP P+DWYQ Y +LAP++ LYV  +  +LVVG GNSAFS+GM+D+G
Sbjct  7    AYGESWYWDNRYTNEPGPFDWYQKYITLAPIINLYVPKNQSILVVGSGNSAFSQGMVDEG  66



>gb|AFK47960.1| unknown [Medicago truncatula]
Length=236

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  EP P+DWYQ Y +LAP++ LYV  +  +LVVG GNSAFS+GM+D+G
Sbjct  7    AYGESWYWDNRYTNEPGPFDWYQKYITLAPIINLYVPKNQSILVVGSGNSAFSQGMVDEG  66



>ref|XP_008793315.1| PREDICTED: methyltransferase-like protein 13 [Phoenix dactylifera]
Length=243

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYGD  YW++RY Q+P P+DWYQ Y +LAPLL LY+   HR+L+VGCGNS   E MI DG
Sbjct  13   AYGDPAYWDQRYRQDPGPFDWYQKYKTLAPLLDLYLRRSHRLLLVGCGNSELGEHMIADG  72

Query  347  YAdvxnvdsssvvIEA  394
            Y DV N+D SSVV+EA
Sbjct  73   YQDVVNIDISSVVVEA  88



>gb|KJB28819.1| hypothetical protein B456_005G071000 [Gossypium raimondii]
Length=235

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y +LA L+ LYV H   R+LVVGCGNS FSE M++D
Sbjct  10   AYGEPWYWDNRYAHESAPFDWYQKYPALASLIHLYVPHRDERILVVGCGNSVFSEDMVND  69

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD S VVIEA
Sbjct  70   GYEDVVNVDISPVVIEA  86



>gb|KJB28820.1| hypothetical protein B456_005G071000 [Gossypium raimondii]
Length=261

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            AYG+ WYW+ RYA E  P+DWYQ Y +LA L+ LYV H   R+LVVGCGNS FSE M++D
Sbjct  10   AYGEPWYWDNRYAHESAPFDWYQKYPALASLIHLYVPHRDERILVVGCGNSVFSEDMVND  69

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV NVD S VVIEA
Sbjct  70   GYEDVVNVDISPVVIEA  86



>ref|XP_010938164.1| PREDICTED: endothelin-converting enzyme 2 [Elaeis guineensis]
Length=243

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW++RY Q+P P+DWYQ Y +LAP+L +Y+   HR+LVVGCGNS   E MI DG
Sbjct  13   AYGEPAYWDQRYRQDPGPFDWYQKYKTLAPILDIYLRRSHRLLVVGCGNSILGESMIADG  72

Query  347  YAdvxnvdsssvvIEA  394
            Y DV N+D SSVV+EA
Sbjct  73   YQDVVNIDISSVVVEA  88



>ref|XP_009417774.1| PREDICTED: methyltransferase-like protein 13 [Musa acuminata 
subsp. malaccensis]
Length=245

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+  YW++RY Q P  +DWYQ Y SLAPL  LY+   HR+L+VGCGNSA  E M+DDGY
Sbjct  11   YGEPSYWDQRYRQYPEQFDWYQKYQSLAPLFDLYLRRSHRLLLVGCGNSALGESMVDDGY  70

Query  350  AdvxnvdsssvvIEA  394
             DV N+D SS+VIEA
Sbjct  71   QDVVNIDVSSIVIEA  85



>gb|ACJ84630.1| unknown [Medicago truncatula]
Length=236

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY  EP  +DWYQ Y +LAP++ LYV  +  +LVVG GNSAFS+GM+D+G
Sbjct  7    AYGESWYWDNRYTNEPGLFDWYQKYITLAPIINLYVPKNQSILVVGSGNSAFSQGMVDEG  66



>gb|ADE77744.1| unknown [Picea sitchensis]
Length=237

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYGD  YW+ RY Q+  P+DWYQ Y  LAPL  LY+   HR+L+VGCGN+  SE M++DG
Sbjct  8    AYGDASYWDNRYRQDNGPFDWYQQYSGLAPLFHLYIPKRHRILMVGCGNAVLSEDMVNDG  67

Query  347  YAdvxnvdsssvvIEA  394
            Y ++ NVD SSVVIEA
Sbjct  68   YQEIVNVDISSVVIEA  83



>ref|XP_011008276.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Populus 
euphratica]
Length=156

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+DDGY
Sbjct  13   YGDALYWDARYVQEAESFDWYQRYASLRPFVRRYIPTSSRVLMVGCGNALMSEDMVDDGY  72



>ref|XP_002876589.1| hypothetical protein ARALYDRAFT_486567 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52848.1| hypothetical protein ARALYDRAFT_486567 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    RVL+VGCGNS  SE M++DGY
Sbjct  13   YGDALYWDARYVQDALSFDWYQRYSSLRPFVRSFVSTSSRVLMVGCGNSLMSEDMVNDGY  72



>ref|NP_191650.2| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAL86352.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67532.1| unknown protein [Arabidopsis thaliana]
 gb|AEE80126.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=252

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDALYWDARYVQDALSFDWYQCYSSLRPFVRSFVSTSSRVLMVGCGNSLMSEDMVKDGY  72



>ref|XP_011008275.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Populus 
euphratica]
Length=216

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+DDGY
Sbjct  13   YGDALYWDARYVQEAESFDWYQRYASLRPFVRRYIPTSSRVLMVGCGNALMSEDMVDDGY  72



>ref|XP_002298412.1| hypothetical protein POPTR_0001s26830g [Populus trichocarpa]
 gb|EEE83217.1| hypothetical protein POPTR_0001s26830g [Populus trichocarpa]
Length=252

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+DDGY
Sbjct  13   YGDALYWDARYVQEAESFDWYQRYASLRPFVRRYIPTSSRVLMVGCGNALMSEDMVDDGY  72



>ref|XP_006369606.1| hypothetical protein POPTR_0001s26830g [Populus trichocarpa]
 gb|ERP66175.1| hypothetical protein POPTR_0001s26830g [Populus trichocarpa]
Length=251

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+DDGY
Sbjct  13   YGDALYWDARYVQEAESFDWYQRYASLRPFVRRYIPTSSRVLMVGCGNALMSEDMVDDGY  72



>ref|XP_011008274.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Populus 
euphratica]
Length=251

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+DDGY
Sbjct  13   YGDALYWDARYVQEAESFDWYQRYASLRPFVRRYIPTSSRVLMVGCGNALMSEDMVDDGY  72



>gb|KDP43608.1| hypothetical protein JCGZ_16895 [Jatropha curcas]
Length=156

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDSLYWDARYVQEAGSFDWYQRYSSLRPFVRRYIPTSSRVLMVGCGNALMSEDMVKDGY  72



>gb|KHN26616.1| Methyltransferase-like protein 13 [Glycine soja]
Length=235

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGM-IDD  343
            AYG+ WYW+ RY+ EP P+DWYQ Y +LAP++ LYV P H VLVV     AFSEGM +D 
Sbjct  7    AYGEPWYWDNRYSNEPGPFDWYQKYLTLAPIINLYVPPSHPVLVV-----AFSEGMVVDG  61

Query  344  GYAdvxnvdsssvvIEA  394
            GY DV N+D SSVVIEA
Sbjct  62   GYTDVVNIDISSVVIEA  78



>ref|XP_006402529.1| hypothetical protein EUTSA_v10006192mg [Eutrema salsugineum]
 gb|ESQ43982.1| hypothetical protein EUTSA_v10006192mg [Eutrema salsugineum]
Length=252

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDALYWDARYVQDALSFDWYQRYSSLRPFVRSFVPTSSRVLMVGCGNSLMSEDMVKDGY  72

Query  350  AdvxnvdsssvvIE  391
             ++ NVD SSV IE
Sbjct  73   ENIMNVDISSVAIE  86



>ref|XP_004516229.1| PREDICTED: methyltransferase-like protein 13-like isoform X2 
[Cicer arietinum]
Length=194

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y  L P +R Y+ P  R+L+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYIQEGGSFDWYQRYSDLRPFIRNYIPPQSRILMVGCGNAVMSEDMVKDGY  72



>ref|XP_010523662.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Tarenaya 
hassleriana]
Length=206

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEASSFDWYQRYSSLRPFVRSFIPTSSRVLMVGCGNSLMSEDMVKDGY  72

Query  350  AdvxnvdsssvvIE  391
             D+ N+D SSV IE
Sbjct  73   EDIMNIDISSVAIE  86



>ref|XP_010694736.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=168

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R ++    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYIQEAASFDWYQRYSALRPFVRKFIPTSSRVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_010523661.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Tarenaya 
hassleriana]
Length=249

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEASSFDWYQRYSSLRPFVRSFIPTSSRVLMVGCGNSLMSEDMVKDGY  72



>ref|XP_010523660.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Tarenaya 
hassleriana]
Length=249

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEASSFDWYQRYSSLRPFVRSFIPTSSRVLMVGCGNSLMSEDMVKDGY  72



>ref|XP_006291733.1| hypothetical protein CARUB_v10017902mg [Capsella rubella]
 gb|EOA24631.1| hypothetical protein CARUB_v10017902mg [Capsella rubella]
Length=251

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDALYWDARYVQDALSFDWYQRYSSLRPFVRSFVPTSSRVLMVGCGNSLMSEDMVKDGY  72



>ref|XP_004516228.1| PREDICTED: methyltransferase-like protein 13-like isoform X1 
[Cicer arietinum]
Length=243

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y  L P +R Y+ P  R+L+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYIQEGGSFDWYQRYSDLRPFIRNYIPPQSRILMVGCGNAVMSEDMVKDGY  72



