BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013G11

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    125   1e-32   Nicotiana sylvestris
ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    122   4e-31   Nicotiana tomentosiformis
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    119   7e-30   Sesamum indicum [beniseed]
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    117   3e-29   Sesamum indicum [beniseed]
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                109   2e-26   Erythranthe guttata [common monkey flower]
emb|CDP14208.1|  unnamed protein product                                105   8e-25   Coffea canephora [robusta coffee]
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                105   9e-25   Erythranthe guttata [common monkey flower]
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    102   1e-23   Nicotiana tomentosiformis
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    100   6e-23   Vitis vinifera
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...  98.2    3e-22   Nicotiana sylvestris
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...  98.2    4e-22   Solanum lycopersicum
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...  97.4    9e-22   Nicotiana tomentosiformis
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...  97.4    9e-22   Nicotiana sylvestris
gb|KDP26218.1|  hypothetical protein JCGZ_22464                       96.3    3e-21   Jatropha curcas
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...  95.5    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...  95.1    5e-21   Solanum tuberosum [potatoes]
emb|CDY14768.1|  BnaC04g47650D                                        92.0    8e-20   Brassica napus [oilseed rape]
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                91.7    1e-19   Medicago truncatula
gb|AFK42347.1|  unknown                                               91.7    1e-19   Medicago truncatula
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...  90.1    5e-19   Brassica rapa
ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...  90.1    5e-19   Prunus mume [ume]
emb|CDY06925.1|  BnaA04g23900D                                        89.7    6e-19   
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...  87.0    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  86.3    1e-17   
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg           86.3    1e-17   Prunus persica
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...  85.9    2e-17   Solanum lycopersicum
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...  85.5    2e-17   Fragaria vesca subsp. vesca
gb|KJB16379.1|  hypothetical protein B456_002G227200                  85.5    2e-17   Gossypium raimondii
gb|KJB35924.1|  hypothetical protein B456_006G133800                  85.5    3e-17   Gossypium raimondii
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...  85.5    3e-17   
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...  84.3    6e-17   Tarenaya hassleriana [spider flower]
emb|CDY00910.1|  BnaC05g42900D                                        84.3    6e-17   
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  84.3    9e-17   
gb|AGV22098.1|  calmodulin-like protein                               83.2    1e-16   Brassica juncea [brown mustard]
emb|CDY23852.1|  BnaC04g01850D                                        83.2    1e-16   Brassica napus [oilseed rape]
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...  83.2    1e-16   Tarenaya hassleriana [spider flower]
emb|CDY60169.1|  BnaAnng16630D                                        82.0    3e-16   Brassica napus [oilseed rape]
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...  81.6    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002323262.1|  Calmodulin-like family protein                   81.3    6e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...  80.9    9e-16   Solanum tuberosum [potatoes]
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...  81.3    1e-15   Brassica rapa
ref|XP_002308908.1|  Calmodulin-like family protein                   80.1    2e-15   Populus trichocarpa [western balsam poplar]
emb|CDX79938.1|  BnaA05g02180D                                        80.1    2e-15   
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...  80.1    2e-15   Brassica rapa
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg           79.7    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...  79.7    2e-15   Populus euphratica
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...  79.7    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194           79.7    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg           79.3    3e-15   Capsella rubella
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457           79.3    4e-15   Arabidopsis lyrata subsp. lyrata
gb|AAM61257.1|  calmodulin-like protein                               79.0    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                 79.0    5e-15   Citrus sinensis [apfelsine]
ref|NP_181672.1|  putative calcium-binding protein CML35              79.0    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg           78.6    6e-15   Citrus clementina [clementine]
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative         78.2    8e-15   Ricinus communis
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...  78.2    9e-15   Citrus sinensis [apfelsine]
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                 77.8    1e-14   Citrus sinensis [apfelsine]
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...  77.8    1e-14   Solanum tuberosum [potatoes]
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg           77.8    1e-14   Eutrema salsugineum [saltwater cress]
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                  77.0    2e-14   Arabis alpina [alpine rockcress]
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...  77.0    2e-14   Populus euphratica
ref|NP_001265939.1|  Hop-interacting protein THI026                   77.0    3e-14   Solanum lycopersicum
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...  76.6    3e-14   Cicer arietinum [garbanzo]
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...  75.9    4e-14   
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...  76.3    5e-14   
ref|NP_187630.1|  putative calcium-binding protein CML36              75.9    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...  75.5    8e-14   Nelumbo nucifera [Indian lotus]
emb|CAA48190.1|  calmodulin like protein                              75.5    9e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...  74.7    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg           74.7    1e-13   Capsella rubella
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...  74.7    1e-13   Camelina sativa [gold-of-pleasure]
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                  74.3    2e-13   Arabis alpina [alpine rockcress]
ref|XP_010102734.1|  putative calcium-binding protein CML36           73.2    5e-13   
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...  72.8    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg           70.9    3e-12   
emb|CBI30075.3|  unnamed protein product                              70.1    4e-12   Vitis vinifera
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...  70.5    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...  70.1    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...  67.8    3e-11   Glycine max [soybeans]
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...  65.5    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...  65.1    3e-10   Eucalyptus grandis [rose gum]
ref|XP_008800223.1|  PREDICTED: calmodulin-like                       64.7    5e-10   Phoenix dactylifera
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g           64.3    6e-10   Phaseolus vulgaris [French bean]
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...  63.9    8e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...  62.4    3e-09   Phoenix dactylifera
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...  62.4    3e-09   Glycine max [soybeans]
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3             62.0    4e-09   Elaeis guineensis
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...  61.6    5e-09   Elaeis guineensis
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...  60.1    5e-08   
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...  58.2    8e-08   Sesamum indicum [beniseed]
ref|XP_002671503.1|  predicted protein                                56.2    3e-07   Naegleria gruberi strain NEG-M
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...  56.2    4e-07   Malus domestica [apple tree]
ref|XP_009770094.1|  PREDICTED: calmodulin-like                       54.7    7e-07   Nicotiana sylvestris
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...  55.5    8e-07   Eucalyptus grandis [rose gum]
ref|XP_006351748.1|  PREDICTED: calmodulin-5/6/7/8-like               54.7    9e-07   Solanum tuberosum [potatoes]
ref|XP_004230637.1|  PREDICTED: calmodulin-like                       54.3    9e-07   Solanum lycopersicum
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like       54.3    1e-06   Glycine max [soybeans]
gb|KDP21392.1|  hypothetical protein JCGZ_21863                       55.1    1e-06   Jatropha curcas
gb|ERG81872.1|  calmodulin-2                                          53.9    2e-06   
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...  54.7    3e-06   
ref|XP_003556466.1|  PREDICTED: calmodulin-like protein 8-like is...  53.1    3e-06   Glycine max [soybeans]
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...  53.5    3e-06   Cicer arietinum [garbanzo]
gb|KHN04934.1|  Calmodulin-like protein 8                             52.8    3e-06   Glycine soja [wild soybean]
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...  53.5    3e-06   Pyrus x bretschneideri [bai li]
dbj|BAJ85572.1|  predicted protein                                    53.9    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007910199.1|  PREDICTED: calmodulin-A-like                     53.1    4e-06   Callorhinchus milii [Australian ghost shark]
ref|NP_001147205.1|  calmodulin                                       53.9    4e-06   
gb|EMT24894.1|  Putative calcium-binding protein CML22                53.1    4e-06   
ref|XP_006014812.1|  PREDICTED: calmodulin                            53.5    4e-06   
ref|XP_011416014.1|  PREDICTED: calmodulin-A-like isoform X2          52.8    4e-06   
ref|XP_011079925.1|  PREDICTED: calmodulin-like                       52.8    4e-06   Sesamum indicum [beniseed]
ref|XP_011416012.1|  PREDICTED: calmodulin-A-like isoform X1          52.8    4e-06   
ref|XP_003580040.2|  PREDICTED: probable calcium-binding protein ...  54.3    4e-06   
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg           53.1    4e-06   Prunus persica
gb|ACN35459.1|  unknown                                               53.5    5e-06   Zea mays [maize]
gb|ACG37753.1|  calmodulin                                            53.5    5e-06   Zea mays [maize]
gb|EPS63975.1|  hypothetical protein M569_10810                       52.8    5e-06   Genlisea aurea
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...  52.8    5e-06   Prunus mume [ume]
ref|XP_011082591.1|  PREDICTED: calmodulin-like                       52.4    5e-06   Sesamum indicum [beniseed]
ref|XP_009617304.1|  PREDICTED: calmodulin-like                       52.0    7e-06   Nicotiana tomentosiformis
ref|XP_966558.2|  PREDICTED: neo-calmodulin-like                      52.8    8e-06   
ref|XP_002090404.1|  GE12824                                          52.4    9e-06   Drosophila yakuba
gb|EYC14046.1|  hypothetical protein Y032_0042g679                    51.6    9e-06   Ancylostoma ceylanicum
