BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013J02

Length=486
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592136.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  66.6    1e-09   
emb|CDP07116.1|  unnamed protein product                              66.2    2e-09   Coffea canephora [robusta coffee]
gb|AAO24774.1|  GCPE protein                                          65.9    2e-09   Catharanthus roseus [chatas]
ref|XP_002530286.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  64.7    4e-09   
gb|KDP44060.1|  hypothetical protein JCGZ_05527                       63.9    8e-09   Jatropha curcas
ref|XP_006378965.1|  hypothetical protein POPTR_0009s01900g           63.5    1e-08   
ref|XP_006378969.1|  hypothetical protein POPTR_0009s01900g           63.5    1e-08   
ref|XP_011044361.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  63.5    1e-08   Populus euphratica
ref|XP_006378966.1|  hypothetical protein POPTR_0009s01900g           63.5    1e-08   
gb|AFQ98370.1|  hydroxymethylbutenyl diphosphate synthase             63.5    1e-08   Camellia sinensis [black tea]
dbj|BAF98296.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...  63.5    1e-08   Hevea brasiliensis [jebe]
ref|XP_006378968.1|  hypothetical protein POPTR_0009s01900g           63.5    1e-08   
ref|XP_010043743.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  63.2    1e-08   Eucalyptus grandis [rose gum]
ref|NP_001234648.1|  GcpE                                             62.8    2e-08   Solanum lycopersicum
ref|XP_006384896.1|  hypothetical protein POPTR_0004s22010g           62.0    3e-08   
ref|XP_007016723.1|  4-hydroxy-3-methylbut-2-enyl diphosphate syn...  62.0    4e-08   
gb|ABG75916.2|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...  61.6    4e-08   Stevia rebaudiana
gb|ADX06907.1|  1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate sy...  61.2    6e-08   Rauvolfia verticillata
gb|AJA39985.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...  61.2    6e-08   Salvia miltiorrhiza f. alba
gb|AEZ55668.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     61.2    6e-08   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006340201.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  60.8    9e-08   Solanum tuberosum [potatoes]
ref|NP_001289212.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  60.8    9e-08   Pyrus x bretschneideri [bai li]
ref|XP_004295028.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  60.5    1e-07   Fragaria vesca subsp. vesca
ref|XP_009367086.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  60.1    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_008349746.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  59.7    2e-07   
ref|XP_008225843.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  59.7    2e-07   Prunus mume [ume]
ref|XP_009335082.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  59.7    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_008225831.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  58.9    3e-07   Prunus mume [ume]
ref|XP_010253662.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  58.5    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008359197.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  58.5    5e-07   
ref|XP_010098198.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  58.2    7e-07   
ref|XP_011089897.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  57.4    1e-06   Sesamum indicum [beniseed]
ref|XP_003597228.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  55.8    4e-06   
ref|XP_006488105.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  55.8    4e-06   
gb|KDO73255.1|  hypothetical protein CISIN_1g0046342mg                55.5    4e-06   Citrus sinensis [apfelsine]
gb|AES67479.2|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     55.5    4e-06   Medicago truncatula
gb|KDO73247.1|  hypothetical protein CISIN_1g0046342mg                55.5    4e-06   Citrus sinensis [apfelsine]
ref|XP_006424584.1|  hypothetical protein CICLE_v10027881mg           55.5    5e-06   
gb|AHA11129.1|  chloroplast 4-hydroxy-3-methylbut-2-enyl diphosph...  55.5    5e-06   Picrorhiza kurrooa
gb|KJB26176.1|  hypothetical protein B456_004G228600                  55.1    5e-06   Gossypium raimondii
gb|KJB26175.1|  hypothetical protein B456_004G228600                  55.1    5e-06   Gossypium raimondii
ref|XP_006424585.1|  hypothetical protein CICLE_v10027881mg           55.1    6e-06   Citrus clementina [clementine]
gb|KHG03611.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  55.1    7e-06   Gossypium arboreum [tree cotton]
gb|AGQ04156.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     54.7    9e-06   Lavandula angustifolia [lavender]
ref|XP_004487119.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  54.3    1e-05   
ref|XP_004487120.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  54.3    1e-05   
gb|EYU36193.1|  hypothetical protein MIMGU_mgv1a001893mg              54.3    1e-05   Erythranthe guttata [common monkey flower]
gb|EYU36192.1|  hypothetical protein MIMGU_mgv1a001893mg              54.3    1e-05   Erythranthe guttata [common monkey flower]
gb|AID51432.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...  53.9    1e-05   Astragalus membranaceus
gb|KHN11204.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  52.8    4e-05   Glycine soja [wild soybean]
ref|XP_003540178.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  52.0    5e-05   Glycine max [soybeans]
emb|CAN72185.1|  hypothetical protein VITISV_005654                   51.6    8e-05   Vitis vinifera
ref|XP_002285130.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  51.6    9e-05   Vitis vinifera
ref|XP_007150210.1|  hypothetical protein PHAVU_005G135800g           50.8    1e-04   Phaseolus vulgaris [French bean]
gb|KHN21521.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  50.4    2e-04   Glycine soja [wild soybean]
ref|XP_003543457.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...  50.4    2e-04   Glycine max [soybeans]