>ref|XP_010694729.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=184

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R ++    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYIQEAASFDWYQRYSALRPFVRKFIPTSSRVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_002527957.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF34446.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=194

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEGGSFDWYQRYSSLRPFVRRYIPLSSRVLMVGCGNALMSEDMVKDGY  72



>ref|XP_002314063.1| hypothetical protein POPTR_0009s06050g [Populus trichocarpa]
 gb|EEE88018.1| hypothetical protein POPTR_0009s06050g [Populus trichocarpa]
Length=257

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M++DGY
Sbjct  13   YGDALYWDARYVQEAESFDWYQHYSSLRPFVRRYIPTSSRVLMVGCGNARMSEDMVEDGY  72



>ref|XP_001781361.1| predicted protein [Physcomitrella patens]
 gb|EDQ53808.1| predicted protein [Physcomitrella patens]
Length=236

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYGD+ YW+ RY+Q+   +DWYQ Y  LAPL+ +Y+   + +L+VGCGN+  SE M++DG
Sbjct  10   AYGDESYWDNRYSQDVGSFDWYQRYGGLAPLINMYMPKTNNLLMVGCGNAVISEDMVNDG  69

Query  347  YAdvxnvdsssvvIEA  394
            Y  + N+D S VVI+A
Sbjct  70   YQTIMNIDISQVVIDA  85



>emb|CDY45674.1| BnaCnng13390D [Brassica napus]
Length=251

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R ++    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDAHYWDARYVQDALSFDWYQRYSSLRPFVRNFIPTSSRVLMVGCGNSLMSEDMVKDGY  72

Query  350  AdvxnvdsssvvIE  391
             D+ NVD SSV IE
Sbjct  73   EDITNVDISSVAIE  86



>ref|XP_009104282.1| PREDICTED: methyltransferase-like protein 13 [Brassica rapa]
 emb|CDX67847.1| BnaA07g18870D [Brassica napus]
Length=251

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDAHYWDARYVQDALSFDWYQRYSSLRPFVRNFVPTSSRVLMVGCGNSLMSEDMVKDGY  72



>ref|XP_004229675.1| PREDICTED: methyltransferase-like protein 13 [Solanum lycopersicum]
Length=263

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R YV    RVL+VGCGN+  SE M+ DGY
Sbjct  14   YGDALYWDSRYVQEAGSFDWYQRYSALRPFVRHYVSTSSRVLMVGCGNAVMSEDMVKDGY  73



>gb|EPS69326.1| hypothetical protein M569_05441, partial [Genlisea aurea]
Length=100

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYWE RYAQ+PV +DWYQ Y  LAP++ LY+     +LVVGCGNS    G++  G
Sbjct  16   AYGEVWYWENRYAQDPVAFDWYQKYPFLAPVIHLYIPRSQPILVVGCGNS----GIVACG  71

Query  347  YA  352
            +A
Sbjct  72   FA  73



>ref|XP_010512425.1| PREDICTED: methyltransferase-like protein 13 [Camelina sativa]
Length=251

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDAHYWDARYVQDALDFDWYQRYSSLRPFVRSFVPTCSRVLMVGCGNSLMSEDMVKDGY  72

Query  350  AdvxnvdsssvvIE  391
             D+ NVD SSV IE
Sbjct  73   EDIMNVDISSVAIE  86



>ref|XP_010413503.1| PREDICTED: methyltransferase-like protein 13 [Camelina sativa]
Length=251

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDAHYWDARYVQDALDFDWYQRYSSLRPFVRSFVPTCSRVLMVGCGNSLMSEDMVKDGY  72



>gb|EYU42983.1| hypothetical protein MIMGU_mgv1a012357mg [Erythranthe guttata]
Length=253

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVP--YDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE     +DWYQ Y SL P +R Y+ P+ RVL+VGCGN+  SE M+ D
Sbjct  13   YGDAMYWDTRYVQEAESGSFDWYQRYSSLRPFIRKYISPNSRVLMVGCGNAVISEDMVKD  72

Query  344  GY  349
             Y
Sbjct  73   SY  74



>gb|KFK35288.1| hypothetical protein AALP_AA5G265300 [Arabis alpina]
Length=251

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ + +DWYQ Y SL P +R +V    R+L+VGCGNS  SE M++D Y
Sbjct  13   YGDALYWDTRYVQDALSFDWYQRYSSLRPFVRSFVPTSSRILMVGCGNSLMSEDMVNDEY  72

Query  350  AdvxnvdsssvvIE  391
             ++ NVD SSV IE
Sbjct  73   EEIMNVDISSVAIE  86



>ref|XP_010694725.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=249

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R ++    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYIQEAASFDWYQRYSALRPFVRKFIPTSSRVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_010103281.1| hypothetical protein L484_007950 [Morus notabilis]
 gb|EXB95306.1| hypothetical protein L484_007950 [Morus notabilis]
Length=229

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M++DGY
Sbjct  13   YGDALYWDARYIQEGGSFDWYQRYSALRPFVRNYIPTSSRVLMVGCGNAVMSEDMVEDGY  72



>ref|XP_002272409.1| PREDICTED: methyltransferase-like protein 13 [Vitis vinifera]
 emb|CBI28595.3| unnamed protein product [Vitis vinifera]
Length=253

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYIQEAGSFDWYQRYSALRPFVRRYIPTSSRVLMVGCGNAVMSEDMVKDGY  72

Query  350  AdvxnvdsssvvIE  391
             ++ N+D SSV IE
Sbjct  73   EEIMNIDISSVAIE  86



>ref|XP_001780701.1| predicted protein [Physcomitrella patens]
 gb|EDQ54485.1| predicted protein [Physcomitrella patens]
Length=185

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            Y D+ YW  RY Q+  P+DWYQ Y  +AP+++++  P  RVL+VGCG++  SE M+ DGY
Sbjct  10   YFDEAYWNSRYTQDAGPFDWYQQYEGIAPVIKMHSQPSDRVLMVGCGSALLSEEMVKDGY  69



>ref|XP_002969554.1| hypothetical protein SELMODRAFT_410320 [Selaginella moellendorffii]
 gb|EFJ29642.1| hypothetical protein SELMODRAFT_410320 [Selaginella moellendorffii]
Length=241

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW+ RY  +   +DWYQ Y  L+ LL+ YV    R+L+VGCGN+A SE M++DG
Sbjct  8    AYGEASYWDNRYKNDSSTFDWYQRYAGLSALLQKYVPKTSRILMVGCGNAAISEDMVNDG  67

Query  347  YAdvxnvdsssvvIEA  394
            Y ++ N+D S+VVIEA
Sbjct  68   YQEIVNIDISTVVIEA  83



>ref|XP_002970823.1| hypothetical protein SELMODRAFT_94369 [Selaginella moellendorffii]
 gb|EFJ28149.1| hypothetical protein SELMODRAFT_94369 [Selaginella moellendorffii]
Length=267

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW+ RY  +   +DWYQ Y  L+ LL+ YV    R+L+VGCGN+A SE M++DG
Sbjct  8    AYGEASYWDNRYKNDSSTFDWYQRYAGLSALLQKYVPKTSRILMVGCGNAAISEDMVNDG  67

Query  347  YAdvxnvdsssvvIEA  394
            Y ++ N+D S+VVIEA
Sbjct  68   YQEIVNIDISTVVIEA  83



>gb|KHN47725.1| Methyltransferase-like protein 13 [Glycine soja]
Length=244

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+ WYW+ RY+ EP P+DWYQ Y +LAP+  LYV P   VLVV     AFSEGM+ DG
Sbjct  7    AYGEPWYWDNRYSNEPGPFDWYQKYLTLAPITNLYVPPAQPVLVV-----AFSEGMVVDG  61



>ref|XP_008231550.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Prunus 
mume]
Length=189

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY +E   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDAVYWDARYVEEGGSFDWYQRYSSLRPFVRNYIPTSSRVLMVGCGNAVMSEDMVADGY  72



>ref|XP_010269735.1| PREDICTED: methyltransferase-like protein 13 [Nelumbo nucifera]
Length=249

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW  RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWNSRYLQEAGSFDWYQRYTALRPFVRKYIPTSSRVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_006482947.1| PREDICTED: methyltransferase-like protein 13-like isoform X2 
[Citrus sinensis]
Length=235

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW  RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWNARYVQEGGSFDWYQRYSALRPFVRKYIPTSSRVLMVGCGNALMSEDMVKDGY  72



>ref|XP_006482948.1| PREDICTED: methyltransferase-like protein 13-like isoform X3 
[Citrus sinensis]
Length=233

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW  RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWNARYVQEGGSFDWYQRYSALRPFVRKYIPTSSRVLMVGCGNALMSEDMVKDGY  72



>ref|XP_006438924.1| hypothetical protein CICLE_v10032531mg [Citrus clementina]
 ref|XP_006482946.1| PREDICTED: methyltransferase-like protein 13-like isoform X1 
[Citrus sinensis]
 gb|ESR52164.1| hypothetical protein CICLE_v10032531mg [Citrus clementina]
Length=252

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW  RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWNARYVQEGGSFDWYQRYSALRPFVRKYIPTSSRVLMVGCGNALMSEDMVKDGY  72



>ref|XP_010279519.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Nelumbo 
nucifera]
Length=249

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW  RY QE   +DWYQ Y +L P  R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWNSRYVQEAGSFDWYQRYSALRPFARKYIPTSSRVLMVGCGNAVMSEDMVKDGY  72



>gb|KDO83291.1| hypothetical protein CISIN_1g025475mg [Citrus sinensis]
Length=252