gb|EYC14045.1|  hypothetical protein Y032_0042g679                    51.6    9e-06   Ancylostoma ceylanicum
ref|XP_005483194.1|  PREDICTED: calmodulin                            52.0    1e-05   
ref|XP_002415538.1|  centrin, putative                                51.6    1e-05   Ixodes scapularis [blacklegged tick]
ref|NP_001150915.1|  calmodulin-related protein 2, touch-induced      52.4    1e-05   
ref|XP_002520954.1|  calmodulin, putative                             51.2    1e-05   Ricinus communis
ref|XP_007144825.1|  hypothetical protein PHAVU_007G187200g           51.2    1e-05   Phaseolus vulgaris [French bean]
gb|EYC14044.1|  hypothetical protein Y032_0042g679                    52.0    1e-05   Ancylostoma ceylanicum
gb|EAY86614.1|  hypothetical protein OsI_07995                        51.6    1e-05   Oryza sativa Indica Group [Indian rice]
gb|KFO18269.1|  Calmodulin                                            51.6    1e-05   Fukomys damarensis [Damara mole rat]
ref|XP_001785090.1|  predicted protein                                51.6    1e-05   
gb|KGG50401.1|  calmodulin                                            51.6    1e-05   Mitosporidium daphniae
gb|AHY86315.1|  Y-GECO1f                                              53.5    1e-05   synthetic construct
ref|XP_009340773.1|  PREDICTED: probable calcium-binding protein ...  52.0    1e-05   Pyrus x bretschneideri [bai li]
gb|AHY86314.1|  Y-GECO1                                               53.5    1e-05   synthetic construct
ref|NP_001173067.1|  Os02g0606501                                     51.2    1e-05   
gb|AFW79981.1|  calmodulin protein 2, touch-induced                   52.0    1e-05   
gb|EFA05282.1|  hypothetical protein TcasGA2_TC015439                 52.8    1e-05   
gb|EKC32559.1|  Calmodulin                                            53.1    2e-05   Crassostrea gigas
ref|XP_001785095.1|  predicted protein                                50.8    2e-05   
ref|XP_004344761.1|  calmodulin, putative                             49.7    2e-05   Acanthamoeba castellanii str. Neff
ref|XP_002129217.1|  PREDICTED: calglandulin-like                     50.8    2e-05   Ciona intestinalis [sea vase]
ref|XP_006088486.1|  PREDICTED: calmodulin-like protein 3             50.8    2e-05   Myotis lucifugus
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg              50.8    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_004867158.1|  PREDICTED: calmodulin isoform X3                 50.8    2e-05   
emb|CDW53538.1|  Calmodulin                                           51.2    2e-05   Trichuris trichiura
ref|NP_001152708.1|  LOC100286349                                     51.6    2e-05   
ref|XP_011099473.1|  PREDICTED: probable calcium-binding protein ...  50.8    2e-05   Sesamum indicum [beniseed]
ref|XP_002512001.1|  Calmodulin, putative                             50.8    2e-05   Ricinus communis
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like    50.8    2e-05   Eucalyptus grandis [rose gum]
ref|XP_004308823.1|  PREDICTED: calmodulin-5/6/7/8-like               51.2    2e-05   Fragaria vesca subsp. vesca
gb|EPS69688.1|  hypothetical protein M569_05080                       50.4    2e-05   Genlisea aurea
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292            50.4    2e-05   
gb|AFJ91796.1|  calmodulin                                            49.3    2e-05   Ostrea edulis [Colchester native oyster]
pdb|1SW8|A  Chain A, Solution Structure Of The N-Terminal Domain ...  49.3    3e-05   Homo sapiens [man]
ref|XP_004425517.1|  PREDICTED: calmodulin-like protein 3             50.1    3e-05   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010104706.1|  putative calcium-binding protein CML25           50.8    3e-05   Morus notabilis
gb|EHH17309.1|  hypothetical protein EGK_13688                        50.1    3e-05   Macaca mulatta [rhesus macaque]
gb|KFD49502.1|  hypothetical protein M513_09613                       51.6    3e-05   Trichuris suis
gb|KDP20063.1|  hypothetical protein JCGZ_05832                       50.4    3e-05   Jatropha curcas
ref|XP_006158531.1|  PREDICTED: calmodulin-like protein 5             50.1    3e-05   Tupaia chinensis
gb|ETK82424.1|  calmodulin                                            50.8    3e-05   Phytophthora parasitica
ref|XP_009037109.1|  hypothetical protein AURANDRAFT_26147            51.2    3e-05   Aureococcus anophagefferens
ref|XP_001609057.1|  calmodulin                                       50.1    3e-05   Babesia bovis T2Bo
emb|CDR97700.1|  calmodulin, putative                                 50.1    3e-05   Babesia bigemina
ref|XP_002721725.1|  PREDICTED: calmodulin-like protein 3             50.1    3e-05   Oryctolagus cuniculus [domestic rabbit]
gb|ELU13700.1|  hypothetical protein CAPTEDRAFT_169155                50.4    3e-05   Capitella teleta
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...  50.1    3e-05   Malus domestica [apple tree]
gb|KJB39976.1|  hypothetical protein B456_007G041100                  50.1    3e-05   Gossypium raimondii
emb|CCD75848.1|  putative centrin                                     50.1    4e-05   Schistosoma mansoni
ref|XP_011288132.1|  PREDICTED: calmodulin                            50.1    4e-05   
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24         50.1    4e-05   Solanum lycopersicum
ref|XP_005869569.1|  PREDICTED: calmodulin-like protein 3             50.1    4e-05   Myotis brandtii
gb|EHB13359.1|  Calmodulin                                            50.1    4e-05   Heterocephalus glaber [naked mole rat]
ref|XP_003695096.1|  PREDICTED: calmodulin-like                       50.1    4e-05   
ref|XP_008119752.1|  PREDICTED: calmodulin                            50.8    4e-05   
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501            50.1    4e-05   
ref|XP_004757981.1|  PREDICTED: calmodulin-like protein 3             49.7    4e-05   Mustela putorius furo [black ferret]
ref|XP_009170077.1|  hypothetical protein T265_06530                  49.7    4e-05   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_004806636.1|  PREDICTED: calmodulin-like protein 3             49.7    4e-05   
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like    50.1    4e-05   Nicotiana sylvestris
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                   49.7    4e-05   Eucalyptus grandis [rose gum]
pdb|4Q57|A  Chain A, Crystal Structure Of The Plectin 1a Actin-bi...  48.5    4e-05   Mus musculus [mouse]
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...  49.7    4e-05   Nicotiana tomentosiformis
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like    49.7    4e-05   Solanum tuberosum [potatoes]
ref|XP_004976061.1|  PREDICTED: probable calcium-binding protein ...  51.2    4e-05   Setaria italica
ref|XP_011150177.1|  PREDICTED: neo-calmodulin-like isoform X4        50.1    4e-05   Harpegnathos saltator
emb|CDP19328.1|  unnamed protein product                              49.7    4e-05   Coffea canephora [robusta coffee]
ref|XP_006125555.1|  PREDICTED: calmodulin-like isoform X2            49.7    5e-05   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008557060.1|  PREDICTED: probable calcium-binding protein ...  51.6    5e-05   Microplitis demolitor
ref|XP_011427007.1|  PREDICTED: calmodulin-A-like                     49.7    5e-05   Crassostrea gigas
ref|XP_003758346.1|  PREDICTED: calmodulin-like                       50.1    5e-05   
dbj|GAA53816.1|  centrin-3                                            49.3    5e-05   Clonorchis sinensis [oriental liver fluke]
ref|XP_011150176.1|  PREDICTED: neo-calmodulin-like isoform X3        50.8    5e-05   Harpegnathos saltator
gb|EFN67816.1|  Calmodulin                                            50.8    5e-05   Camponotus floridanus
gb|EKC20233.1|  Calmodulin                                            51.6    5e-05   Crassostrea gigas
ref|XP_009386769.1|  PREDICTED: calmodulin-like                       49.7    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|EGI57712.1|  Calmodulin                                            50.1    5e-05   Acromyrmex echinatior
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...  49.7    5e-05   Pyrus x bretschneideri [bai li]
sp|Q39752.3|CALM_FAGSY  RecName: Full=Calmodulin; Short=CaM           49.7    5e-05   Fagus sylvatica
gb|EZA54087.1|  Calmodulin                                            50.8    5e-05   Ooceraea biroi
gb|AFQ60635.1|  Nano-lantern_Ca2+_CaM-4GS                             52.0    5e-05   synthetic construct
gb|AFQ60634.1|  Nano-lantern_Ca2+_CaM-2GS                             52.0    5e-05   synthetic construct
gb|EMT00032.1|  Calmodulin                                            49.7    5e-05   
ref|XP_004829358.1|  calmodulin, putative                             49.3    5e-05   Theileria equi strain WA
ref|XP_011307674.1|  PREDICTED: neo-calmodulin-like isoform X3        50.8    5e-05   Fopius arisanus
gb|EPY50961.1|  calmodulin Cam1                                       49.3    5e-05   Schizosaccharomyces cryophilus OY26
ref|XP_011066820.1|  PREDICTED: neo-calmodulin-like                   50.8    5e-05   Acromyrmex echinatior
ref|XP_006647478.1|  PREDICTED: probable calcium-binding protein ...  49.7    5e-05   Oryza brachyantha
ref|XP_011257081.1|  PREDICTED: neo-calmodulin-like isoform X3        50.8    5e-05   Camponotus floridanus
ref|XP_006616491.1|  PREDICTED: calmodulin-like isoform X5            50.8    5e-05   Apis dorsata [rock honeybee]
ref|XP_006558598.1|  PREDICTED: calmodulin-like isoform X5            50.8    6e-05   Apis mellifera [bee]
gb|EPX74846.1|  calmodulin Cam1                                       49.3    6e-05   Schizosaccharomyces octosporus yFS286
ref|NP_593340.1|  calmodulin Cam1                                     49.3    6e-05   Schizosaccharomyces pombe
ref|XP_002175972.1|  calmodulin Cam1                                  49.3    6e-05   Schizosaccharomyces japonicus yFS275
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...  49.7    6e-05   Elaeis guineensis
ref|XP_011339099.1|  PREDICTED: neo-calmodulin-like isoform X3        50.8    6e-05   Ooceraea biroi
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3             50.1    6e-05   Eucalyptus grandis [rose gum]
gb|KIW04752.1|  hypothetical protein PV09_04478                       49.3    6e-05   Verruconis gallopava
ref|XP_008557059.1|  PREDICTED: uncharacterized protein LOC103577...  51.2    6e-05   Microplitis demolitor
ref|XP_011150174.1|  PREDICTED: calmodulin-beta-like isoform X1       50.8    6e-05   Harpegnathos saltator
ref|XP_006558597.1|  PREDICTED: calmodulin-like isoform X4            50.8    6e-05   Apis mellifera [bee]
ref|XP_006669179.1|  calmodulin                                       49.7    6e-05   Cordyceps militaris CM01
ref|XP_006616488.1|  PREDICTED: calmodulin-like isoform X2            50.8    6e-05   Apis dorsata [rock honeybee]
ref|XP_005605456.1|  PREDICTED: calmodulin                            49.3    6e-05   
gb|EHB00855.1|  Calmodulin                                            50.1    6e-05   Heterocephalus glaber [naked mole rat]
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             49.3    6e-05   Nicotiana sylvestris
ref|XP_006616490.1|  PREDICTED: calmodulin-like isoform X4            50.8    6e-05   Apis dorsata [rock honeybee]
ref|XP_004897704.1|  PREDICTED: calmodulin-like protein 3             49.3    6e-05   
ref|XP_011307672.1|  PREDICTED: calmodulin-beta-like isoform X1       50.8    6e-05   Fopius arisanus
ref|XP_011257082.1|  PREDICTED: neo-calmodulin-like isoform X4        49.7    6e-05   Camponotus floridanus
ref|XP_011150175.1|  PREDICTED: calmodulin-A-like isoform X2          50.8    6e-05   Harpegnathos saltator
ref|XP_624589.2|  PREDICTED: calmodulin-like isoformX2                50.8    6e-05   Apis mellifera [bee]