>ref|XP_009592136.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009592137.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
Length=740

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MA GAVP SF GLK RENG+GF K++DFVRVSD+QRVK R
Sbjct  1    MAAGAVPTSFTGLKSRENGVGFAKSLDFVRVSDLQRVKFR  40



>emb|CDP07116.1| unnamed protein product [Coffea canephora]
Length=731

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MATGAVP SF GLK RENGLGF K+M+FVRVS+ QRVK R
Sbjct  1    MATGAVPASFTGLKSRENGLGFAKSMEFVRVSNTQRVKFR  40



>gb|AAO24774.1| GCPE protein [Catharanthus roseus]
Length=740

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MATG VP SF GLK RENGLGF K+MDFV+VSD++RVK R
Sbjct  1    MATGTVPASFTGLKSRENGLGFAKSMDFVQVSDLRRVKFR  40



>ref|XP_002530286.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
 gb|EEF32093.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
Length=716

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF GLK RE+ LGFGK+MDFVR+ D++R+KS
Sbjct  1    MATGAVPTSFTGLKTRESNLGFGKSMDFVRICDLKRIKS  39



>gb|KDP44060.1| hypothetical protein JCGZ_05527 [Jatropha curcas]
Length=740

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG VP SF GLK RE+ LGFGK+MDFVRV D++R+KS
Sbjct  1    MATGTVPASFTGLKARESSLGFGKSMDFVRVCDLKRIKS  39



>ref|XP_006378965.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56762.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=678

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKS  39



>ref|XP_006378969.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56766.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=708

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKS  39



>ref|XP_011044361.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
 ref|XP_011044362.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
Length=740

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKS  39



>ref|XP_006378966.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378967.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_002314268.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378970.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56763.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56764.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|EEE88223.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56767.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=741

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKS  39



>gb|AFQ98370.1| hydroxymethylbutenyl diphosphate synthase [Camellia sinensis]
Length=741

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MATGAVP SF GLK R++GLGF K+MDFV+V D+QRVK R
Sbjct  1    MATGAVPASFTGLKSRDHGLGFVKSMDFVKVCDLQRVKFR  40



>dbj|BAF98296.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hevea brasiliensis]
Length=740

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF GLK R++ LGFGK+MDFVRV D++R+KS
Sbjct  1    MATGAVPASFTGLKTRDSSLGFGKSMDFVRVCDLKRIKS  39



>ref|XP_006378968.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56765.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=705

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKS  39



>ref|XP_010043743.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85733.1| hypothetical protein EUGRSUZ_B02495 [Eucalyptus grandis]
Length=740

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MA+GAVP SF+GLK R++GLGF K+MDFVR+SD QRV+S 
Sbjct  3    MASGAVPASFSGLKSRDSGLGFVKSMDFVRISDQQRVRSH  42