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW  RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWNARYVQEGGSFDWYQRYSALRPFVRKYIPTSSRVLMVGCGNALMSEDMVKDGY  72



>ref|XP_007220926.1| hypothetical protein PRUPE_ppa023083mg, partial [Prunus persica]
 gb|EMJ22125.1| hypothetical protein PRUPE_ppa023083mg, partial [Prunus persica]
Length=229

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY +E   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYVEEGGSFDWYQRYSSLRPFVRNYIPTSSRVLMVGCGNAVMSEDMVADGY  72



>ref|XP_010279520.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Nelumbo 
nucifera]
Length=244

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW  RY QE   +DWYQ Y +L P  R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWNSRYVQEAGSFDWYQRYSALRPFARKYIPTSSRVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_011091775.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Sesamum 
indicum]
Length=256

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE     +DWYQ Y +L P +R Y+ P  RVL+VGCGN+  SE M+ D
Sbjct  13   YGDALYWDARYIQEANCGSFDWYQRYSALRPFIRKYISPSSRVLMVGCGNAVISEDMVKD  72

Query  344  GY  349
            G+
Sbjct  73   GF  74



>ref|XP_008349519.1| PREDICTED: methyltransferase-like protein 13 [Malus domestica]
Length=148

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEGGSFDWYQRYSSLRPFVRHFIPISSSVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_008231549.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Prunus 
mume]
Length=252

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY +E   +DWYQ Y SL P +R Y+    RVL+VGCGN+  SE M+ DGY
Sbjct  13   YGDAVYWDARYVEEGGSFDWYQRYSSLRPFVRNYIPTSSRVLMVGCGNAVMSEDMVADGY  72



>ref|NP_001060507.1| Os07g0656800 [Oryza sativa Japonica Group]
 dbj|BAF22421.1| Os07g0656800 [Oryza sativa Japonica Group]
 dbj|BAG94181.1| unnamed protein product [Oryza sativa Japonica Group]
Length=185

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            ++YG   YW+ RY +E   PYDWYQ Y +L P +R +  P  RVL++GCG++  SE M+D
Sbjct  69   LSYGKAEYWDARYVEEGGAPYDWYQRYAALRPFVRRFAPPESRVLMIGCGSALMSEDMVD  128

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  129  DGYTEIMNIDISSVVIE  145



>ref|XP_009391525.1| PREDICTED: methyltransferase-like protein 13 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            AYG+  YW++RY  +P  +DWYQ Y SLAPL   Y+  HHR+L+VGCGNSA  E M+DDG
Sbjct  4    AYGEPSYWDQRYQSDPGTFDWYQKYPSLAPLFDRYLLRHHRLLLVGCGNSALGESMVDDG  63

Query  347  YAdvxnvdsssvvIEA  394
            Y DV N+D SSVVIEA
Sbjct  64   YQDVVNIDISSVVIEA  79



>ref|XP_004136132.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus]
 ref|XP_004158228.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus]
 gb|KGN45088.1| hypothetical protein Csa_7G420810 [Cucumis sativus]
Length=253

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YGDAVYWDARYLQEAGSFDWYQRYSSLRPFVRKFISTSASVLMVGCGNAVMSEDMVKDGY  72



>gb|EEE67733.1| hypothetical protein OsJ_25422 [Oryza sativa Japonica Group]
Length=309

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            ++YG   YW+ RY +E   PYDWYQ Y +L P +R +  P  RVL++GCG++  SE M+D
Sbjct  69   LSYGKAEYWDARYVEEGGAPYDWYQRYAALRPFVRRFAPPESRVLMIGCGSALMSEDMVD  128

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  129  DGYTEIMNIDISSVVIE  145



>ref|XP_010469131.1| PREDICTED: methyltransferase-like protein 13 [Camelina sativa]
Length=251

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY Q+ +  +WYQ Y SL P +R +V    RVL+VGCGNS  SE M+ DGY
Sbjct  13   YGDAHYWDARYVQDALDLNWYQRYSSLRPFVRSFVPTCSRVLMVGCGNSLMSEDMVKDGY  72

Query  350  AdvxnvdsssvvIE  391
             D+ NVD SSV IE
Sbjct  73   EDIMNVDISSVAIE  86



>gb|KJB24939.1| hypothetical protein B456_004G168900 [Gossypium raimondii]
Length=187

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV-PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+ RY QE    +DWYQ Y SL P +R YV    RVL+VGCGN+  SE M  DG
Sbjct  13   YGDALYWDSRYIQEAGGAFDWYQRYSSLRPFVRRYVPTSSRVLMVGCGNALMSEDMAKDG  72

Query  347  Y  349
            Y
Sbjct  73   Y  73



>ref|XP_006345393.1| PREDICTED: methyltransferase-like protein 13-like [Solanum tuberosum]
Length=263

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R  V    RVL+VGCGN+  SE M+ DGY
Sbjct  14   YGDALYWDTRYVQEAGSFDWYQCYSALRPYVRHCVSTSSRVLMVGCGNAVMSEDMVKDGY  73



>ref|XP_007131399.1| hypothetical protein PHAVU_011G010500g [Phaseolus vulgaris]
 gb|ESW03393.1| hypothetical protein PHAVU_011G010500g [Phaseolus vulgaris]
Length=252

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P +R ++    R+L+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYIQEGGSFDWYQRYSALRPFVRNFIPFSSRILMVGCGNAVMSEDMVKDGY  72



>ref|XP_006827494.1| hypothetical protein AMTR_s00009p00167650 [Amborella trichopoda]
 gb|ERM94910.1| hypothetical protein AMTR_s00009p00167650 [Amborella trichopoda]
Length=257

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE  P+DWYQ Y +L P +  Y+     +L++GCGN+  SE M+ DGY
Sbjct  21   YGDALYWDTRYIQEAGPFDWYQRYSALRPFIHRYIPKSSPILMLGCGNAVMSEDMVKDGY  80



>ref|XP_007052437.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX96594.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=252

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV-PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+ RY QE    +DWYQ Y SL P +R YV    RVL+VGCGN+  SE M+ DG
Sbjct  13   YGDALYWDARYVQEAGGAFDWYQRYSSLRPFVRNYVPTSSRVLMVGCGNALMSEDMVKDG  72

Query  347  Y  349
            Y
Sbjct  73   Y  73



>ref|XP_009368053.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Pyrus 
x bretschneideri]
Length=255

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEGGAFDWYQRYSSLRPFVRHFIPTSSPVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_009368054.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Pyrus 
x bretschneideri]
Length=254

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEGGAFDWYQRYSSLRPFVRHFIPTSSPVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_008375217.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Malus 
domestica]
Length=254

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEGGAFDWYQRYSSLRPFVRHFIPTSSPVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_008375216.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Malus 
domestica]
Length=255

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YGDALYWDARYVQEGGAFDWYQRYSSLRPFVRHFIPTSSPVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_003562541.1| PREDICTED: methyltransferase-like protein 13 [Brachypodium distachyon]
Length=276

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            +YG+  YW+ RY +E   PYDWYQ Y +L P +RL+  P  R+L++GCG++  SE M+ D
Sbjct  38   SYGEAGYWDARYVEEGGAPYDWYQRYAALRPFVRLFAPPASRLLMIGCGSALISEDMVAD  97

Query  344  GYAdvxnvdsssvvIE  391
            GY D+ N+D SSVVIE
Sbjct  98   GYTDIMNIDISSVVIE  113



>ref|XP_002461145.1| hypothetical protein SORBIDRAFT_02g041600 [Sorghum bicolor]
 gb|EER97666.1| hypothetical protein SORBIDRAFT_02g041600 [Sorghum bicolor]
Length=270

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            + YG+  YW+ RY +E   PYDWYQ Y +L P +R +  P  R+L+VGCG++  SE M++
Sbjct  31   LGYGEAEYWDARYVEEGGAPYDWYQRYDALRPFVRRFAPPASRILMVGCGSALMSEDMVN  90

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  91   DGYVEIVNIDISSVVIE  107



>ref|XP_008651009.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=226

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            + YG+  YW+ RY +E   PYDWYQ Y +L P +R +  P  R+L+VGCG++  SE M+ 
Sbjct  71   LGYGEAEYWDARYVEEGGAPYDWYQRYDALRPFVRCFAPPASRILMVGCGSALMSEDMVT  130

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  131  DGYVEIVNIDISSVVIE  147



>ref|NP_001136982.1| hypothetical protein [Zea mays]
 gb|ACF83012.1| unknown [Zea mays]
 tpg|DAA63948.1| TPA: hypothetical protein ZEAMMB73_090428 [Zea mays]
Length=195

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            + YG+  YW+ RY +E   PYDWYQ Y +L P +R +  P  R+L+VGCG++  SE M+ 
Sbjct  71   LGYGEAEYWDARYVEEGGAPYDWYQRYDALRPFVRCFAPPASRILMVGCGSALMSEDMVT  130

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  131  DGYVEIVNIDISSVVIE  147



>ref|XP_002993618.1| hypothetical protein SELMODRAFT_449189 [Selaginella moellendorffii]
 gb|EFJ05310.1| hypothetical protein SELMODRAFT_449189 [Selaginella moellendorffii]
Length=1808

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  170   YGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
             YG++ YW KRYA+E  + +DWYQ Y  L P+L+ ++    RVL+ GCGN+  SE M+ DG
Sbjct  1591  YGEEEYWNKRYAEEAFMTFDWYQRYADLQPILKKHIPKSARVLMAGCGNAVMSEDMVSDG  1650