ref|XP_008550049.1|  PREDICTED: calmodulin-A-like                     50.8    6e-05   Microplitis demolitor
ref|XP_011498410.1|  PREDICTED: neo-calmodulin-like isoform X2        50.4    6e-05   Ceratosolen solmsi marchali
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...  49.7    6e-05   Fragaria vesca subsp. vesca
ref|XP_004349444.1|  calmodulin                                       49.3    6e-05   Capsaspora owczarzaki ATCC 30864
ref|XP_011090880.1|  PREDICTED: probable calcium-binding protein ...  50.1    6e-05   Sesamum indicum [beniseed]
ref|XP_011257079.1|  PREDICTED: calmodulin-beta-like isoform X1       50.8    6e-05   Camponotus floridanus
gb|KIW16124.1|  calmodulin                                            50.1    7e-05   Exophiala spinifera
ref|XP_003400211.1|  PREDICTED: calmodulin-like                       50.8    7e-05   Bombus terrestris [large earth bumblebee]
ref|XP_003372739.1|  EF hand domain containing protein                50.4    7e-05   Trichinella spiralis
ref|XP_011257080.1|  PREDICTED: calmodulin-A-like isoform X2          50.8    7e-05   Camponotus floridanus
ref|XP_006616487.1|  PREDICTED: calmodulin-like isoform X1            50.8    7e-05   Apis dorsata [rock honeybee]
ref|XP_011339096.1|  PREDICTED: calmodulin-beta-like isoform X1       50.8    7e-05   Ooceraea biroi
ref|NP_001053179.1|  Os04g0492800                                     50.4    7e-05   
gb|AET43975.1|  calmodulin                                            48.1    7e-05   Reishia clavigera
ref|XP_011307673.1|  PREDICTED: calmodulin-A-like isoform X2          50.8    7e-05   Fopius arisanus
ref|XP_006558596.1|  PREDICTED: calmodulin-like isoform X3            50.8    7e-05   Apis mellifera [bee]
gb|EMS64097.1|  Putative calmodulin-like protein 2                    48.9    7e-05   Triticum urartu
gb|AJD79800.1|  calmodulin                                            48.1    7e-05   Clarias gariepinus [sharptooth catfish]
ref|XP_006616489.1|  PREDICTED: calmodulin-like isoform X3            50.8    7e-05   Apis dorsata [rock honeybee]
ref|XP_007074300.1|  PREDICTED: calmodulin-like                       49.3    7e-05   Panthera tigris altaica
ref|XP_004867156.1|  PREDICTED: calmodulin isoform X1                 50.1    7e-05   
ref|XP_011171909.1|  PREDICTED: neo-calmodulin-like                   50.8    7e-05   Solenopsis invicta [imported red fire ant]
ref|XP_004970313.1|  PREDICTED: calmodulin-3-like isoform X2          49.3    7e-05   
ref|XP_003903394.1|  PREDICTED: calmodulin-like protein 3             49.3    7e-05   Papio anubis [baboon]
ref|XP_011129786.1|  calmodulin                                       48.9    7e-05   Gregarina niphandrodes
gb|KGB39653.1|  Centrin-3                                             49.3    7e-05   Schistosoma haematobium
ref|XP_011339098.1|  PREDICTED: calmodulin-A-like isoform X2          50.4    7e-05   
pdb|1F70|A  Chain A, Refined Solution Structure Of Calmodulin N-T...  48.1    7e-05   Xenopus laevis [clawed frog]
ref|XP_011498412.1|  PREDICTED: neo-calmodulin-like isoform X4        49.7    7e-05   Ceratosolen solmsi marchali
ref|XP_006841622.1|  hypothetical protein AMTR_s00003p00224450        49.3    7e-05   Amborella trichopoda
ref|XP_504759.1|  YALI0E34111p                                        49.3    7e-05   Yarrowia lipolytica CLIB122
ref|XP_001622774.1|  predicted protein                                49.3    7e-05   Nematostella vectensis
ref|XP_011498411.1|  PREDICTED: neo-calmodulin-like isoform X3        49.7    7e-05   Ceratosolen solmsi marchali
ref|XP_008216621.1|  PREDICTED: calmodulin-A-like                     50.4    8e-05   
ref|XP_006432946.1|  hypothetical protein CICLE_v10002774mg           48.9    8e-05   Citrus clementina [clementine]
gb|EKC24243.1|  Calmodulin                                            51.2    8e-05   Crassostrea gigas
emb|CAD41532.1|  OSJNBb0091E11.1                                      49.7    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACG31559.1|  calmodulin                                            48.9    8e-05   Zea mays [maize]
pdb|3UCT|A  Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of...  47.8    8e-05   Homo sapiens [man]
pdb|3B32|A  Chain A, Crystal Structure Of Calcium-Saturated Calmo...  47.8    8e-05   Rattus norvegicus [brown rat]
gb|ACT88125.1|  AT15141p                                              49.3    8e-05   Drosophila melanogaster
ref|XP_010672963.1|  PREDICTED: probable calcium-binding protein ...  50.1    8e-05   Beta vulgaris subsp. vulgaris [field beet]
pdb|1AK8|A  Chain A, Nmr Solution Structure Of Cerium-Loaded Calm...  47.8    8e-05   Bos taurus [bovine]
pdb|2LQC|A  Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin ...  47.8    8e-05   Homo sapiens [man]
gb|ELK12789.1|  Calmodulin                                            49.3    8e-05   
ref|XP_011498409.1|  PREDICTED: neo-calmodulin-like isoform X1        50.4    8e-05   
ref|XP_006839639.1|  PREDICTED: calmodulin                            49.3    8e-05   
emb|CAH67730.1|  H0522A01.1                                           49.7    8e-05   
ref|XP_006652455.1|  PREDICTED: probable calcium-binding protein ...  50.4    8e-05   
ref|XP_002160750.1|  PREDICTED: calmodulin-like                       49.3    8e-05   
gb|KFY20747.1|  hypothetical protein V491_03461                       49.3    8e-05   
gb|ESA24296.1|  hypothetical protein GLOINDRAFT_341734                48.9    8e-05   
pdb|1J7O|A  Chain A, Solution Structure Of Calcium-calmodulin N-t...  47.8    8e-05   
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                     48.9    8e-05   
ref|NP_004057.1|  centrin-1                                           49.3    9e-05   
ref|XP_009243366.1|  PREDICTED: calmodulin-like protein 3             48.9    9e-05   
ref|XP_009379268.1|  PREDICTED: probable calcium-binding protein ...  49.7    9e-05   
gb|ACH46202.1|  putative calmodulin variant 1                         47.8    9e-05   
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg           48.9    9e-05   
gb|EFZ10130.1|  hypothetical protein SINV_07599                       49.3    9e-05   
ref|NP_001104289.1|  calmodulin                                       48.9    9e-05   
ref|XP_011416024.1|  PREDICTED: calmodulin-like protein 12            50.8    9e-05   
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...  48.9    9e-05   
gb|KIY52148.1|  calmodulin                                            48.9    9e-05   
ref|XP_004970312.1|  PREDICTED: calmodulin-3-like isoform X1          49.3    9e-05   
gb|AEY79848.1|  calmodulin                                            47.4    9e-05   
ref|NP_001270011.1|  calmodulin 2 (phosphorylase kinase, delta)       48.9    9e-05   
pdb|2LLO|A  Chain A, Solution Nmr-derived Structure Of Calmodulin...  47.8    1e-04   
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   48.9    1e-04   
ref|XP_004324871.1|  PREDICTED: calmodulin-like                       48.5    1e-04   
gb|AEO16865.1|  GEX-GECO1                                             50.8    1e-04   
prf||0608335A  calmodulin                                             48.5    1e-04
sp|P11121.2|CALM_PYUSP  RecName: Full=Calmodulin; Short=CaM           48.5    1e-04   
gb|AHB64329.1|  calmodulin                                            48.1    1e-04   
ref|XP_001113485.1|  PREDICTED: calmodulin-like isoform 4             48.9    1e-04   
emb|CAG29342.1|  CETN3                                                48.9    1e-04   
ref|XP_006868502.1|  PREDICTED: calmodulin                            48.9    1e-04   
ref|XP_003748509.1|  PREDICTED: calmodulin-like                       49.3    1e-04   
ref|XP_008343178.1|  PREDICTED: probable calcium-binding protein ...  49.7    1e-04   
pdb|2K0J|A  Chain A, Solution Structure Of Cam Complexed To Drp1p     48.5    1e-04   
ref|XP_008153573.1|  PREDICTED: calmodulin-like protein 5             48.5    1e-04   
emb|CDQ92434.1|  unnamed protein product                              48.9    1e-04   
ref|XP_009859758.1|  PREDICTED: caltractin                            48.9    1e-04   
ref|XP_009061568.1|  hypothetical protein LOTGIDRAFT_219848           48.9    1e-04   
ref|XP_004923690.1|  PREDICTED: calmodulin-like                       50.1    1e-04   
gb|ACM09117.1|  Calmodulin                                            47.8    1e-04   
ref|XP_008310981.1|  PREDICTED: calmodulin                            49.3    1e-04   
gb|ABK21927.1|  unknown                                               48.5    1e-04   
gb|KHN88588.1|  Calmodulin                                            47.8    1e-04   
ref|XP_005786038.1|  calmodulin                                       48.9    1e-04   
gb|ELV14138.1|  Calmodulin                                            48.9    1e-04   
ref|XP_010364795.1|  PREDICTED: calmodulin-like protein 3             48.5    1e-04   
ref|XP_003257649.1|  PREDICTED: calmodulin-like protein 3             48.5    1e-04   
sp|P02595.2|CALM_PATSP  RecName: Full=Calmodulin; Short=CaM           48.5    1e-04   
pdb|3SG5|A  Chain A, Crystal Structure Of Dimeric Gcamp3-d380y, Q...  50.4    1e-04   
ref|XP_007298032.1|  EF-hand                                          48.9    1e-04   
prf||0711223A  calmodulin                                             48.5    1e-04
ref|XP_808682.1|  calmodulin                                          47.4    1e-04   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       48.5    1e-04   
pdb|3SG4|A  Chain A, Crystal Structure Of Gcamp3-d380y, Lp(linker 2)  50.4    1e-04   
pdb|3WLC|A  Chain A, Crystal Structure Of Dimeric Gcamp6m             50.4    1e-04   
ref|XP_007532277.1|  PREDICTED: calmodulin                            48.5    1e-04   
sp|P62184.2|CALM_RENRE  RecName: Full=Calmodulin; Short=CaM           48.5    1e-04   
pdb|4DJC|A  Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-...  48.5    1e-04   
ref|XP_006405836.1|  hypothetical protein EUTSA_v10027972mg           48.5    1e-04   
ref|XP_008835072.1|  PREDICTED: calmodulin-like protein 3             48.5    1e-04   
gb|EFA08949.1|  hypothetical protein TcasGA2_TC006656                 48.9    1e-04   
gb|AAY16242.1|  calmodulin                                            47.8    1e-04   
ref|XP_011159042.1|  PREDICTED: probable calcium-binding protein ...  49.7    1e-04   
gb|AGB14584.1|  calmodulin                                            47.8    1e-04   
ref|XP_005242003.1|  PREDICTED: calmodulin                            50.1    1e-04   
ref|XP_004241038.1|  PREDICTED: calmodulin-like protein 8             48.5    1e-04   
gb|AGB14592.1|  calmodulin                                            47.8    1e-04   
ref|XP_005557409.1|  PREDICTED: centrin-3 isoform X2                  47.8    1e-04   
sp|P84339.2|CALM_AGABI  RecName: Full=Calmodulin; Short=CaM           48.1    1e-04   
ref|XP_006372871.1|  hypothetical protein POPTR_0017s05860g           49.3    1e-04   
gb|ADT61781.1|  calmodulin                                            48.5    1e-04   
emb|CDQ64500.1|  unnamed protein product                              48.9    1e-04   
gb|AAY67906.1|  centrin 3                                             47.8    1e-04   
gb|AJP77094.1|  LAR-GECO1                                             50.4    1e-04   
ref|NP_181643.1|  calmodulin-like protein 4                           50.1    1e-04   
dbj|GAK68453.1|  calmodulin                                           48.1    1e-04   
gb|ELR61731.1|  hypothetical protein M91_07940                        48.5    1e-04   
gb|AEA30980.1|  calmodulin                                            47.4    1e-04   
ref|XP_011390388.1|  putative calmodulin                              48.1    1e-04   
ref|XP_009611663.1|  PREDICTED: calmodulin-like protein 8             48.1    1e-04   
ref|XP_001765534.1|  predicted protein                                48.5    1e-04   