>ref|NP_001234648.1| GcpE [Solanum lycopersicum]
 ref|XP_010313199.1| PREDICTED: gcpE isoform X1 [Solanum lycopersicum]
 gb|AAO15447.1|AF435086_1 GcpE [Solanum lycopersicum]
Length=740

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MA G VP SF GLK  ENGLGF K+M+F+RVSD+QRVK R
Sbjct  1    MAAGTVPASFTGLKSNENGLGFAKSMNFIRVSDLQRVKFR  40



>ref|XP_006384896.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
 gb|ERP62693.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
Length=760

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF+GLK RE+ LGFGK++DFVR+ D++R+KS
Sbjct  1    MATGAVPASFSGLKMRESSLGFGKSVDFVRICDIKRIKS  39



>ref|XP_007016723.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007016724.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34342.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34343.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
Length=740

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF+GLK R++ LGF K+MDFVRV D++R+KS
Sbjct  1    MATGAVPASFSGLKHRDSSLGFAKSMDFVRVCDLKRIKS  39



>gb|ABG75916.2| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Stevia 
rebaudiana]
Length=740

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVK  479
            MATGA P SF  LKGRENGLGF K  DFV+VSD++RVK
Sbjct  1    MATGAAPTSFMSLKGRENGLGFAKTSDFVKVSDLKRVK  38



>gb|ADX06907.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Rauvolfia 
verticillata]
Length=740

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVK  479
            MATG VP SF GLK  ENGLGF K++DFVRVSD++RVK
Sbjct  1    MATGTVPASFTGLKSGENGLGFAKSIDFVRVSDLRRVK  38



>gb|AJA39985.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia 
miltiorrhiza f. alba]
Length=742

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGREN-GLGFGKNMDFVRVSDMQRVK  479
            MATGAVP SF GLK R++ GLGFGK+ DFVRVSD+QRVK
Sbjct  1    MATGAVPASFTGLKSRDHRGLGFGKSSDFVRVSDLQRVK  39



>gb|AEZ55668.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia miltiorrhiza]
Length=742

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGREN-GLGFGKNMDFVRVSDMQRVK  479
            MATGAVP SF GLK R++ GLGFGK+ DFVRVSD+QRVK
Sbjct  1    MATGAVPASFTGLKSRDHRGLGFGKSSDFVRVSDLQRVK  39



>ref|XP_006340201.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Solanum tuberosum]
Length=740

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MA GAVP SF GLK  EN LGF K+M+FVRVSD+QRVK R
Sbjct  1    MAAGAVPASFTGLKSNENVLGFTKSMNFVRVSDLQRVKFR  40



>ref|NP_001289212.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, chloroplastic 
[Pyrus x bretschneideri]
 gb|AHM26645.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase protein 
[Pyrus x bretschneideri]
Length=740

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF GLK R++  GF K+MDFVRVSD++R KS
Sbjct  1    MATGAVPASFTGLKSRDSSFGFAKSMDFVRVSDLKRFKS  39



>ref|XP_004295028.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
 ref|XP_011461710.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=740

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF GL GRE  LGF K++DFVRVSD++R KS
Sbjct  1    MATGAVPASFTGLTGRETTLGFTKSVDFVRVSDLKRFKS  39



>ref|XP_009367086.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367087.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367088.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
Length=740

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF GLK R++  GF K+MDFVRVSD++R KS
Sbjct  1    MATGAVPASFTGLKSRDSSFGFAKSMDFVRVSDLKRFKS  39



>ref|XP_008349746.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
 ref|XP_008349747.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF GLKG ++  GF K+MDFVRVSD++R KS
Sbjct  1    MATGAVPASFTGLKGXDSSFGFAKSMDFVRVSDLKRFKS  39



>ref|XP_008225843.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Prunus mume]
Length=749