Query  347   Y  349
             Y
Sbjct  1651  Y  1651



>tpg|DAA63949.1| TPA: hypothetical protein ZEAMMB73_090428 [Zea mays]
Length=163

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            + YG+  YW+ RY +E   PYDWYQ Y +L P +R +  P  R+L+VGCG++  SE M+ 
Sbjct  71   LGYGEAEYWDARYVEEGGAPYDWYQRYDALRPFVRCFAPPASRILMVGCGSALMSEDMVT  130

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  131  DGYVEIVNIDISSVVIE  147



>gb|ACR35085.1| unknown [Zea mays]
Length=266

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            + YG+  YW+ RY +E   PYDWYQ Y +L P +R +  P  R+L+VGCG++  SE M+ 
Sbjct  27   LGYGEAEYWDARYVEEGGAPYDWYQRYDALRPFVRCFAPPASRILMVGCGSALMSEDMVT  86

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  87   DGYVEIVNIDISSVVIE  103



>gb|KHN32397.1| Methyltransferase-like protein 13 [Glycine soja]
Length=252

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+  YW+ RY QE   +DWYQ Y +L P +R ++    R+L+VGCGN+  SE M+ DGY
Sbjct  13   YGEAGYWDARYIQEGGSFDWYQRYSALRPFVRNFIPLSSRILMVGCGNAVMSEDMVKDGY  72



>gb|KJB24938.1| hypothetical protein B456_004G168900 [Gossypium raimondii]
Length=252

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV-PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+ RY QE    +DWYQ Y SL P +R YV    RVL+VGCGN+  SE M  DG
Sbjct  13   YGDALYWDSRYIQEAGGAFDWYQRYSSLRPFVRRYVPTSSRVLMVGCGNALMSEDMAKDG  72

Query  347  Y  349
            Y
Sbjct  73   Y  73



>ref|XP_010906018.1| PREDICTED: methyltransferase-like protein 13 [Elaeis guineensis]
Length=254

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+ RY +E    +DWYQ Y +L P +R +V    RVL+VGCGN+  SE M+ DG
Sbjct  13   YGDALYWDARYVEEGGASFDWYQRYSALRPFVRKFVPTSSRVLMVGCGNAVMSEDMVKDG  72

Query  347  YAdvxnvdsssvvIE  391
            Y D+ N+D SSVVIE
Sbjct  73   YVDIMNIDISSVVIE  87



>ref|XP_003539878.1| PREDICTED: methyltransferase-like protein 13-like [Glycine max]
Length=252

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+  YW+ RY QE   +DWYQ Y +L P +R ++    R+L+VGCGN+  SE M+ DGY
Sbjct  13   YGEAGYWDARYIQEGGSFDWYQRYSALRPFVRNFIPLSSRILMVGCGNAVMSEDMVKDGY  72



>ref|XP_008783272.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Phoenix 
dactylifera]
Length=254

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+ RY +E    +DWYQ Y +L P +R +V    RVL+VGCGN+  SE M+ DG
Sbjct  13   YGDALYWDARYVEEGGASFDWYQRYSALRPFVRKFVPTSSRVLMVGCGNAVMSEDMVKDG  72

Query  347  YAdvxnvdsssvvIE  391
            Y D+ N+D SSVVIE
Sbjct  73   YVDIMNIDISSVVIE  87



>ref|NP_001235079.1| uncharacterized protein LOC100527880 [Glycine max]
 gb|ACU17083.1| unknown [Glycine max]
 gb|KHN11709.1| Methyltransferase-like protein 13 [Glycine soja]
Length=249

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+  YW+ RY QE    DWYQ Y +L P +R ++    R+L+VGCGNS  SE M+ DGY
Sbjct  13   YGEAVYWDARYIQEDGSCDWYQRYSALRPFVRNFIPLSSRILMVGCGNSVMSEDMVKDGY  72



>ref|XP_002973436.1| hypothetical protein SELMODRAFT_442094 [Selaginella moellendorffii]
 gb|EFJ25810.1| hypothetical protein SELMODRAFT_442094 [Selaginella moellendorffii]
Length=1754

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  170   YGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
             YG++ YW KRYA+E  + +DWYQ Y  L P+L+ ++    RVL+ GCGN+  SE M+ DG
Sbjct  1537  YGEEEYWNKRYAEEAFMTFDWYQRYADLQPILKKHIPKSARVLMAGCGNAVMSEDMVRDG  1596

Query  347   Y  349
             Y
Sbjct  1597  Y  1597



>ref|XP_008461358.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Cucumis 
melo]
Length=253

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY  E   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YGDAVYWDARYLHEAGSFDWYQRYSSLRPFVRKFISTSASVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_009602387.1| PREDICTED: methyltransferase-like protein 13 [Nicotiana tomentosiformis]
Length=249

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE     +DWYQ Y +L P +R YV    R+L+VGCGN+  SE M+ D
Sbjct  13   YGDALYWDARYLQEAGCGSFDWYQRYSALRPFVRNYVPTSSRILMVGCGNAVMSEDMVKD  72

Query  344  GY  349
            GY
Sbjct  73   GY  74



>emb|CDP16366.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE     +DWYQ Y +L P +R Y+    RVL+VGCGN+  SE M+ D
Sbjct  13   YGDALYWDARYIQEANCGSFDWYQRYSALRPFVRKYIPTSARVLMVGCGNALMSEDMVKD  72

Query  344  GY  349
            GY
Sbjct  73   GY  74



>ref|XP_009790864.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Nicotiana 
sylvestris]
Length=158

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE     +DWYQ Y +L P +R YV    R+L+VGCG++  SE M+ D
Sbjct  13   YGDALYWDARYLQEAGCGSFDWYQRYSALRPFVRNYVPTSSRILMVGCGSAVMSEDMVKD  72

Query  344  GY  349
            GY
Sbjct  73   GY  74



>ref|XP_008651008.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA63947.1| TPA: hypothetical protein ZEAMMB73_090428 [Zea mays]
Length=310

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            + YG+  YW+ RY +E   PYDWYQ Y +L P +R +  P  R+L+VGCG++  SE M+ 
Sbjct  71   LGYGEAEYWDARYVEEGGAPYDWYQRYDALRPFVRCFAPPASRILMVGCGSALMSEDMVT  130

Query  341  DGYAdvxnvdsssvvIE  391
            DGY ++ N+D SSVVIE
Sbjct  131  DGYVEIVNIDISSVVIE  147



>gb|KEH17674.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=151

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P LR        +L+VGCGN+  SE M+ DGY
Sbjct  13   YGDAHYWDARYIQEGGSFDWYQRYSNLKPFLRHCFSLSSTILMVGCGNAVISEDMVKDGY  72



>ref|XP_010942058.1| PREDICTED: methyltransferase-like protein 13 [Elaeis guineensis]
Length=382

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+ RY +E    +DWYQ Y +L P +R +V    RVL+VGCGN+  SE M+ DG
Sbjct  13   YGDALYWDARYVEEGGASFDWYQRYSALRPFVRKFVPTSSRVLMVGCGNAVMSEDMVKDG  72

Query  347  YAdvxnvdsssvvIE  391
            Y D+ N+D SSVVIE
Sbjct  73   YVDIMNIDISSVVIE  87



>emb|CDW83771.1| methyltransferase-like protein 13-like [Stylonychia lemnae]
Length=259

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQ-EPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+KRY + E   +DW + Y SL PL +  + P  ++LV+GCGN+ FSE + DDG
Sbjct  4    YGDPNYWDKRYEENEGAVFDWLEDYGSLKPLFKDILKPESKILVLGCGNAEFSEDLYDDG  63

Query  347  Y  349
            Y
Sbjct  64   Y  64



>ref|XP_004958544.1| PREDICTED: endothelin-converting enzyme 2-like [Setaria italica]
Length=261

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMID  340
            ++YG+  YW+ RY +E   PYDWYQ Y +L P +R +  P  R+L++GCG++  SE M+ 
Sbjct  22   LSYGEAEYWDARYVEEGGAPYDWYQRYDALRPFVRRFAPPASRLLMIGCGSALMSEDMVS  81

Query  341  DGY  349
            DGY
Sbjct  82   DGY  84



>ref|XP_009354367.1| PREDICTED: methyltransferase-like protein 13 [Pyrus x bretschneideri]
Length=250

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            Y D  YW+ RY QE   +DWYQ Y SL P +R ++     VL+VGCGN+  SE M+ DGY
Sbjct  13   YSDALYWDARYVQEGGSFDWYQRYSSLRPFVRHFIPISSSVLMVGCGNAVMSEDMVKDGY  72



>ref|XP_009790863.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Nicotiana 
sylvestris]
Length=239

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE     +DWYQ Y +L P +R YV    R+L+VGCG++  SE M+ D
Sbjct  13   YGDALYWDARYLQEAGCGSFDWYQRYSALRPFVRNYVPTSSRILMVGCGSAVMSEDMVKD  72

Query  344  GY  349
            GY
Sbjct  73   GY  74



>ref|XP_001751905.1| predicted protein [Physcomitrella patens]
 gb|EDQ83340.1| predicted protein [Physcomitrella patens]
Length=257

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            +AY D+ YW  RYA +P P+DWYQ+Y  L  L  +Y+   +++L  GCGN    E M+ D
Sbjct  28   LAYHDEEYWNSRYANQPEPFDWYQSYKELKGLFEMYLPKDNKILNAGCGNGMLGEDMVRD  87