gb|AAY16235.1|  calmodulin                                            47.8    1e-04   
gb|AAC37419.1|  calmodulin-related protein                            50.1    1e-04   
ref|XP_008472657.1|  PREDICTED: calmodulin-like                       49.3    1e-04   
ref|XP_006432944.1|  hypothetical protein CICLE_v10004033mg           47.8    1e-04   
ref|NP_001031523.1|  calmodulin-like protein 4                        49.7    1e-04   
ref|XP_971297.2|  PREDICTED: neo-calmodulin-like isoform X3           49.7    1e-04   
ref|XP_008197240.1|  PREDICTED: neo-calmodulin-like isoform X2        49.7    1e-04   
ref|XP_458926.2|  DEHA2D10582p                                        48.1    1e-04   
gb|AAX42560.1|  calmodulin-like 3                                     48.1    1e-04   
emb|CAG10181.1|  unnamed protein product                              48.5    2e-04   
ref|XP_006350654.1|  PREDICTED: calmodulin-like protein 11-like       48.1    2e-04   
pdb|1GGZ|A  Chain A, Crystal Structure Of The Calmodulin-Like Pro...  48.1    2e-04   
gb|ETE70432.1|  Calmodulin                                            48.9    2e-04   
ref|NP_005176.1|  calmodulin-like protein 3                           48.1    2e-04   
gb|AAX36139.1|  calmodulin-like 3                                     48.1    2e-04   
ref|XP_009702107.1|  PREDICTED: calmodulin-like                       48.9    2e-04   
gb|KDP28741.1|  hypothetical protein JCGZ_14512                       48.9    2e-04   
gb|EZA53976.1|  Calmodulin                                            49.3    2e-04   
ref|XP_004691277.1|  PREDICTED: calmodulin-like protein 3             48.1    2e-04   
gb|ENN77948.1|  hypothetical protein YQE_05625                        48.1    2e-04   
ref|XP_002430223.1|  calmodulin-A, putative                           48.5    2e-04   
ref|XP_001755625.1|  predicted protein                                48.1    2e-04   
ref|XP_002683533.1|  flagellar calmodulin                             48.1    2e-04   
ref|XP_001703420.1|  calmodulin                                       48.5    2e-04   
ref|XP_006035364.1|  PREDICTED: calmodulin-like                       48.1    2e-04   
ref|XP_004336073.1|  Calmodulin, putative                             48.1    2e-04   
gb|EDL78581.1|  rCG55787                                              48.1    2e-04   
emb|CDX99691.1|  BnaC04g34480D                                        48.1    2e-04   
gb|ABA01113.1|  calmodulin                                            48.5    2e-04   
emb|CCQ18612.1|  Calmodulin and related proteins                      48.1    2e-04   
ref|XP_011281779.1|  PREDICTED: calmodulin                            48.1    2e-04   
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...  48.5    2e-04   
ref|NP_001065715.1|  Os11g0141400                                     47.4    2e-04   
dbj|GAN06811.1|  calmodulin                                           48.1    2e-04   
ref|XP_002446720.1|  hypothetical protein SORBIDRAFT_06g021150        49.3    2e-04   
ref|XP_008931196.1|  PREDICTED: calmodulin                            48.5    2e-04   
ref|XP_006909678.1|  PREDICTED: calmodulin isoform X1                 48.1    2e-04   
gb|AAY16239.1|  calmodulin                                            47.4    2e-04   
ref|XP_004361968.1|  calmodulin                                       48.1    2e-04   
ref|XP_010986526.1|  PREDICTED: calmodulin                            49.3    2e-04   
ref|XP_008197239.1|  PREDICTED: neo-calmodulin-like isoform X1        49.7    2e-04   
gb|AFV80092.1|  calmodulin-like protein                               48.1    2e-04   
ref|XP_005772534.1|  Centrin-like protein                             48.5    2e-04   
gb|AAW25231.1|  SJCHGC09133 protein                                   48.1    2e-04   
pdb|3IFK|A  Chain A, Crystal Structure Of Calcium-Saturated Calmo...  47.0    2e-04   
emb|CDY27652.1|  BnaUnng00020D                                        48.1    2e-04   
gb|EHJ76967.1|  putative calmodulin-A                                 48.5    2e-04   
prf||1003191A  calmodulin                                             48.1    2e-04
gb|AAH05457.1|  Calmodulin-like 3                                     48.1    2e-04   
prf||1206346A  calmodulin                                             48.1    2e-04
ref|XP_009140162.1|  PREDICTED: calcium-binding protein CML24         48.1    2e-04   
sp|Q9HFY6.3|CALM_BLAEM  RecName: Full=Calmodulin; Short=CaM           48.1    2e-04   
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...  48.1    2e-04   
gb|EPT04782.1|  hypothetical protein FOMPIDRAFT_1021634               48.1    2e-04   
gb|KDN43033.1|  Calmodulin                                            48.1    2e-04   
ref|NP_081692.1|  calmodulin-like protein 3                           48.1    2e-04   
ref|XP_003689570.1|  PREDICTED: uncharacterized protein LOC100865094  49.7    2e-04   
gb|ADK23955.1|  calmodulin                                            48.1    2e-04   
gb|AEO16869.1|  G-GECO1.1                                             49.7    2e-04   
ref|XP_005383897.1|  PREDICTED: calmodulin-like protein 3 isoform X1  47.8    2e-04   
gb|AFK45794.1|  unknown                                               47.8    2e-04   
ref|XP_003473474.1|  PREDICTED: calmodulin-like protein 3             47.8    2e-04   
ref|XP_003624801.1|  Calmodulin                                       47.8    2e-04   
gb|AFQ60636.1|  Nano-lantern_Ca2+_CaM_E104Q-2G                        50.1    2e-04   
gb|AFQ60637.1|  Nano-lantern_Ca2+_CaM_E104Q-3GS                       50.1    2e-04   
gb|AFQ60638.1|  Nano-lantern_Ca2+_CaM_E104Q-4GS                       50.1    2e-04   
gb|KFQ36055.1|  Calmodulin                                            47.0    2e-04   
pdb|4OY4|A  Chain A, Calcium-free Campari V0.2                        49.7    2e-04   
ref|XP_009393057.1|  PREDICTED: neo-calmodulin-like                   48.1    2e-04   
dbj|BAB27862.1|  unnamed protein product                              48.1    2e-04   
ref|XP_011080472.1|  PREDICTED: calmodulin                            47.8    2e-04   
gb|AFQ60633.1|  Nano-lantern_Ca2+_CaM-2G                              50.1    2e-04   
ref|XP_008945243.1|  PREDICTED: calmodulin-alpha-like                 47.4    2e-04   
ref|XP_008703623.1|  PREDICTED: calmodulin-like protein 3             47.8    2e-04   
ref|XP_006933271.1|  PREDICTED: calmodulin-like protein 3             47.8    2e-04   
ref|XP_005391108.1|  PREDICTED: calmodulin                            47.0    2e-04   
ref|XP_005017784.1|  PREDICTED: centrin-3                             48.1    2e-04   
gb|AEO16870.1|  G-GECO1.2                                             49.7    2e-04   
gb|EKC36205.1|  Calmodulin                                            47.4    2e-04   
ref|XP_005320369.1|  PREDICTED: calmodulin-like protein 3             47.8    2e-04   
ref|XP_003630938.1|  Calcium-binding pollen allergen                  48.5    2e-04   
gb|ACO09945.1|  Calmodulin                                            47.4    2e-04   
ref|XP_004605509.1|  PREDICTED: calmodulin-like protein 5             47.8    2e-04   
gb|AEO16868.1|  G-GECO1                                               49.7    2e-04   
ref|XP_001062982.1|  PREDICTED: calmodulin-like protein 5             47.8    2e-04   
gb|ACH46247.1|  putative calmodulin variant 4                         47.0    2e-04   
gb|EKC32562.1|  Calmodulin                                            50.1    2e-04   
gb|AET05414.2|  EF hand calcium-binding family protein                48.5    2e-04   
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...  48.5    2e-04   
ref|XP_010737967.1|  PREDICTED: calmodulin                            47.4    2e-04   
gb|AEO16864.1|  GEM-GECO1                                             49.7    2e-04   
gb|AGB14576.1|  calmodulin                                            47.4    2e-04   
ref|XP_006568277.1|  PREDICTED: probable calcium-binding protein ...  49.7    2e-04   
gb|AEQ35023.1|  calmodulin                                            47.8    2e-04   
ref|XP_392226.2|  PREDICTED: probable calcium-binding protein CML...  49.7    2e-04   
ref|XP_002946692.1|  calmodulin                                       48.1    2e-04   
gb|KDQ52197.1|  hypothetical protein JAAARDRAFT_40314                 47.8    2e-04   
dbj|GAA95920.1|  hypothetical protein E5Q_02578                       47.8    2e-04   
pdb|4IK5|A  Chain A, High Resolution Structure Of Delta-rest-gcamp3   49.7    2e-04   
gb|AGB14578.1|  calmodulin                                            47.4    2e-04   
ref|NP_001066111.2|  Os12g0138000                                     47.0    2e-04   
ref|XP_011453688.1|  PREDICTED: calmodulin-like                       46.6    2e-04   
ref|XP_002920391.1|  PREDICTED: calmodulin-like protein 3             47.8    2e-04   
ref|XP_006568278.1|  PREDICTED: probable calcium-binding protein ...  49.3    2e-04   
emb|CEP07602.1|  hypothetical protein                                 47.8    2e-04   
ref|XP_011140004.1|  PREDICTED: calmodulin-like isoform X2            49.3    2e-04   
gb|AEX97094.1|  calmodulin                                            47.4    2e-04   
ref|XP_009419453.1|  PREDICTED: calmodulin-like protein 1             48.5    2e-04   
ref|XP_002491691.1|  Calmodulin                                       47.8    2e-04   
ref|XP_002455240.1|  hypothetical protein SORBIDRAFT_03g006930        48.5    2e-04   
ref|XP_011339456.1|  PREDICTED: calmodulin isoform X2                 49.3    2e-04   
ref|XP_002420201.1|  CaM, putative; calmodulin, putative              47.8    2e-04   
emb|CBN20770.1|  calmodulin                                           47.8    2e-04   
ref|XP_006129724.1|  PREDICTED: calmodulin-like isoform X3            47.4    2e-04   
ref|XP_006819033.1|  PREDICTED: calmodulin-like                       48.1    2e-04   
gb|AGB14599.1|  calmodulin                                            47.4    2e-04   
gb|ELW48699.1|  Calmodulin                                            48.9    2e-04   
gb|ELU14232.1|  hypothetical protein CAPTEDRAFT_100820                47.4    2e-04   
gb|AGB14601.1|  calmodulin                                            47.4    2e-04   
ref|XP_006609940.1|  PREDICTED: probable calcium-binding protein ...  49.3    2e-04   
ref|XP_010150447.1|  PREDICTED: centrin-3                             46.6    2e-04   
gb|KIM54918.1|  hypothetical protein SCLCIDRAFT_333294                47.8    2e-04   
ref|XP_001625680.1|  predicted protein                                47.8    2e-04   
ref|NP_001146794.1|  uncharacterized protein LOC100280399             48.1    2e-04   
ref|XP_008159907.1|  PREDICTED: calmodulin-alpha-like                 47.4    2e-04   
ref|XP_005704341.1|  calmodulin isoform 1                             47.8    2e-04   
gb|AAZ23120.1|  calmodulin                                            47.4    2e-04   
dbj|BAJ92507.1|  predicted protein                                    48.1    2e-04   
gb|KFK41060.1|  hypothetical protein AALP_AA2G080200                  47.8    3e-04   
gb|ACG40998.1|  calmodulin                                            48.1    3e-04   
emb|CDK28292.1|  unnamed protein product                              47.0    3e-04   
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg           47.8    3e-04   
gb|AGB14570.1|  calmodulin                                            47.0    3e-04   
gb|AGV52785.1|  O-GECO1                                               49.3    3e-04   
gb|EFA81078.1|  calmodulin                                            47.8    3e-04   
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...  47.8    3e-04   
ref|XP_011140005.1|  PREDICTED: calmodulin-like isoform X3            49.3    3e-04   
ref|XP_004470713.1|  PREDICTED: centrin-3                             48.1    3e-04   