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG VP SF GLKGR++ +GF K+MDFVRV D++R KS
Sbjct  1    MATGTVPASFMGLKGRDSSIGFAKSMDFVRVCDLKRFKS  39



>ref|XP_009335082.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009335083.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=740

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF G KGR++  GF K+MDFVRVSD++R KS
Sbjct  1    MATGAVPASFTGPKGRDSSFGFAKSMDFVRVSDLKRFKS  39



>ref|XP_008225831.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Prunus mume]
Length=616

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG VP SF GLKGR++ +GF K+MDFVRV D++R KS
Sbjct  1    MATGTVPASFMGLKGRDSSIGFAKSMDFVRVCDLKRFKS  39



>ref|XP_010253662.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
 ref|XP_010253663.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
Length=740

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR  485
            MATG+VP SF+G K R+ GL F K++DFV+VSD+QRVKSR
Sbjct  1    MATGSVPASFSGPKIRDYGLSFTKSVDFVKVSDLQRVKSR  40



>ref|XP_008359197.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGAVP SF GLK R++  GF K+MDF RVSD++R KS
Sbjct  1    MATGAVPASFTGLKSRDSSFGFAKSMDFARVSDLKRFKS  39



>ref|XP_010098198.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
 gb|EXB74654.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
Length=978

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVK  479
            MA G VP +F+GLK R++GLGF K++DFV+VSD++RVK
Sbjct  239  MAAGTVPAAFSGLKSRDSGLGFAKSLDFVKVSDLKRVK  276



>ref|XP_011089897.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089899.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089900.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
Length=742

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGREN-GLGFGKNMDFVRVSDMQRVKSR  485
            MATGAVP SF GLK R++ G+ F K+ DFVRVSD+QRVK R
Sbjct  1    MATGAVPASFTGLKSRDHQGISFAKSSDFVRVSDLQRVKFR  41



>ref|XP_003597228.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Medicago 
truncatula]
Length=767

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            M  G VP SF+ L+  ++GLGFGK++DFVRVSD+QR+KS
Sbjct  1    MVAGTVPASFSSLRTCDSGLGFGKSIDFVRVSDLQRMKS  39



>ref|XP_006488105.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006488106.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=751

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKS  39



>gb|KDO73255.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
Length=449

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKS  39



>gb|AES67479.2| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Medicago truncatula]
Length=740

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            M  G VP SF+ L+  ++GLGFGK++DFVRVSD+QR+KS
Sbjct  1    MVAGTVPASFSSLRTCDSGLGFGKSIDFVRVSDLQRMKS  39



>gb|KDO73247.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73248.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73249.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73250.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73251.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73252.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73253.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73254.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
Length=466

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKS  39



>ref|XP_006424584.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37824.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=676

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKS  39



>gb|AHA11129.1| chloroplast 4-hydroxy-3-methylbut-2-enyl diphosphate synthase 
[Picrorhiza kurrooa]
Length=748

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENG-LGFGKNMDFVRVSDMQRVKSR  485
            MATG VP SF GLK R++  LGF K  DFVRVSD+QRVK R
Sbjct  1    MATGTVPSSFTGLKSRDHQRLGFAKTSDFVRVSDLQRVKFR  41



>gb|KJB26176.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=739

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA+GAVP SF GLK ++ GLGF K+ DFVR+ D++R K+
Sbjct  1    MASGAVPASFPGLKSKDPGLGFAKSTDFVRICDLRRTKT  39



>gb|KJB26175.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=740

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA+GAVP SF GLK ++ GLGF K+ DFVR+ D++R K+
Sbjct  1    MASGAVPASFPGLKSKDPGLGFAKSTDFVRICDLRRTKT  39



>ref|XP_006424585.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006424586.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006488107.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Citrus sinensis]
 gb|ESR37825.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37826.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=741

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKS  39



>gb|KHG03611.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Gossypium 
arboreum]
Length=740

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA+GAVP SF GLK ++ GLGF K+ DFVR+ D++R K+
Sbjct  1    MASGAVPASFPGLKSKDPGLGFAKSTDFVRICDLRRTKT  39