Query  344  GY  349
            GY
Sbjct  88   GY  89



>gb|EXX70602.1| See1p [Rhizophagus irregularis DAOM 197198w]
Length=197

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGM  334
              Y  K YWEKRY++EP  + +DW+++Y  L PL  +++ + +  +LV+GCGNSA SE M
Sbjct  13   TEYRTKEYWEKRYSKEPPEISFDWFKSYKELKPLFDVHLPNKNVSILVLGCGNSALSEDM  72

Query  335  IDDGY  349
             DDGY
Sbjct  73   YDDGY  77



>ref|XP_009393889.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=248

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRY-AQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
             YGD  YW+ RY A     +DWYQ Y +L P +R YV    RVL+VGCGN+  SE M+ D
Sbjct  12   GYGDALYWDARYLADGSASFDWYQRYSALRPFVRKYVPVSARVLMVGCGNAVLSEDMVKD  71

Query  344  GY  349
            GY
Sbjct  72   GY  73



>ref|XP_009393890.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=238

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRY-AQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
             YGD  YW+ RY A     +DWYQ Y +L P +R YV    RVL+VGCGN+  SE M+ D
Sbjct  12   GYGDALYWDARYLADGSASFDWYQRYSALRPFVRKYVPVSARVLMVGCGNAVLSEDMVKD  71

Query  344  GY  349
            GY
Sbjct  72   GY  73



>ref|XP_009393891.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=235

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRY-AQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
             YGD  YW+ RY A     +DWYQ Y +L P +R YV    RVL+VGCGN+  SE M+ D
Sbjct  12   GYGDALYWDARYLADGSASFDWYQRYSALRPFVRKYVPVSARVLMVGCGNAVLSEDMVKD  71

Query  344  GY  349
            GY
Sbjct  72   GY  73



>ref|XP_010067789.1| PREDICTED: methyltransferase-like protein 13 [Eucalyptus grandis]
 ref|XP_010067790.1| PREDICTED: methyltransferase-like protein 13 [Eucalyptus grandis]
 gb|KCW65992.1| hypothetical protein EUGRSUZ_G03283 [Eucalyptus grandis]
 gb|KCW65993.1| hypothetical protein EUGRSUZ_G03283 [Eucalyptus grandis]
Length=258

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVP--YDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMID  340
            YGD  YW+ RY QE     +DWYQ Y  L P +R+Y+     RVLVVGCGN+  SE M+ 
Sbjct  13   YGDATYWDARYVQEAEMGHFDWYQRYSGLRPFIRMYIPSCSSRVLVVGCGNALMSEDMVK  72

Query  341  DGYAdvxnvdsssvvIE  391
            DGY D+ N+D SSV IE
Sbjct  73   DGYEDITNIDISSVAIE  89



>gb|ESA21750.1| hypothetical protein GLOINDRAFT_118540 [Rhizophagus irregularis 
DAOM 181602]
Length=209

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGM  334
              Y  K YWEKRY++EP  + +DW+++Y  L PL  +++ + +  +LV+GCGNSA SE M
Sbjct  13   TEYRTKEYWEKRYSKEPPEISFDWFKSYKELKPLFDVHLPNKNVSILVLGCGNSALSEDM  72

Query  335  IDDGY  349
             DDGY
Sbjct  73   YDDGY  77



>gb|KCW65991.1| hypothetical protein EUGRSUZ_G03283 [Eucalyptus grandis]
Length=291

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVP--YDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMID  340
            YGD  YW+ RY QE     +DWYQ Y  L P +R+Y+     RVLVVGCGN+  SE M+ 
Sbjct  13   YGDATYWDARYVQEAEMGHFDWYQRYSGLRPFIRMYIPSCSSRVLVVGCGNALMSEDMVK  72

Query  341  DGYAdvxnvdsssvvIE  391
            DGY D+ N+D SSV IE
Sbjct  73   DGYEDITNIDISSVAIE  89



>gb|KIY68899.1| S-adenosyl-L-methionine-dependent methyltransferase [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=233

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYA-QEPVPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMIDD  343
            YG++ YW +RY+ +E   +DW++TY  +AP+LR L  + + R+L++GCGNS  SE M DD
Sbjct  11   YGEREYWNERYSGEENKTFDWFKTYADVAPILRELIPNKNARILMLGCGNSTLSEDMYDD  70

Query  344  GYA  352
            GY 
Sbjct  71   GYT  73



>gb|KEH17673.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=206

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y +L P LR        +L+VGCGN+  SE M+ DGY
Sbjct  13   YGDAHYWDARYIQEGGSFDWYQRYSNLKPFLRHCFSLSSTILMVGCGNAVISEDMVKDGY  72



>emb|CDW78977.1| protein kinase domain protein [Stylonychia lemnae]
Length=211

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWE RY ++  P+DWYQ Y  +  ++  Y+ P  ++L +GCGNS  SE M +DGY
Sbjct  4    YGKPEYWEDRYQKDKEPFDWYQRYSGIKDVITQYIQPTFQILNIGCGNSRLSEEMYEDGY  63



>gb|EWM24648.1| protein kinase domain protein [Nannochloropsis gaditana]
Length=288

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
             YG   YW+ RY  +P P+DWYQ Y  L  LL+ ++     +L+ GCGNS+ SE M +DG
Sbjct  16   CYGRASYWDSRYTTDPEPFDWYQRYSGLKGLLKQHIRKSDSILMAGCGNSSMSEDMYEDG  75

Query  347  YA  352
            + 
Sbjct  76   FT  77



>ref|XP_007304464.1| S-adenosyl-L-methionine-dependent methyltransferase [Stereum 
hirsutum FP-91666 SS1]
 gb|EIM86845.1| S-adenosyl-L-methionine-dependent methyltransferase [Stereum 
hirsutum FP-91666 SS1]
Length=206

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY+QE     +DW++ Y  +A L+R  +   H R+L++GCGNS  SE M D
Sbjct  14   YGTKQYWDQRYSQEATDATFDWFKKYEDVADLIRDAIPDKHARILMLGCGNSTLSEDMYD  73

Query  341  DGY  349
            DGY
Sbjct  74   DGY  76



>gb|KFH67412.1| hypothetical protein MVEG_06145 [Mortierella verticillata NRRL 
6337]
Length=208

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMID  340
             AY  + YWE+RYA+E   +DW++TY  L PLL  ++     R+L++GCGNS  SE M D
Sbjct  11   TAYKRQEYWEERYAKEE-SFDWFKTYEDLKPLLSQHITSKDSRILMLGCGNSTLSEDMYD  69

Query  341  DGY  349
            DGY
Sbjct  70   DGY  72



>emb|CBJ25742.1| conserved unknown protein [Ectocarpus siliculosus]
Length=211

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YW+ RY ++P  +DWYQ Y  L   +  YV     +L+VGCGNS  SE M DDG+
Sbjct  6    YGKASYWDDRYTKDPEIFDWYQRYSGLKDWISQYVRKDDNILMVGCGNSRLSEDMFDDGF  65

Query  350  A  352
             
Sbjct  66   T  66



>ref|XP_002946829.1| hypothetical protein VOLCADRAFT_56160 [Volvox carteri f. nagariensis]
 gb|EFJ52055.1| hypothetical protein VOLCADRAFT_56160 [Volvox carteri f. nagariensis]
Length=203

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            V Y +K YW  RY  +P  +DW+  Y +L  ++R +V     VL VGCGNS F EGM  D
Sbjct  16   VRYAEKEYWNSRYISQPCEFDWFYGYTALRKVVRTFVKRTKSVLHVGCGNSNFQEGMAKD  75

Query  344  GY  349
            GY
Sbjct  76   GY  77



>ref|XP_009549301.1| hypothetical protein HETIRDRAFT_323921 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW79026.1| hypothetical protein HETIRDRAFT_323921 [Heterobasidion irregulare 
TC 32-1]
Length=207

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLRLYVHPHH-RVLVVGCGNSAFSEGMID  340
            YG K YW++RY QEP    +DW++ Y  +A LLR  +   + R+L++GCGNS  SE M D
Sbjct  13   YGTKEYWDQRYTQEPEDASFDWFKRYEDVAGLLRDAIPDKNVRILMLGCGNSTLSEDMYD  72

Query  341  DGYA  352
            DGY 
Sbjct  73   DGYK  76



>ref|XP_002988875.1| hypothetical protein SELMODRAFT_427489 [Selaginella moellendorffii]
 gb|EFJ10137.1| hypothetical protein SELMODRAFT_427489 [Selaginella moellendorffii]
Length=276

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
             YG+  YW+KRYA++P    DW+  Y    P++R ++    RVL+ GCGNSA S  M++D
Sbjct  47   GYGEISYWDKRYAEQPDATLDWFSDYSRFEPIVRKHIPKSSRVLMAGCGNSAMSNDMVED  106

Query  344  GY  349
            GY
Sbjct  107  GY  108



>ref|XP_003291807.1| hypothetical protein DICPUDRAFT_10325 [Dictyostelium purpureum]
 gb|EGC31676.1| hypothetical protein DICPUDRAFT_10325 [Dictyostelium purpureum]
Length=166

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHH-RVLVVGCGNSAFSEGMIDDG  346
            YG   YW++RY ++P  +DWYQ Y +L P L   +     ++L+VGCGNS  SE M +DG
Sbjct  4    YGKPVYWDRRYKKDPETFDWYQKYSTLKPFLIEKIKSKDAKILMVGCGNSTLSEEMYNDG  63

Query  347  Y  349
            Y
Sbjct  64   Y  64



>emb|CCM00248.1| predicted protein [Fibroporia radiculosa]
Length=157

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY+QEP    +DW+++Y  +A +LR L      R++++GCGNS  SE M D
Sbjct  12   YGTKQYWDQRYSQEPPDASFDWFKSYEDVADILRELIPDRDARIVMLGCGNSKLSEEMYD  71