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  93
            G+KKP G +TPTSVLP L++EIS DE S +    YAELVQAF +ID D DGKIRKEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADEWSEISAEVYAELVQAFHVIDTDGDGKIRKEELEA  103

Query  92   LLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +LS+VG EPPS+EEL L+L EVDRDGDGCI
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCI  133



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 4/90 (4%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEA  93
            G+KKP G +TPTSVLP L++EIS D+ S +    YAELVQAF +ID D DGKI KEELEA
Sbjct  44   GFKKPNGLATPTSVLPTLSNEISADKWSEISAEVYAELVQAFHMIDTDGDGKIMKEELEA  103

Query  92   LLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +LS+VG EPPS+EEL L+L EVDRDGDGCI
Sbjct  104  ILSRVGTEPPSKEELTLLLDEVDRDGDGCI  133



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDEL----SGLYAELVQAFKLIDRDDDGKIRKEELEA  93
            G+KKP G STPTSVLP+L+ EISP+E     + +Y EL QAF++IDRD DGKI+KEELE 
Sbjct  44   GFKKPTGLSTPTSVLPSLSAEISPNEWPEIPADIYFELKQAFEMIDRDGDGKIKKEELEG  103

Query  92   LLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            LL ++G EPP +EEL+LML+EVDRDGDGCI
Sbjct  104  LLCRLGPEPPCQEELKLMLTEVDRDGDGCI  133



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEA  93
            G KKP G STPTSVLP L+ +IS +E S     +Y EL QAF++IDRD DGKI+KEELEA
Sbjct  44   GSKKPNGLSTPTSVLPTLSADISAEEWSEISADVYFELKQAFEMIDRDGDGKIKKEELEA  103

Query  92   LLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            LL ++GAEPP++EEL+LMLS+VDRDGDGCI
Sbjct  104  LLCRLGAEPPNQEELQLMLSDVDRDGDGCI  133



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 5/90 (6%)
 Frame = -1

Query  257  YKKPGGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEA  93
            +KKP G STPTSVLP A + EIS +E S     +Y +L QAF++IDRD DGK+ K ELE 
Sbjct  47   FKKPNGLSTPTSVLPTASSAEISTEEWSEISADVYFDLKQAFEMIDRDGDGKVTKAELED  106

Query  92   LLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            LL  +GA+PPSREELRLMLSEVDRDGDGCI
Sbjct  107  LLCGLGADPPSREELRLMLSEVDRDGDGCI  136



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 5/86 (6%)
 Frame = -1

Query  245  GGESTPTSVLP-ALNDEISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  +TPTSVLP  L+ EI+ DE S    G+Y ++ +AFK+IDRD DGKI ++ELEALLS+
Sbjct  66   GSPATPTSVLPPTLSSEITSDEWSEISGGVYEDVKEAFKMIDRDGDGKITRDELEALLSR  125

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            VGAEPPS EEL ++LSEVDRDGDGCI
Sbjct  126  VGAEPPSAEELNMLLSEVDRDGDGCI  151



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 9/81 (11%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG STPTSVLP+ +D         L +EL QAF++IDRD DGKI+KEELE LLS++GAEP
Sbjct  44   GGLSTPTSVLPSADD---------LCSELKQAFEMIDRDGDGKIKKEELEGLLSRLGAEP  94

Query  65   PSREELRLMLSEVDRDGDGCI  3
            PS+EEL+LM+SEVDRDGDGCI
Sbjct  95   PSQEELKLMVSEVDRDGDGCI  115



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 6/86 (7%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G+KKP G +TPTSVLP    EIS DE    ++E++QAF +ID D DGKIRKE+LEA+L++
Sbjct  44   GFKKPNGLATPTSVLPP--SEISADE----WSEILQAFHMIDSDGDGKIRKEQLEAILTR  97

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            VG +PPS EEL  +L+EVDR+GDGCI
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCI  123



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = -1

Query  230  PTSVLPALNDEIS---PDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  60
            PTSVLP  + EIS    D  S +  ELV AFK+IDRD DGKI K ELEALLS+VG EPPS
Sbjct  59   PTSVLPMHSYEISGDWSDFSSDIQTELVHAFKMIDRDGDGKITKRELEALLSRVGVEPPS  118

Query  59   REELRLMLSEVDRDGDGCI  3
             EE+ +MLSEVDRDGDGCI
Sbjct  119  EEEIMMMLSEVDRDGDGCI  137



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 6/86 (7%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G++KP G +TPTSVLP   ++IS DE    ++E++QAF +ID   DGKIRKE+LEA+L++
Sbjct  44   GFQKPNGLATPTSVLPP--NDISADE----WSEILQAFHMIDSGGDGKIRKEQLEAILTR  97

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            VG +PPS EEL  +L+EVDR+GDGCI
Sbjct  98   VGPDPPSEEELISLLNEVDRNGDGCI  123



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 5/86 (6%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G++KP G STPTSVLP   +EIS  E+  +YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  41   GFRKPTGSSTPTSVLP---NEISAAEV--VYAELIHAFHMMDTDGDGKIRKEELEAILSR  95

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            VG EPPS+EEL L+L EVD DGDGCI
Sbjct  96   VGTEPPSKEELMLLLEEVDVDGDGCI  121


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +
Sbjct  140  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFV  194



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 9/94 (10%)
 Frame = -1

Query  257  YKKPGGESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEE  102
            +K   G STPTSVLP  L++EIS ++ S       G+Y++LVQAF LID D DGKIRKE+
Sbjct  40   HKPYNGLSTPTSVLPTTLSNEISAEDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQ  99

Query  101  LEALLSQVGAE-PPSREELRLMLSEVDRDGDGCI  3
            LEA+LS+VG + PPS EEL  +L+EVD++GDGCI
Sbjct  100  LEAILSRVGGKSPPSEEELISLLNEVDKNGDGCI  133



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 9/89 (10%)
 Frame = -1

Query  242  GESTPTSVLPA-LNDEISPDELS-------GLYAELVQAFKLIDRDDDGKIRKEELEALL  87
            G STPTSVLP  L++EIS D+ S       G+Y++LVQAF LID D DGKIRKE+LEA+L
Sbjct  45   GISTPTSVLPTTLSNEISADDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQLEAIL  104

Query  86   SQVGAE-PPSREELRLMLSEVDRDGDGCI  3
            S+VG + PPS EEL  +L+EVD++GDGCI
Sbjct  105  SRVGGKSPPSEEELISLLNEVDKNGDGCI  133



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -1

Query  233  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  54
            TPTSVLP ++ + S D  +  Y++LVQAFKLIDRD+DG + + ELEALLS++GAEPPS+E
Sbjct  58   TPTSVLPEISGDWS-DISTDFYSDLVQAFKLIDRDNDGIVSRRELEALLSRLGAEPPSQE  116

Query  53   ELRLMLSEVDRDGDGCI  3
            E+  MLSEVD  GDGCI
Sbjct  117  EVATMLSEVDHVGDGCI  133



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPD----ELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  84
            K GG +TP SVL + + EIS D      +  + E +QAFKLIDRD DGK+   ELE LLS
Sbjct  47   KGGGGATPKSVLRSCSQEISGDWSDLSAANTHLEHLQAFKLIDRDGDGKVTIHELEGLLS  106

Query  83   QVGAEPPSREELRLMLSEVDRDGDGCI  3
            ++G EPPS+EE+ LML+E+D+DGDGCI
Sbjct  107  RIGGEPPSKEEMLLMLTEIDQDGDGCI  133



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 5/86 (6%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G+ KP G STPTSVLP   +EIS  E+   YAEL+ AF ++D D DGKIRKEELEA+LS+
Sbjct  43   GFSKPTGSSTPTSVLP---NEISAAEVG--YAELIHAFHMMDTDGDGKIRKEELEAILSR  97

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            VG EPPS+EEL L+L EVD +GDGCI
Sbjct  98   VGTEPPSKEELMLLLEEVDVNGDGCI  123


 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL  AF   D D DGKI  +EL ++  Q+G    + EE R M+  VD++GDG +
Sbjct  142  SELRDAFDFFDADHDGKITADELFSVFRQIGDSRCTLEECRRMIRGVDKNGDGFV  196



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 8/83 (10%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            KPG  +TP SVLP  +D        G Y+EL+QAFKLIDRDDDG + + +L ALLS++  
Sbjct  51   KPGPAATPISVLPGDHD--------GFYSELIQAFKLIDRDDDGVVSRRDLAALLSRLSP  102

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            EPPS+EE+ LML EVD  GDGCI
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCI  125



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  65   PSREELRLMLSEVDRDGDGCI  3
            P+ EE+ LMLSEVD DG GCI
Sbjct  106  PTPEEIALMLSEVDSDGKGCI  126



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
             G  TPTSVLP ++ E S D    +  EL QAF+LIDRD+DG + +EELEA+L+++GA P
Sbjct  47   AGSQTPTSVLPEVSGEWS-DITVDVQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARP  105

Query  65   PSREELRLMLSEVDRDGDGCI  3
            P+ EE+ LMLSEVD DG GCI
Sbjct  106  PTPEEIALMLSEVDSDGKGCI  126



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 9/83 (11%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            KPG  +TP SVLP   D          Y+EL+QAFKLIDRDDDG + ++EL ALLS +  
Sbjct  50   KPGPAATPVSVLPGEQD---------FYSELIQAFKLIDRDDDGVVSRKELAALLSGLSP  100

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            EPPS+EE+ LML EVD  GDGCI
Sbjct  101  EPPSQEEVTLMLQEVDGGGDGCI  123



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA+P
Sbjct  64   GGIRTPTSVLPERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADP  122

Query  65   PSREELRLMLSEVDRDGDGCI  3
            PS+EE+ LMLSEVDR+G+G I
Sbjct  123  PSQEEVMLMLSEVDREGNGSI  143


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -1

Query  239  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  60
            E   +  L AL + + P       +EL  AFK+ D D DGKI  EEL  + + +G +  +
Sbjct  138  EGNGSITLDALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAEELFNVFTAIGDDRCT  197

Query  59   REELRLMLSEVDRDGDGCI  3
             E+ R M++ VD++GDG +
Sbjct  198  LEDCRRMIAGVDKNGDGFV  216



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 8/83 (10%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            KPG  +TP SVLP  + +         Y+EL+QAFKLIDRDDDG + ++EL ALLS++  
Sbjct  51   KPGPAATPVSVLPGGDQD--------FYSELIQAFKLIDRDDDGVVSRKELAALLSRLSP  102

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            EPPS+EE+ LML EVD  GDGCI
Sbjct  103  EPPSQEEVTLMLQEVDGGGDGCI  125



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 60/90 (67%), Gaps = 14/90 (16%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEA  93
            G +KP   STPTSV+P         E+SG     Y ELVQAFKLIDRDDDG + + EL A
Sbjct  50   GDRKPSPASTPTSVIP---------EISGGDRDFYTELVQAFKLIDRDDDGVVSRNELAA  100

Query  92   LLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +L ++  EPPS EE+R+ML EVD  GDGCI
Sbjct  101  VLRRLSPEPPSEEEVRMMLREVD-GGDGCI  129



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 7/83 (8%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAEL--VQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            GG +TPTSVLP    E S D  S   A+L   QAFKLIDRD+DG + ++ELEALLS++G 
Sbjct  57   GGIATPTSVLP----EKSGD-WSDFSADLDMAQAFKLIDRDNDGVVSRKELEALLSRLGN  111

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            +PPS+EE+ LMLSEVDRDG+G I
Sbjct  112  DPPSQEEVTLMLSEVDRDGNGSI  134


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  42
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  135  TLEALLNQVGPVSGPAADSELRDAFEVXDTDNDGKISAEELLRVFTAIGDERCTLEECRR  194

Query  41   MLSEVDRDGDGCI  3
            M+  VD+DGDG +
Sbjct  195  MIDGVDKDGDGFV  207



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            + GG  TPTSVL   + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALLS++GA
Sbjct  62   EAGGIGTPTSVLLERSGDWS-DFSTDLQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGA  120