>gb|AGQ04156.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Lavandula 
angustifolia]
Length=742

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENG-LGFGKNMDFVRVSDMQRVK  479
            MATGAVP SF GLK R++  LGF K+ DFVRVS++QRVK
Sbjct  1    MATGAVPASFTGLKSRDHPCLGFAKSSDFVRVSNLQRVK  39



>ref|XP_004487119.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Cicer arietinum]
Length=774

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA G VP SF+  + R++GLGFGK++DFVRVSD++R+ S
Sbjct  1    MAAGTVPASFSSFRKRDSGLGFGKSIDFVRVSDLKRMNS  39



>ref|XP_004487120.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=740

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA G VP SF+  + R++GLGFGK++DFVRVSD++R+ S
Sbjct  1    MAAGTVPASFSSFRKRDSGLGFGKSIDFVRVSDLKRMNS  39



>gb|EYU36193.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=742

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRE-NGLGFGKNMDFVRVSDMQRVKSR  485
            MATGAVP SF  LK R+  G+ F K+ DFVRVSD+QR+K R
Sbjct  1    MATGAVPASFTALKSRDLKGISFAKSSDFVRVSDLQRIKFR  41



>gb|EYU36192.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=743

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRE-NGLGFGKNMDFVRVSDMQRVKSR  485
            MATGAVP SF  LK R+  G+ F K+ DFVRVSD+QR+K R
Sbjct  1    MATGAVPASFTALKSRDLKGISFAKSSDFVRVSDLQRIKFR  41



>gb|AID51432.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Astragalus 
membranaceus]
Length=742

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA G VP SF   +  ++GLGFGK++DFVRVSD++R+KS
Sbjct  1    MAAGTVPASFTNFRKCDSGLGFGKSIDFVRVSDLKRIKS  39



>gb|KHN11204.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=741

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA+GAVP +F+ LK  ++ LGF K+MDFVRVSD++ +KS
Sbjct  1    MASGAVPTTFSTLKTWDSSLGFAKSMDFVRVSDLKSMKS  39



>ref|XP_003540178.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006592698.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Glycine max]
 ref|XP_006592699.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Glycine max]
Length=741

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA+GAVP +F+ LK  ++ LGF K+MDFVRVSD++ +KS
Sbjct  1    MASGAVPTTFSTLKTWDSSLGFAKSMDFVRVSDLKSMKS  39



>emb|CAN72185.1| hypothetical protein VITISV_005654 [Vitis vinifera]
Length=740

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRV  476
            MATG+VP SF+GL+  +  LG  K++DFVRVSDMQR+
Sbjct  1    MATGSVPTSFSGLRRMDCNLGSSKSVDFVRVSDMQRI  37



>ref|XP_002285130.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Vitis vinifera]
 emb|CBI16309.3| unnamed protein product [Vitis vinifera]
Length=740

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRV  476
            MATG+VP SF+GL+  +  LG  K++DFVRVSDMQR+
Sbjct  1    MATGSVPTSFSGLRRMDCNLGSSKSVDFVRVSDMQRI  37



>ref|XP_007150210.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
 gb|ESW22204.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
Length=740

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MA+G VP SF+ LK  ++ LGF K++DFVRVSD++ +KS
Sbjct  1    MASGTVPTSFSSLKTWDSNLGFAKSIDFVRVSDLKSMKS  39



>gb|KHN21521.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=742

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  366  MATGA-VPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGA VP +F+ LK  ++ LGF KN+DFVRVSDM+ +KS
Sbjct  1    MATGAAVPTTFSTLKTWDSSLGFAKNIDFVRVSDMKSMKS  40



>ref|XP_003543457.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Glycine max]
Length=742

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  366  MATGA-VPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKS  482
            MATGA VP +F+ LK  ++ LGF KN+DFVRVSDM+ +KS
Sbjct  1    MATGAAVPTTFSTLKTWDSSLGFAKNIDFVRVSDMKSMKS  40



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960