Query  341  DGY  349
            DGY
Sbjct  72   DGY  74



>ref|XP_009405869.1| PREDICTED: methyltransferase-like protein 13 [Musa acuminata 
subsp. malaccensis]
Length=250

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  167  AYGDKWYWEKRY-AQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            +YGD  YW+ RY A     +DWYQ Y +L P +R YV     VL+VGCGN+  SE M+ D
Sbjct  12   SYGDALYWDARYLADGSASFDWYQRYSALRPFVRKYVPVSAGVLMVGCGNAVMSEDMVKD  71

Query  344  GY  349
            GY
Sbjct  72   GY  73



>gb|EJY82595.1| hypothetical protein OXYTRI_19792 [Oxytricha trifallax]
Length=262

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQ-EPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+KRY + +   +DW + Y SL PL    + P  ++LV+GCGN+ FSE + DDG
Sbjct  4    YGDPKYWDKRYQENQGSMFDWLEDYKSLKPLFGDILTPESKILVLGCGNAEFSEDLYDDG  63

Query  347  Y  349
            Y
Sbjct  64   Y  64



>gb|AFK36600.1| unknown [Lotus japonicus]
Length=258

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YGD  YW+ RY QE   +DWYQ Y SL P +R        +L+VGCGN+  SE M+ DGY
Sbjct  15   YGDALYWDTRYIQEGGSFDWYQRYSSLRPFVRHCFPLSSTLLMVGCGNAVMSEDMVRDGY  74



>ref|XP_001437949.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK70552.1| unnamed protein product [Paramecium tetraurelia]
Length=212

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWE+RY ++P P+DWYQ +  +  L++    P  ++L VG GNS  SE M D+GY
Sbjct  4    YGKAEYWEERYTRDPEPFDWYQRFAGIKDLVQACFTPESKLLNVGAGNSRLSEEMFDEGY  63



>ref|XP_001455278.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87881.1| unnamed protein product [Paramecium tetraurelia]
Length=212

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWE+RY ++P P+DWYQ +  +  L++    P  ++L +G GNS  SE M D+GY
Sbjct  4    YGKAEYWEERYTRDPEPFDWYQRFAGIKDLVQGCFTPESKILNIGAGNSRLSEEMFDEGY  63



>ref|XP_001426247.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK58849.1| unnamed protein product [Paramecium tetraurelia]
Length=228

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWE+RY++   P++WYQ Y +L  ++  Y++ + R+L +GCGNS   E M  +GY
Sbjct  14   YGKLEYWERRYSENDKPFEWYQNYDNLKDIVTQYINQNSRILNIGCGNSNIPEDMYKEGY  73



>ref|XP_002781668.1| methylase, putative [Perkinsus marinus ATCC 50983]
 gb|EER13463.1| methylase, putative [Perkinsus marinus ATCC 50983]
Length=208

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YW++RY ++P P+DWYQ +  L  +++ YV P  ++L VG GNS  SE M ++GY
Sbjct  4    YGRSEYWDERYTRDPEPFDWYQRWAGLKDVVQEYVKPEDKILNVGAGNSKLSEEMYEEGY  63



>ref|XP_001022399.2| hypothetical protein TTHERM_00558360 [Tetrahymena thermophila]
 gb|EAS02154.2| kinase domain protein [Tetrahymena thermophila SB210]
Length=212

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG+  YWE+RYA+EP P+DWYQ +  +   +  +++P  ++L VG G+S  SE M D+G+
Sbjct  4    YGNPQYWEERYAKEPEPFDWYQRFSGIRDHVIPHINPESKILNVGSGSSRLSEEMFDEGH  63



>ref|XP_002469246.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED85548.1| predicted protein [Postia placenta Mad-698-R]
Length=205

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY++EP    +DW+++Y  +A ++R L      R+L++GCGNS  SE M D
Sbjct  12   YGSKEYWDQRYSKEPSGASFDWFKSYADVADIIRELIPDKASRILMLGCGNSTLSEDMYD  71

Query  341  DGY  349
            DGY
Sbjct  72   DGY  74



>ref|XP_004040127.1| protein kinase domain protein [Ichthyophthirius multifiliis]
 gb|EGR34823.1| protein kinase domain protein [Ichthyophthirius multifiliis]
Length=214

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWE+RY ++P P+DWYQ +  +   +  Y+    R+L VG GNS  SE + D+GY
Sbjct  4    YGKADYWEERYTRDPEPFDWYQRFQGIKQFIVPYLTAESRILNVGAGNSRLSEELFDEGY  63

Query  350  A  352
             
Sbjct  64   T  64



>ref|XP_008899110.1| hypothetical protein PPTG_06818 [Phytophthora parasitica INRA-310]
 gb|ETI55646.1| hypothetical protein F443_01692 [Phytophthora parasitica P1569]
 gb|ETK95455.1| hypothetical protein L915_01612 [Phytophthora parasitica]
 gb|ETL48835.1| hypothetical protein L916_01588 [Phytophthora parasitica]
 gb|ETM01895.1| hypothetical protein L917_01557 [Phytophthora parasitica]
 gb|ETM55140.1| hypothetical protein L914_01601 [Phytophthora parasitica]
 gb|ETN15572.1| hypothetical protein PPTG_06818 [Phytophthora parasitica INRA-310]
 gb|ETO84382.1| hypothetical protein F444_01693 [Phytophthora parasitica P1976]
 gb|ETP25455.1| hypothetical protein F441_01659 [Phytophthora parasitica CJ01A1]
 gb|ETP53457.1| hypothetical protein F442_01634 [Phytophthora parasitica P10297]
Length=206

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YW++RY ++   +DWYQ Y  L  LL  YV     +L+ G GNS  SE M++DGY
Sbjct  4    YGKATYWDERYTKDSEQFDWYQRYGGLKELLNQYVKKTDSILMAGAGNSRLSEEMVNDGY  63



>ref|XP_002896114.1| putative methyltransferase, putative [Phytophthora infestans 
T30-4]
 gb|EEY53044.1| putative methyltransferase, putative [Phytophthora infestans 
T30-4]
Length=206

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YW++RY ++   +DWYQ Y  L  LL  YV     +L+ G GNS  SE M++DGY
Sbjct  4    YGKATYWDERYTKDSEQFDWYQRYGGLKELLNQYVKKTDSILMAGAGNSRLSEEMVNDGY  63



>ref|XP_001459460.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK92063.1| unnamed protein product [Paramecium tetraurelia]
Length=228

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWE+RY++   P++WYQ Y +L  ++  Y++ + R+L +GCGNS   E M  +GY
Sbjct  14   YGKLEYWERRYSENDKPFEWYQNYDNLKDIVTQYINHNSRILNIGCGNSNIPEDMYKEGY  73



>ref|XP_007368152.1| S-adenosyl-L-methionine-dependent methyltransferase [Dichomitus 
squalens LYAD-421 SS1]
 gb|EJF59032.1| S-adenosyl-L-methionine-dependent methyltransferase [Dichomitus 
squalens LYAD-421 SS1]
Length=205

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY QE     +DW++TY  +A ++R L  +   R+L++GCGNS  S+ M +
Sbjct  12   YGTKEYWDQRYTQESEETSFDWFKTYDGIADIMRQLIPNKSSRILMLGCGNSTLSQDMYN  71

Query  341  DGY  349
            DGY
Sbjct  72   DGY  74



>gb|EFA78103.1| hypothetical protein PPL_08751 [Polysphondylium pallidum PN500]
Length=224

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
              YG+K YW+ RY      +DWYQ Y+ L       ++   ++L+VGCGNS  SE M  D
Sbjct  2    TKYGEKTYWDSRYKNNTDSFDWYQDYNGLRDTFSSNINKDGKILMVGCGNSLLSEEMNKD  61

Query  344  GYA  352
            GY 
Sbjct  62   GYK  64



>gb|EAR85248.3| methyltransferase domain protein [Tetrahymena thermophila SB210]
Length=255

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWEKRY     P+DWYQ Y  +  ++  Y++   R+L VGCG+S  SE M  +GY
Sbjct  18   YGKIEYWEKRYQTNTKPFDWYQNYDGVKDIITQYINKSTRILNVGCGSSLLSEEMYFEGY  77

Query  350  A  352
             
Sbjct  78   K  78



>ref|XP_009527601.1| hypothetical protein PHYSODRAFT_559298 [Phytophthora sojae]
 gb|EGZ18543.1| hypothetical protein PHYSODRAFT_559298 [Phytophthora sojae]
Length=206

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YW++RY ++   +DWYQ Y  L  LL  YV     +L+ G GNS  SE M++DGY
Sbjct  4    YGKASYWDERYTKDSEQFDWYQRYGGLKELLNQYVKKTDAILMAGAGNSRLSEEMVNDGY  63



>ref|XP_011091776.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Sesamum 
indicum]
Length=234

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAF  322
            YGD  YW+ RY QE     +DWYQ Y +L P +R Y+ P  RVL+VGCGN+A 
Sbjct  13   YGDALYWDARYIQEANCGSFDWYQRYSALRPFIRKYISPSSRVLMVGCGNAAI  65



>gb|EMD39276.1| hypothetical protein CERSUDRAFT_64140 [Ceriporiopsis subvermispora 
B]
Length=206

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY QE     +DW+++Y  +A +LR L  + + R+L++GCGNS  SE M D
Sbjct  12   YGTKEYWDQRYNQESDDSSFDWFKSYGEVADILRDLIPNKNARILMLGCGNSKLSEEMYD  71