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            +PPS+EE+ LMLSEVDR+G+G I
Sbjct  121  DPPSQEEVMLMLSEVDREGNGSI  143



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = -1

Query  221  VLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  45
            VLP+ N +  P E+S  +Y+ELVQAF++ID D DGKI KEEL A+L++VG++PP+ EEL 
Sbjct  81   VLPSTNTQW-PSEISAEVYSELVQAFQMIDGDGDGKIHKEELSAILTRVGSDPPTEEELV  139

Query  44   LMLSEVDRDGDGCI  3
             +L+EVD +GDGCI
Sbjct  140  QLLNEVDVNGDGCI  153



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 9/86 (10%)
 Frame = -1

Query  254  KKPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  78
             KPGG  +TPTSVLP    E S         ++ QAF+LIDRD+DG + + ELEALL ++
Sbjct  46   HKPGGPAATPTSVLPGDWSEFS-------SVDMAQAFRLIDRDNDGVVSRTELEALLKRL  98

Query  77   -GAEPPSREELRLMLSEVDRDGDGCI  3
             GAEPP++EE+ +MLSEVD DGDGCI
Sbjct  99   LGAEPPTQEEVAMMLSEVDGDGDGCI  124


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL +AF++ D D DGKI  EEL ++ + +G E  + EE R M++EVD++GDG +
Sbjct  143  SELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFV  197



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 7/83 (8%)
 Frame = -1

Query  242  GESTPTSVLPALNDEISPDEL---SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            G  TPTSVLP    E S D L   +  Y EL QAFK +D+D+DG I + E+EALLS+   
Sbjct  61   GTGTPTSVLP----ETSVDWLDFSANFYVELCQAFKTMDKDNDGVITRSEVEALLSKFAR  116

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            +PPS+EE+  ML EVD DGDGCI
Sbjct  117  QPPSQEEISSMLGEVDGDGDGCI  139



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 61/90 (68%), Gaps = 5/90 (6%)
 Frame = -1

Query  260  GYKKP----GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEA  93
            G++ P     G  TPTSVLP  + + S D  +  Y EL QAFK++D+D+DG I + ELEA
Sbjct  52   GHQYPSAATAGFVTPTSVLPQTSGDWS-DFPANFYLELCQAFKMLDKDNDGVISRSELEA  110

Query  92   LLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            LL +V  +PPSR E+ LMLSEVD DGDG I
Sbjct  111  LLGKVARQPPSRIEVSLMLSEVDGDGDGYI  140



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  69
            GG +TPTSVL   + + S  E S  L  ++ +AFKLIDRD+DG + ++ELEALL Q+G  
Sbjct  116  GGVTTPTSVLAERSGDWS--EFSADLQLDMAKAFKLIDRDNDGVVSRKELEALLCQLGNN  173

Query  68   PPSREELRLMLSEVDRDGDGCI  3
            PPS+EE+ LMLSEVDRDG G I
Sbjct  174  PPSQEEVTLMLSEVDRDGSGSI  195


 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  42
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  196  TLEALLNQVGPVSGPPADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  255

Query  41   MLSEVDRDGDGCI  3
            M++EVD++GDG +
Sbjct  256  MIAEVDKNGDGFV  268



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = -1

Query  254  KKPGGESTPTSVLPALNDEISPDELSG----LYAELVQAFKLIDRDDDGKIRKEELEALL  87
            +KP   STP SVLP ++ + S  ++S      YAELVQAFKLIDRDDDG + + EL ALL
Sbjct  51   RKPDPASTPISVLPEISGDWS--QISAGDRDFYAELVQAFKLIDRDDDGMVSRSELAALL  108

Query  86   SQVGAEPPSREELRLMLSEVDRDGDGCI  3
            S++  +PPS+EE+ +ML  VD   DGCI
Sbjct  109  SRLSPDPPSQEEVSMMLRVVDGGDDGCI  136



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 4/81 (5%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  50   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  105

Query  65   PSREELRLMLSEVDRDGDGCI  3
            P+ EE+ +ML EVD DGDG I
Sbjct  106  PTEEEIDVMLKEVDCDGDGTI  126



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG +TPTSVLP  + + S D  + L  ++ QAFKLIDRD+DG + ++ELEALL ++G  P
Sbjct  128  GGITTPTSVLPEKSGDWS-DFSADL--DMAQAFKLIDRDNDGVVSRKELEALLCRLGNAP  184

Query  65   PSREELRLMLSEVDRDGDGCI  3
            PS+EE+ LMLSEVDRDG+G I
Sbjct  185  PSQEEVTLMLSEVDRDGNGSI  205


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  42
             L AL +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R 
Sbjct  206  TLEALLNQVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRR  265

Query  41   MLSEVDRDGDGCI  3
            M+  VD+DGDG +
Sbjct  266  MIDGVDKDGDGFV  278



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 4/81 (5%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  65   PSREELRLMLSEVDRDGDGCI  3
            P+ EE+ +ML EVD DGDG +
Sbjct  101  PTEEEIDVMLREVDCDGDGTV  121



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 10/86 (12%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + ++EL ALLS+
Sbjct  42   GNLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKELAALLSR  93

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  EPPS+EE+ +ML EV  D DGCI
Sbjct  94   LSPEPPSQEEVSMMLREV--DADGCI  117



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYA--ELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
             G  TPTSVLP ++ + +  + S  Y+  ELVQAFKLID+D+DG + +++LEALLS++G 
Sbjct  46   AGTVTPTSVLPEVSGDFAAVDASYPYSYLELVQAFKLIDKDNDGAVSRQDLEALLSRLGP  105

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            +P S+EE+ +ML ++DRDGDG I
Sbjct  106  DPLSQEEIDVMLGDLDRDGDGAI  128


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -1

Query  197  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  18
            +S  +LS   AEL + F+  D D DG I  EEL  + + +G E  + E+ R M++ VD D
Sbjct  138  VSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIAAVDED  197

Query  17   GDGCI  3
            GDG +
Sbjct  198  GDGFV  202



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 59/81 (73%), Gaps = 4/81 (5%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  45   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  100

Query  65   PSREELRLMLSEVDRDGDGCI  3
            P+ EE+ +ML EV+ DGDG +
Sbjct  101  PTEEEIDVMLKEVNCDGDGTV  121



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 56/86 (65%), Gaps = 10/86 (12%)
 Frame = -1

Query  251  KPGG-ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  75
            KP G  +TP SVLP       P      Y ELVQAFKLIDRDDDG + + +L ALLS++ 
Sbjct  51   KPAGPTATPISVLP-------PQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLS  103

Query  74   AEPPSREELRLMLSEVDRDGD--GCI  3
             EPPS+EE+ LML EVD D D  GCI
Sbjct  104  PEPPSQEEVSLMLKEVDGDNDDGGCI  129



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  65   PSREELRLMLSEVD  24
            PS +E+ +ML EVD
Sbjct  115  PSSQEMAVMLGEVD  128



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  221  VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRL  42
            VLP+   +   +  + +Y+ELVQAF++ID D DGKI KEE+ A+L++VG++PP+ EEL  
Sbjct  47   VLPSTTTQWPSEIPAEVYSELVQAFQMIDVDGDGKIHKEEISAILTRVGSDPPTEEELVQ  106

Query  41   MLSEVDRDGDGCI  3
            +L+EVD +GDGCI
Sbjct  107  LLNEVDVNGDGCI  119



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 4/81 (5%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++   SP      Y E++QAFKLIDRD+DG + + +LE+LL+++G +P
Sbjct  82   GGSVTPTSILPEVSAVHSPYS----YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDP  137

Query  65   PSREELRLMLSEVDRDGDGCI  3
             + EE+ +ML EVD DGDG +
Sbjct  138  LTEEEIDVMLKEVDCDGDGTV  158



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -1

Query  242  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  63
            G  TPTS+LP ++ + + D  + LY EL QAFKLIDRD+DG + + ELEALL+++GAEPP
Sbjct  54   GFRTPTSILPQVSGDWT-DISADLYFELTQAFKLIDRDNDGLVSRNELEALLTRLGAEPP  112

Query  62   SREELRLMLSEVDR  21
            S EE+ ++L EVD 
Sbjct  113  SSEEMAVILGEVDH  126



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 10/86 (12%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  EPPS EE+ +ML EV  D DGCI
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCI  117



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 10/86 (12%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  KPG  +TP SVLP  + +         Y+ELV+AFKLIDRDDDG + +++L ALLS+
Sbjct  42   GKLKPGPAATPVSVLPQSSGD--------FYSELVEAFKLIDRDDDGVVSRKDLAALLSR  93

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  EPPS EE+ +ML EV  D DGCI
Sbjct  94   LSPEPPSPEEVSMMLREV--DADGCI  117



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 4/81 (5%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++ + SP      Y E++ AF+LIDRD+DG + + +L +LLS++G +P
Sbjct  49   GGSVTPTSILPEVSGDPSPYS----YVEILHAFQLIDRDNDGAVTRRDLSSLLSRLGPDP  104

Query  65   PSREELRLMLSEVDRDGDGCI  3
            PS EE+ +ML EVD DG+G I
Sbjct  105  PSEEEIDVMLREVDCDGEGTI  125



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
             G  TPTSVLP ++ + S D  +  Y EL QAFK+IDRD+DG + + ELEALL+++GAEP
Sbjct  56   AGFRTPTSVLPQISGDWS-DMSTDFYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEP  114

Query  65   PSREELRLMLSEVDR  21
            PS EE+ +ML E D 
Sbjct  115  PSSEEMAVMLGERDH  129



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = -1

Query  254  KKPGGESTPTSVLPALNDEISPDEL--SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
             KPG  +TP SVLP ++ + S      S LY+ELVQAFKLIDRDDDG + + EL ALL++
Sbjct  51   HKPGPAATPISVLPEISGDWSQVSAGDSDLYSELVQAFKLIDRDDDGAVSRSELAALLTR  110

Query  80   VGAEPPSREELRLMLSEVD  24
            +  EPPS++E+ +ML E D
Sbjct  111  LSPEPPSQDEVSMMLREAD  129



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G EP
Sbjct  47   GGSVTPTSILPEVPSPYS-------YIEILQAFKLIDRDNDGAVSRHDLESLLSRLGPEP  99

Query  65   PSREELRLMLSEVDRDGDGCI  3
             + EE+ +M+ EVD DGDG I
Sbjct  100  LTEEEINVMIKEVDGDGDGTI  120



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 8/84 (10%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  KPG  +TP SVLP  + +         Y ELVQAFKLIDRD DG + + +L ALLS+
Sbjct  46   GNLKPGPTATPISVLPHNSGD--------FYTELVQAFKLIDRDHDGVVSRGDLAALLSR  97

Query  80   VGAEPPSREELRLMLSEVDRDGDG  9
            +  EPPS+EE+ LML EVD D DG
Sbjct  98   LSPEPPSQEEVSLMLKEVDGDDDG  121



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 8/86 (9%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  K G  +TP SVLP  + +         YAEL+QAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYAELIQAFKLIDRDDDGVVSRGDLAALISR  97

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  EPPS+EE+ LML EVD    GCI
Sbjct  98   LSPEPPSQEEVSLMLREVDGGDGGCI  123



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  EPPS+EE+ LML EVD    GCI
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCI  123



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = -1

Query  248  PGGESTPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  78
            P    TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++
Sbjct  50   PDRVGTPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRL  109

Query  77   GAEPPSREELRLMLSEVDRDGDGCI  3
            GA+PP++EE++ MLSEVDR+GDG I
Sbjct  110  GADPPTQEEVKSMLSEVDREGDGYI  134