Query  341  DGYA  352
            DGY 
Sbjct  72   DGYK  75



>gb|KDQ61339.1| hypothetical protein JAAARDRAFT_54716 [Jaapia argillacea MUCL 
33604]
Length=207

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY QE   V +DW+++Y  +A ++R L      R+L++GCGNS  SE M +
Sbjct  14   YGTKDYWDRRYQQESEGVSFDWFKSYKDIAEMIRELIPSKSARILMLGCGNSKLSEDMYE  73

Query  341  DGY  349
            DGY
Sbjct  74   DGY  76



>ref|XP_003885020.1| hypothetical protein NCLIV_054190 [Neospora caninum Liverpool]
 emb|CBZ54992.1| hypothetical protein NCLIV_054190 [Neospora caninum Liverpool]
Length=224

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEPVPYDWYQTYHSLAP-LLRLYVHPHHRVLVVGCGNSAFSEGMID  340
             AYG   YW++RY ++  P+DW+Q Y  L P LL   + P  R+LV+GCG S  SE M  
Sbjct  2    TAYGKVDYWDERYRRDVEPFDWFQRYAGLKPILLEAGLEPSSRILVLGCGTSRVSEEMYA  61

Query  341  DGY  349
            DGY
Sbjct  62   DGY  64



>gb|KIP02687.1| hypothetical protein PHLGIDRAFT_32105 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=208

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW+KRY  E     +DW++ Y  +A L+R L      R+L++GCGNS  SE M D
Sbjct  12   YGTKQYWDKRYTLESDDSTFDWFKKYEDIADLIRELIPDKSARILMLGCGNSTLSEDMYD  71

Query  341  DGYA  352
            DGY 
Sbjct  72   DGYK  75



>gb|EMT03115.1| Methyltransferase-like protein 13 [Aegilops tauschii]
Length=331

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 9/69 (13%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVP---------YDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAF  322
            +G   YWE RY+              +DWYQ+Y +L PLLR  V    RVL++GCGNS  
Sbjct  11   FGAAAYWEARYSSPSTGGKGGGGGGFFDWYQSYSALRPLLRACVPTSSRVLMLGCGNSLL  70

Query  323  SEGMIDDGY  349
            SE M+ DGY
Sbjct  71   SEDMVKDGY  79



>ref|XP_008783273.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Phoenix 
dactylifera]
Length=251

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP-VPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            YGD  YW+ RY +E    +DWYQ Y +L P +R +V    RVL+VGCGN   +E M+ DG
Sbjct  13   YGDALYWDARYVEEGGASFDWYQRYSALRPFVRKFVPTSSRVLMVGCGN---AEDMVKDG  69

Query  347  YAdvxnvdsssvvIE  391
            Y D+ N+D SSVVIE
Sbjct  70   YVDIMNIDISSVVIE  84



>ref|XP_007327517.1| hypothetical protein AGABI1DRAFT_126009 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM81644.1| hypothetical protein AGABI1DRAFT_126009 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=165

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLL-RLYVHPHHRVLVVGCGNSAFSEGMI  337
            AYG K YW++RY+QE     +DW+++Y  LA +L  L  +   R+L++GCGNS  SE M 
Sbjct  12   AYGAKEYWDQRYSQETENSDFDWFKSYKDLAEILHELIPNRMSRILMLGCGNSKLSEDMW  71

Query  338  DDGY  349
            +DGY
Sbjct  72   EDGY  75



>ref|XP_004962183.1| PREDICTED: methyltransferase-like protein 13-like [Setaria italica]
Length=258

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 10/70 (14%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVP----------YDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSA  319
            YG   YW+ RY+               +DWYQTY +L PLLR  +    RVL++GCGNS 
Sbjct  11   YGAAAYWDARYSSSSAGSPASGGGGEFFDWYQTYSALRPLLRACLPASSRVLMLGCGNSL  70

Query  320  FSEGMIDDGY  349
             SEGM  DGY
Sbjct  71   LSEGMAKDGY  80



>ref|XP_001032911.2| Protein kinase domain containing protein [Tetrahymena thermophila]
Length=240

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWEKRY     P+DWYQ Y  +  ++  Y++   R+L VGCG+S  SE M  +GY
Sbjct  18   YGKIEYWEKRYQTNTKPFDWYQNYDGVKDIITQYINKSTRILNVGCGSSLLSEEMYFEGY  77

Query  350  A  352
             
Sbjct  78   K  78



>ref|XP_006461775.1| hypothetical protein AGABI2DRAFT_118628 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV46449.1| hypothetical protein AGABI2DRAFT_118628 [Agaricus bisporus var. 
bisporus H97]
Length=185

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLL-RLYVHPHHRVLVVGCGNSAFSEGMI  337
            AYG K YW++RY+QE     +DW+++Y  LA +L  L  +   R+L++GCGNS  SE M 
Sbjct  12   AYGAKEYWDQRYSQETENSDFDWFKSYKDLAEILHELIPNRMSRILMLGCGNSKLSEDMW  71

Query  338  DDGY  349
            +DGY
Sbjct  72   EDGY  75



>ref|XP_001022873.1| hypothetical protein TTHERM_00578720 [Tetrahymena thermophila]
 gb|EAS02628.1| kinase domain protein [Tetrahymena thermophila SB210]
Length=215

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YWE+RY ++P P+DWYQ +  +   +  ++ P  ++L +G GNS  SE M D+GY
Sbjct  4    YGKIDYWEERYTRDPEPFDWYQRFSGVKQFIVPHLIPESKILNIGAGNSRMSEEMFDEGY  63



>ref|XP_003390871.1| PREDICTED: methyltransferase-like protein 13 [Amphimedon queenslandica]
Length=724

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  KWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            K YWEK + +   P++WY  Y  L  +L  Y+ P +R+LVVGCGNS  SE + D G+
Sbjct  16   KDYWEKFFQKRKAPFEWYGEYLDLCHILHKYIKPSNRILVVGCGNSKLSEDLYDVGF  72



>gb|EPT02985.1| hypothetical protein FOMPIDRAFT_1022607 [Fomitopsis pinicola 
FP-58527 SS1]
Length=207

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY QE     +DW+++Y  +A +LR  +   + ++L++GCGNS  SE M D
Sbjct  13   YGTKEYWDQRYTQESEEESFDWFKSYKDVADILRALIPDKNAKILMLGCGNSKLSEEMYD  72

Query  341  DGY  349
            DGY
Sbjct  73   DGY  75



>emb|CCI45672.1| unnamed protein product [Albugo candida]
Length=207

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YW++RY ++   +DWYQ Y  L  LL  YV     +L+ G GNS  SE M++DGY
Sbjct  4    YGKASYWDERYEKDAEQFDWYQRYGGLKDLLTQYVKKTDAILMAGAGNSRLSEEMVNDGY  63



>dbj|GAM24960.1| hypothetical protein SAMD00019534_081350 [Acytostelium subglobosum 
LB1]
Length=208

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYVHPHH-RVLVVGCGNSAFSEGMIDD  343
            YG K YWE+RY QE    YDW +TY  L P     +      +L++GCGNS+ SE M DD
Sbjct  14   YGTKDYWEQRYQQEATTTYDWLKTYKDLKPFFETCLGDRSASMLMLGCGNSSISEDMYDD  73

Query  344  GY  349
            GY
Sbjct  74   GY  75



>ref|XP_005241283.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Falco 
peregrinus]
Length=536

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            +G   YWE+ + Q    P++WY  +  L P+L+ YV P  +VLVVGCGNS  SE M D G
Sbjct  11   FGSARYWERFFRQRGKRPFEWYGAFPELCPILQKYVRPRDKVLVVGCGNSELSEQMYDMG  70



>ref|XP_004337328.1| catalytic, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR15315.1| catalytic, putative [Acanthamoeba castellanii str. Neff]
Length=202

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +2

Query  167  AYGD-KWYWEKRYAQEPVPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            AYG  + YW+KRY ++   +DWYQ Y +L  +L  +      R+L+VGCGNS  SE M++
Sbjct  5    AYGKGREYWDKRYKKDEEQFDWYQRYDTLKHILEEVTPKSMDRILMVGCGNSRMSEHMVE  64

Query  341  DGYA  352
            DGYA
Sbjct  65   DGYA  68



>ref|XP_009043014.1| hypothetical protein AURANDRAFT_35393 [Aureococcus anophagefferens]
 gb|EGB02288.1| hypothetical protein AURANDRAFT_35393 [Aureococcus anophagefferens]
Length=221

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDD  343
            V YG   YW++RY ++P  +DWY  +  LA +++ +V  +   +V+GCGNS     MIDD
Sbjct  12   VQYGKTQYWDERYTEDPAQFDWYLRWAGLAVVVQKHVRKNVDTIVLGCGNSRMGADMIDD  71

Query  344  GY  349
            GY
Sbjct  72   GY  73



>ref|XP_006438923.1| hypothetical protein CICLE_v10032531mg [Citrus clementina]
 ref|XP_006482949.1| PREDICTED: methyltransferase-like protein 13-like isoform X4 
[Citrus sinensis]
 gb|ESR52163.1| hypothetical protein CICLE_v10032531mg [Citrus clementina]
Length=214

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNS  316
            YGD  YW  RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+
Sbjct  13   YGDALYWNARYVQEGGSFDWYQRYSALRPFVRKYIPTSSRVLMVGCGNA  61



>ref|XP_007865319.1| S-adenosyl-L-methionine-dependent methyltransferase [Gloeophyllum 
trabeum ATCC 11539]
 gb|EPQ56615.1| S-adenosyl-L-methionine-dependent methyltransferase [Gloeophyllum 
trabeum ATCC 11539]
Length=207