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  K G  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVLPQNSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  97

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  EPPS+EE+ LML EVD    GCI
Sbjct  98   LSHEPPSQEEVSLMLREVDGGDGGCI  123



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = -1

Query  233  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  63
            TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  62   SREELRLMLSEVDRDGDGCI  3
            ++EE++ MLSEVDR+GDG I
Sbjct  115  TQEEVKSMLSEVDREGDGYI  134



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 5/77 (6%)
 Frame = -1

Query  233  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  54
            TP SVLP L+ + S D  S  ++ELVQAFKL+D D+DG + + +LE+LL ++GAE    E
Sbjct  53   TPPSVLPDLSGDWS-DVSSDFFSELVQAFKLMDNDNDGIVSRTQLESLLIRLGAE----E  107

Query  53   ELRLMLSEVDRDGDGCI  3
            E+  MLSEVDRDGDGCI
Sbjct  108  EVATMLSEVDRDGDGCI  124



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = -1

Query  233  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  63
            TPTSVL  ++    ++S D    L  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  62   SREELRLMLSEVDRDGDGCI  3
            ++EE+  MLSEVDR+GDG I
Sbjct  115  TQEEVSSMLSEVDREGDGYI  134



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 3/78 (4%)
 Frame = -1

Query  233  TPTSVLPALN---DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  63
            TPTSVL  ++    ++S D    +  ELVQA KL+DRD+DG + + ELEALL ++GA+PP
Sbjct  55   TPTSVLHEISGDWSDMSADISLDMNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPP  114

Query  62   SREELRLMLSEVDRDGDG  9
            ++EE++ MLSEVDR+GDG
Sbjct  115  TQEEVKSMLSEVDREGDG  132



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 67/83 (81%), Gaps = 7/83 (8%)
 Frame = -1

Query  233  TPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAE  69
            TPTSVLP L++EIS D+ S     G+Y++LVQAF +ID + DGKIRKE+LEA+LS+VG +
Sbjct  44   TPTSVLPTLSNEISADDWSEISTAGVYSDLVQAFSVID-NGDGKIRKEQLEAILSRVGGK  102

Query  68   -PPSREELRLMLSEVDRDGDGCI  3
             PP+ EEL L+L E+D++GDGCI
Sbjct  103  SPPTEEELVLLLDELDKNGDGCI  125



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            KPG  +TP SVLP  + + S  ++SG    Y++L+QAFKLIDRDDDG + + +L ALLS+
Sbjct  50   KPGPAATPVSVLPENSGDWS--QISGDRDFYSDLIQAFKLIDRDDDGVVSRGDLAALLSR  107

Query  80   VGAEPPSREELRLMLSEVD-RDGDGCI  3
            +  +PPS+EE+ LML EVD  +  GCI
Sbjct  108  LSPDPPSQEEVSLMLREVDGGEESGCI  134



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = -1

Query  230  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  51
            PTS+LP    EISP   S  Y E++++F LIDR++DG I K +LE+LLS++G EP + EE
Sbjct  41   PTSILP----EISPSPYS--YVEILKSFSLIDRNNDGAISKHDLESLLSKLGPEPLTEEE  94

Query  50   LRLMLSEVDRDGDGCI  3
            + +M+ EVDRDGDG I
Sbjct  95   IDVMIKEVDRDGDGTI  110



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  242  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  63
            G  TPTS+LP ++ + + D  + LY EL QAFKLID D+DG + + ELEALL+++GAEPP
Sbjct  49   GFRTPTSILPQVSGDWT-DISNDLYFELTQAFKLIDGDNDGLVSRSELEALLTRLGAEPP  107

Query  62   SREELRLMLSEVDR  21
            S EE+ ++L EVD 
Sbjct  108  SSEEMAVILGEVDH  121



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 7/84 (8%)
 Frame = -1

Query  236  STPTSVLPALNDEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            STPTSVLP L++EIS DE S     G+Y++LV+AF +ID + DGKI+KE+LEA+LS+VG 
Sbjct  41   STPTSVLPTLSNEISADEWSDISTAGVYSDLVRAFSVID-NGDGKIKKEKLEAILSRVGG  99

Query  71   E-PPSREELRLMLSEVDRDGDGCI  3
            + PPS EEL L+L E+D +GDGCI
Sbjct  100  KSPPSEEELVLLLDELDENGDGCI  123


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = -1

Query  200  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  21
            E +P   +G   E+  AF   D D DGKI  EEL  +   +G E  + EE + M++ VD+
Sbjct  136  ESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELFNVFRMIGDERCTLEECKRMITSVDK  195

Query  20   DGDGCI  3
            +GDG +
Sbjct  196  NGDGFV  201



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 4/81 (5%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTSVLP ++ + S D    +  EL QAF+LIDRD+DG + +EELE +L+++GA  
Sbjct  52   GGSQTPTSVLPEISGDWS-DVTVDVQWELSQAFRLIDRDNDGVVSREELELVLTRLGARA  110

Query  65   PSREELRLMLSEVDRDGDGCI  3
               EE+ +ML+EVD DG GCI
Sbjct  111  ---EEIAIMLTEVDGDGRGCI  128



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL QAFK+ID+D+DG I + ELEALLS+V  +PPSREE+ LMLSEV  DG GCI
Sbjct  35   SELCQAFKIIDKDNDGVITRSELEALLSKVARQPPSREEVSLMLSEVYGDGVGCI  89



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = -1

Query  224  SVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  48
            SVLP  + E S  E S  L  ++ QAFK IDRD+DG + ++ELEALL ++G +P SREE+
Sbjct  65   SVLPERSGEWS--EFSADLQLDMAQAFKXIDRDNDGVVSRKELEALLCRLGNDPQSREEV  122

Query  47   RLMLSEVDRDGDGCI  3
             LMLSEVDRDG+G I
Sbjct  123  TLMLSEVDRDGNGSI  137



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 7/77 (9%)
 Frame = -1

Query  233  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  54
            TPTS+LP +    S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + E
Sbjct  54   TPTSILPEVPSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEE  106

Query  53   ELRLMLSEVDRDGDGCI  3
            E+ +ML EVD DGDG I
Sbjct  107  EINVMLKEVDCDGDGTI  123



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            K GG +TP SVL + + EIS D     +  + +LV+AFK IDRD DGKI + ELE +LS+
Sbjct  48   KEGGATTPRSVLHSHSHEISGDWSDLQADFHFQLVEAFKFIDRDGDGKITRRELENILSR  107

Query  80   VGAEPPS--REELRLMLSEVDRDGDGCI  3
            +GA+ PS   + + + L EVDRDGDGCI
Sbjct  108  LGADTPSEEMQMMLMELMEVDRDGDGCI  135



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 52/86 (60%), Gaps = 9/86 (10%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  K G  +TP SV     D          Y ELVQAFKLIDRDDDG + + +L AL+S+
Sbjct  46   GNLKQGPTATPISVSSNSGD---------FYTELVQAFKLIDRDDDGVVSRGDLAALISR  96

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  EPPS+EE+ LML EVD    GCI
Sbjct  97   LSHEPPSQEEVSLMLREVDGGDGGCI  122



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 8/75 (11%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSP  101

Query  71   EPPSREELRLMLSEV  27
            EPPS+EE+ LML EV
Sbjct  102  EPPSQEEVSLMLKEV  116



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 7/77 (9%)
 Frame = -1

Query  233  TPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  54
            TPTS+LP ++   S       Y E++QAFKLIDRD+DG + + +LE+LLS++G +P + +
Sbjct  57   TPTSILPDVSSPYS-------YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTED  109

Query  53   ELRLMLSEVDRDGDGCI  3
            E+ +M+ EVD DGDG I
Sbjct  110  EISVMIQEVDCDGDGAI  126



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 8/75 (11%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            KPG  +TP SVLP  + +         Y ELVQAFKLIDRDDDG + + +L ALLS++  
Sbjct  50   KPGPTATPISVLPQSSGD--------FYTELVQAFKLIDRDDDGVVSRGDLAALLSKLSP  101

Query  71   EPPSREELRLMLSEV  27
            EPPS+EE+ LML EV
Sbjct  102  EPPSQEEVSLMLKEV  116



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 55/88 (63%), Gaps = 11/88 (13%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
             +K     +TP SVLP           S  ++EL+QAFKLIDRDDDG + + +L  L+S+
Sbjct  51   NHKPNPSSTTPISVLPWSG--------SDFHSELIQAFKLIDRDDDGVVSRRDLANLISK  102

Query  80   VGAEPPSREELRLMLSEVDRDG--DGCI  3
            +  EPPS EE+ LML EVD DG  DGCI
Sbjct  103  LSPEPPSHEEVSLMLREVD-DGEEDGCI  129



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 5/85 (6%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ---VG  75
            GG  TPTSVLP ++ ++S D  + +++EL +AFKLIDRD+DG + ++ELEALLS+   VG
Sbjct  58   GGSVTPTSVLPEISGDLS-DFSADIHSELAEAFKLIDRDNDGIVSRKELEALLSRLGGVG  116

Query  74   AEPPSREELRLMLSEVD-RDGDGCI  3
            +   S + +  MLSEVD  DG+GCI
Sbjct  117  SISESEDFVASMLSEVDGGDGEGCI  141



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  51   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  108

Query  65   PSREELRLMLSEVDRDGD  12
             + +E+ +M+ EV  +GD
Sbjct  109  LTEDEINVMIKEVGCEGD  126



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  YAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            + EL++AF LID+D+DG + + +LEALL+Q+G  PP+++E+ +ML EVDRDG G I
Sbjct  54   HLELLKAFTLIDKDNDGAVSRHDLEALLTQLGPNPPNKDEINVMLREVDRDGHGTI  109



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  DDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            D DGKI K ELEALLS+VG EPPS EE+ +MLSEVDRDGDGCI
Sbjct  48   DGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCI  90



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++   SP   S  Y E++QAFKLIDRD+DG I + +LE+LL+++G +P
Sbjct  53   GGSVTPTSILPEVSCNPSPPPYS--YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDP  110

Query  65   PSREELRLMLSEV  27
             + +E+ +M+ EV
Sbjct  111  LTEDEINVMIKEV  123



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
            GG  TPTS+LP ++ + SP      Y E++QAFKLIDRD+DG I + +LE+LLS++G +P
Sbjct  51   GGSVTPTSILPEVSCDTSPPPPYS-YVEILQAFKLIDRDNDGAISRHDLESLLSRLGPDP  109

Query  65   PSREELRLMLSEV  27
             + +E+ +M+ EV
Sbjct  110  LTEDEINVMIKEV  122



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
             +K   G  TPTSVLP ++ + S      +  +L QAF+LIDRD+DG + +++LEALL+ 
Sbjct  48   NHKPSAGNQTPTSVLPGVSGDWSDVAAVDVRWDLAQAFRLIDRDNDGVVTRQDLEALLTC  107

Query  80   VGAEPPSREELRLMLSEVDRDG  15
            +GA  P  +++ +ML EVD DG
Sbjct  108  LGAS-PCPDDVAVMLGEVDGDG  128


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +
Sbjct  150  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFV  203



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = -1

Query  248  PGGESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
             G ++TP SVL A + +    + PDE+S     L+  F + D D DGKI K ELEA+L +
Sbjct  55   TGLQTTPRSVLQAAHGKTPLFLFPDEVS-----LLDLFNMFDCDGDGKITKRELEAVLRR  109

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +  + P+ EE+  M++E+DRDGDGCI
Sbjct  110  LVPDAPTAEEVASMVAEMDRDGDGCI  135