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW+KRY +E     +DW+++Y  +A + R L      R+L++GCGNS  SE M D
Sbjct  13   YGTKEYWDKRYEKESDGTTFDWFKSYDDVADMFRELIPDKASRILMLGCGNSRLSEQMYD  72

Query  341  DGYA  352
            DGY 
Sbjct  73   DGYK  76



>ref|XP_007320856.1| hypothetical protein SERLADRAFT_472997 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO22318.1| hypothetical protein SERLADRAFT_472997 [Serpula lacrymans var. 
lacrymans S7.9]
Length=140

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQ--EPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGM  334
            + YG K YW+ RY+Q  +   +DW+++Y  +A L+R YV     ++L++GCGNS+ SE M
Sbjct  8    IEYGTKEYWDHRYSQHSDSATFDWFKSYAEVAHLIREYVPDKSSKILMLGCGNSSLSEDM  67

Query  335  IDDGY  349
              DGY
Sbjct  68   WQDGY  72



>ref|XP_009034759.1| hypothetical protein AURANDRAFT_5839, partial [Aureococcus anophagefferens]
 gb|EGB10134.1| hypothetical protein AURANDRAFT_5839, partial [Aureococcus anophagefferens]
Length=171

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  173  GDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGYA  352
            G   YW++RY ++P P+DWYQ Y  +       +     +L+ GCGNS  SE M +DGYA
Sbjct  1    GKTSYWDERYTKDPEPFDWYQRYSGIQARRGAGMERDDSILMAGCGNSRLSEDMFEDGYA  60



>ref|XP_001874602.1| S-adenosylmethionine-dependent methyltransferase, truncated [Laccaria 
bicolor S238N-H82]
 gb|EDR14043.1| S-adenosylmethionine-dependent methyltransferase, truncated, 
partial [Laccaria bicolor S238N-H82]
Length=120

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLL-RLYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW++RY+QE V   +DW+++Y  LA ++  L      ++L++GCGNS  SE M +
Sbjct  8    YGTKSYWDQRYSQESVEDSFDWFKSYSDLADIIHELIPDKSSKILMLGCGNSKLSEDMWE  67

Query  341  DGY  349
            DGY
Sbjct  68   DGY  70



>gb|KDO83292.1| hypothetical protein CISIN_1g025475mg [Citrus sinensis]
Length=214

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNS  316
            YGD  YW  RY QE   +DWYQ Y +L P +R Y+    RVL+VGCGN+
Sbjct  13   YGDALYWNARYVQEGGSFDWYQRYSALRPFVRKYIPTSSRVLMVGCGNA  61



>ref|XP_005435908.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Falco 
cherrug]
Length=536

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            +G   YWE+ + Q    P++WY  +  L P+L+ YV P  +VLVVGCGNS  SE M D G
Sbjct  11   FGSARYWERFFRQRGKRPFEWYGAFPELCPVLQKYVRPRDKVLVVGCGNSELSEQMYDMG  70



>ref|XP_011469517.1| PREDICTED: uncharacterized protein LOC101299615 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=244

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE    +DWYQ Y +L P +R ++      VLVVGCGN+  SE M  D
Sbjct  13   YGDANYWDARYVQEGDSLFDWYQRYSALRPFIRNFIPDTSSPVLVVGCGNAVMSEDMAKD  72

Query  344  GY  349
            GY
Sbjct  73   GY  74



>gb|KFP01687.1| Methyltransferase-like 13, partial [Calypte anna]
Length=679

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            +G   YW++ + Q    P++WY  +  L PLLR Y+ P  +VLVVGCGNS  SE M D G
Sbjct  4    FGSARYWDRFFRQRGSCPFEWYGAFPELCPLLRKYLRPRDKVLVVGCGNSELSEQMYDTG  63

Query  347  YA  352
              
Sbjct  64   MC  65



>dbj|BAJ88363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=258

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 8/68 (12%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVP--------YDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFS  325
            +G   YW+ RY+             +DWYQ+Y +L PLLR  V    RVL++GCGNS  S
Sbjct  11   FGAAAYWDARYSSPSTGGKGGVGGFFDWYQSYPALRPLLRACVPASSRVLMLGCGNSLLS  70

Query  326  EGMIDDGY  349
            E M+ DGY
Sbjct  71   EDMVKDGY  78



>ref|XP_004307241.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=252

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMIDD  343
            YGD  YW+ RY QE    +DWYQ Y +L P +R ++      VLVVGCGN+  SE M  D
Sbjct  13   YGDANYWDARYVQEGDSLFDWYQRYSALRPFIRNFIPDTSSPVLVVGCGNAVMSEDMAKD  72

Query  344  GY  349
            GY
Sbjct  73   GY  74



>ref|XP_007415069.1| hypothetical protein MELLADRAFT_30587 [Melampsora larici-populina 
98AG31]
 gb|EGG01724.1| hypothetical protein MELLADRAFT_30587 [Melampsora larici-populina 
98AG31]
Length=119

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPVP--YDWYQTYHSLAPLLRLYVH-PHHRVLVVGCGNSAFSEGMI  337
            +YG   YW++RY+QEP    +DW+Q+Y  L+ L++ +V  P  ++ V+GCGNS  S+ M 
Sbjct  3    SYGSAAYWDERYSQEPAGSHFDWFQSYSELSDLIQQHVPLPEAKICVLGCGNSTLSQDMY  62

Query  338  DDGY  349
            + GY
Sbjct  63   EAGY  66



>gb|KIJ61960.1| hypothetical protein HYDPIDRAFT_115096 [Hydnomerulius pinastri 
MD-312]
Length=211

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEP--VPYDWYQTYHSLAPLLR-LYVHPHHRVLVVGCGNSAFSEGMID  340
            YG K YW+ RY+QE     +DW+++Y  LA  LR L    + ++L++GCGNS FSE M +
Sbjct  9    YGTKDYWDSRYSQEAPDSSFDWFKSYGDLASQLRELIPDKNAKILMLGCGNSKFSEDMWE  68

Query  341  DGY  349
            DGY
Sbjct  69   DGY  71



>gb|EGN96704.1| hypothetical protein SERLA73DRAFT_75577 [Serpula lacrymans var. 
lacrymans S7.3]
Length=155

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  164  VAYGDKWYWEKRYAQ--EPVPYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGM  334
            + YG K YW+ RY+Q  +   +DW+++Y  +A L+R YV     ++L++GCGNS+ SE M
Sbjct  8    IEYGTKEYWDHRYSQHSDSATFDWFKSYAEVAHLIREYVPDKSSKILMLGCGNSSLSEDM  67

Query  335  IDDGY  349
              DGY
Sbjct  68   WQDGY  72



>ref|XP_002972255.1| hypothetical protein SELMODRAFT_97591 [Selaginella moellendorffii]
 gb|EFJ26341.1| hypothetical protein SELMODRAFT_97591 [Selaginella moellendorffii]
Length=228

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            Y D  YW+KRY  E    +DWYQ +  L PLL  Y+    R+L+ GCGN+  SE M+ +G
Sbjct  7    YDDIQYWDKRYLDEGDDTFDWYQRFKELKPLLCRYIKKDSRILMAGCGNAVLSEEMVLNG  66

Query  347  Y  349
            +
Sbjct  67   F  67



>gb|KDQ18894.1| hypothetical protein BOTBODRAFT_63062 [Botryobasidium botryosum 
FD-172 SS1]
Length=207

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +2

Query  167  AYGDKWYWEKRYAQEPV--PYDWYQTYHSLAPLLRLYV-HPHHRVLVVGCGNSAFSEGMI  337
            +YG K YW++RY +E V   +DW+++Y+ +A L+   +     R+L++GCGNS  SE M 
Sbjct  10   SYGIKEYWDERYRKEAVDASFDWFKSYNQIASLIAKRIPDKSSRILMLGCGNSTLSEEMW  69

Query  338  DDGY  349
            DDGY
Sbjct  70   DDGY  73



>emb|CCA16443.1| putative methyltransferase [Albugo laibachii Nc14]
Length=207

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDGY  349
            YG   YW++RY ++   +DWYQ Y  L   L  YV     +L+ G GNS  SE M++DGY
Sbjct  4    YGKASYWDERYEKDAEQFDWYQRYGGLKDFLTQYVKKTDAILMAGAGNSRLSEEMVNDGY  63



>ref|XP_005147146.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Melopsittacus 
undulatus]
Length=538

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  170  YGDKWYWEKRYAQE-PVPYDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFSEGMIDDG  346
            +G   YW++ + Q    P++WY  +  L PLLR YV P  +VLVVGCGNS  SE M D G
Sbjct  11   FGSARYWDRFFQQRGQRPFEWYGAFPELCPLLRKYVRPRDKVLVVGCGNSELSEQMYDVG  70



>ref|NP_001151561.1| LOC100285195 [Zea mays]
 gb|ACG43336.1| methylase [Zea mays]
Length=258

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 38/68 (56%), Gaps = 8/68 (12%)
 Frame = +2

Query  170  YGDKWYWEKRYAQEPVP--------YDWYQTYHSLAPLLRLYVHPHHRVLVVGCGNSAFS  325
            YG   YW+ RY+             +DWYQTY +L PLLR  V    RVL++GCGNS  S
Sbjct  11   YGAAAYWDARYSSGSPASAAAGCGFFDWYQTYPALRPLLRARVPTSSRVLMLGCGNSLLS  70

Query  326  EGMIDDGY  349
            E M  DGY
Sbjct  71   EDMAKDGY  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556972490900