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 9/79 (11%)
 Frame = -1

Query  245  GGES-TPTSVLP-----ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLS  84
            GGE+ TPTSVLP       +D  S  E++G   ELV+AF  ID D+DG + +E+LEALLS
Sbjct  47   GGEARTPTSVLPPQLSGEWSDVASSSEMNG---ELVRAFTYIDGDNDGVLSREDLEALLS  103

Query  83   QVGAEPPSREELRLMLSEV  27
            ++GAEP S +E  LML EV
Sbjct  104  RLGAEPLSADEKALMLREV  122



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 59/101 (58%), Gaps = 15/101 (15%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPA---LNDEISPDELSG---LYAEL--------VQAFKLIDRDDD  123
            G+   G  STP SVLPA   L     P   +G   L+  L         + F + D D D
Sbjct  42   GFISSGLHSTPRSVLPASPGLRPAEKPPSAAGSNDLWLFLPASSSSSVSELFAVFDCDGD  101

Query  122  GKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCI  3
            GKI ++ELEA+L ++G A+PP+ EE+  M++EVDRDGDGCI
Sbjct  102  GKITRQELEAVLRRLGGADPPTEEEVASMVAEVDRDGDGCI  142



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 54/81 (67%), Gaps = 6/81 (7%)
 Frame = -1

Query  245  GGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEP  66
             G  TPTSVLP ++ + S D    +  +L QAF+LIDRD+DG + +++LEA+L+++GA  
Sbjct  54   AGSLTPTSVLPGVSGDWS-DVTVDVRWDLAQAFRLIDRDNDGVVSRQDLEAVLTRLGA--  110

Query  65   PSREELRLMLSEVDRDGDGCI  3
                ++ LMLSEV+    GCI
Sbjct  111  ---SDVALMLSEVEGGAGGCI  128


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF + D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +
Sbjct  149  ELKEAFAVFDTDRDGRISAEELLRVFRAIGDERCTLEECRRMIEGVDRNGDGFV  202



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 52/83 (63%), Gaps = 9/83 (11%)
 Frame = -1

Query  239  ESTPTSVLPALNDE----ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            ++TP SVLP  + +      PDE     A  +  F + D D DGKI K ELEA+L ++  
Sbjct  59   QATPRSVLPPDHGKAPVVFLPDE-----AAWLDLFNVFDCDGDGKITKRELEAVLRRLVP  113

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            +PP+ EE+  M++EVDRDGDGCI
Sbjct  114  DPPTAEEVASMVAEVDRDGDGCI  136



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -1

Query  149  FKLIDRDDDGKIRKEELEALLSQVG-AEPPSREELRLMLSEVDRDGDGCI  3
            F + DRD DGKI + EL+A+L ++G A+PP+ EE+  M++EVDRDGDGCI
Sbjct  82   FAVFDRDGDGKITRHELQAVLRRLGGADPPTEEEVASMVAEVDRDGDGCI  131



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGL--YAELVQAFKLIDRDDDGKIRKEELEALL  87
             +K   G  TPTSVLP ++ E S    + +    +L QA +LIDRD+DG + +++LE+LL
Sbjct  49   NHKPSPGNQTPTSVLPDVSGEWSEVAAAAVDVRWDLAQALRLIDRDNDGVVTRQDLESLL  108

Query  86   SQVGAEPPSREELRLMLSEVDRDG  15
            +++GA  PS  ++ LML EVD DG
Sbjct  109  TRLGAS-PSPGDVALMLGEVDGDG  131


 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF++ D D DG+I  EEL  +   +G E  + EE R M+  VDR+GDG +
Sbjct  153  ELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVDRNGDGFV  206



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = -1

Query  239  ESTPTSVLPA-----LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  75
             STP S+LPA     +        LS   + +   F + DRD DGKI ++ELEA+L  +G
Sbjct  49   HSTPRSILPAGKPPSVAGSGEFWLLSPASSSVSDLFAVFDRDRDGKITRQELEAVLRGLG  108

Query  74   -AEPPSREELRLMLSEVDRDGDGCI  3
             A+PP+ EE+  M++EVD DGDGCI
Sbjct  109  GADPPTEEEVASMVAEVDLDGDGCI  133



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -1

Query  236  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  78
            STP SVLP    +            LS   + +   F + DRD DGKI   ELEA+L ++
Sbjct  48   STPRSVLPPPAGKTPSSSGSDDLWLLSPASSSVSDLFAVFDRDGDGKITPHELEAVLRRL  107

Query  77   GA-EPPSREELRLMLSEVDRDGDGCI  3
            G  +PP+ EE+  M++EVDRDGDGCI
Sbjct  108  GGVDPPTEEEVASMVAEVDRDGDGCI  133


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL +AF + D + DGKI  EEL  + S +G E  + E+ R M+  VD DGDG +
Sbjct  151  AELREAFAVFDANGDGKISAEELLGVFSTLGDEGCTLEDCRRMIGGVDTDGDGFV  205



>ref|XP_010924246.1| PREDICTED: probable calcium-binding protein CML35 [Elaeis guineensis]
Length=320

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -1

Query  236  STPTSVLPALNDEISPDE-------LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  78
            STP SVLP    +            LS   + +   F + +RD DGKI   ELEA+L  +
Sbjct  67   STPCSVLPPPTGKTPSSSRSDDLWLLSPASSSISNLFIIFNRDGDGKIMPHELEAILCHL  126

Query  77   -GAEPPSREELRLMLSEVDRDGDGCI  3
             GA PP++EEL  M+ EV+RD +GCI
Sbjct  127  HGANPPTKEELASMVVEVNRDDNGCI  152



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = -1

Query  242  GESTPTSV---LPALNDEISP-DELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  75
            G+++PT+     P +N   S  +  S L  EL Q FK  D + DGKI   EL ++L  VG
Sbjct  18   GDTSPTTAPVQAPMINSRSSSLNGRSRLEEELEQVFKKFDVNGDGKISASELGSILGSVG  77

Query  74   AEPPSREELRLMLSEVDRDGDGCI  3
             +P + EELR+M+ EVD DGDG I
Sbjct  78   -QPATEEELRIMIQEVDADGDGFI  100



>ref|XP_002671503.1| predicted protein [Naegleria gruberi]
 gb|EFC38759.1| predicted protein [Naegleria gruberi]
Length=156

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -1

Query  173  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            L  EL  AF L D+D DGKI  EEL A+L ++G + PS EEL+LM S+VD+D +G I
Sbjct  10   LVNELKDAFSLFDQDGDGKISIEELGAVLKKLG-QCPSAEELQLMFSDVDQDNNGTI  65



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPSSDEELNSMISEVDSDGDGFI  108



>ref|XP_009770094.1| PREDICTED: calmodulin-like [Nicotiana sylvestris]
Length=147

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D +S D++S    EL +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEDQIS----ELREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  29   VDRDGDGCI  3
            VD DGDG I
Sbjct  56   VDPDGDGTI  64



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 7/81 (9%)
 Frame = -1

Query  242  GES-TPTSVLPALNDEISPDE--LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            GES TPTSVL              +G   EL +AF LIDRD DG + ++ELEALLS++G 
Sbjct  56   GESLTPTSVLGRGGGGGGGGGGVWAGSNLELARAFGLIDRDGDGILSRKELEALLSRLG-  114

Query  71   EPPSREELRLMLSEVDRDGDG  9
               SR+E+ +MLSEV   G+G
Sbjct  115  ---SRDEVAVMLSEVGCHGEG  132


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+  D D DGKI  EEL  + +  G E  + EE R M+SEVD++GDG +
Sbjct  157  AELRETFEFFDADHDGKITAEELLGVFAAFGDERCTLEECRRMISEVDKNGDGFV  211



>ref|XP_006351748.1| PREDICTED: calmodulin-5/6/7/8-like [Solanum tuberosum]
Length=147

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRMEELASVIQSLH-EHPTREEIQEMINE  55

Query  29   VDRDGDGCI  3
            VD DGDG I
Sbjct  56   VDPDGDGSI  64



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D ++ D++S    E  QAF +ID+D DG IR EEL +++  +  E P+REE++ M++E
Sbjct  1    MADALTEDQIS----EFRQAFWVIDKDCDGVIRIEELASVIQSLH-ENPTREEMQEMMNE  55

Query  29   VDRDGDGCI  3
            VD DGDG I
Sbjct  56   VDPDGDGTI  64



>ref|XP_003536119.1| PREDICTED: calmodulin-like protein 11-like [Glycine max]
 gb|KHN16197.1| Calmodulin-like protein 8 [Glycine soja]
Length=149

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD DG G I
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMDGSGTI  65



>gb|KDP21392.1| hypothetical protein JCGZ_21863 [Jatropha curcas]
Length=229

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 5/65 (8%)
 Frame = -1

Query  197  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  18
            IS +E+    AE  +AF +ID+D DG I  EEL A++  +    P++EE+R M+SEVD D
Sbjct  100  ISANEI----AEFHEAFSMIDKDSDGFITMEELAAIIQSLDG-HPTKEEVREMISEVDFD  154

Query  17   GDGCI  3
            G+G I
Sbjct  155  GNGTI  159


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF +ID+D DG I  EEL A++  +    P++EE+R M+SEVD DG+G I
Sbjct  11   AEFHEAFSMIDKDSDGFITMEELAAIIQSLDG-HPTKEEVREMISEVDFDGNGTI  64



>gb|ERG81872.1| calmodulin-2 [Ascaris suum]
Length=163

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = -1

Query  215  PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  36
             A  ++I  D L+    E+ +AF + DRD DG+I  +EL A++  +G E PS  ELR M+
Sbjct  7    SATFEQIESDRLT----EIREAFSVFDRDGDGRITVDELGAVMDSLG-EHPSESELRRMI  61

Query  35   SEVDRDGDGCI  3
            SE D DG+G I
Sbjct  62   SEFDEDGNGTI  72



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL Q FK  D + DGKI   EL A++S +G +P S EEL  M+SEVD DGDG I
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPASDEELNGMISEVDSDGDGFI  175



>ref|XP_003556466.1| PREDICTED: calmodulin-like protein 8-like isoform X1 [Glycine 
max]
 ref|XP_006606459.1| PREDICTED: calmodulin-like protein 8-like isoform X2 [Glycine 
max]
Length=149

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD +G G I
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMNGSGTI  65



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = -1

Query  257  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  78
            + +P       S  P+ +  +S    + L  EL Q FK  D + DGKI   EL +++  +
Sbjct  7    FNRPKDMIPSASSTPSRSTSLSVHSRARLAGELEQVFKKFDVNGDGKISASELGSIMGSL  66

Query  77   GAEPPSREELRLMLSEVDRDGDGCI  3
            G +P + +EL  M+ EVD DGDGCI
Sbjct  67   G-QPATEQELDNMIREVDGDGDGCI  90



>gb|KHN04934.1| Calmodulin-like protein 8 [Glycine soja]
Length=149

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  LYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            L  E ++AF L DRD DG I  EEL + L  +    P +EEL++M++EVD +G G I
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMNGSGTI  65



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL Q FK  D + DGKI   EL A++S +G +  S EEL  M+SEVD DGDG I
Sbjct  50   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QASSDEELNSMISEVDSDGDGFI  103



>dbj|BAJ85572.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87358.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91714.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = -1

Query  200  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  21
            ++SP   +   AEL + F+L DR+ DG+I +EELE  L ++G   P  +EL  M++ +D 
Sbjct  41   KMSPSVKAADRAELARVFELFDRNGDGRITREELEDSLGKLGIPVPG-DELAAMIARIDA  99

Query  20   DGDGCI  3
            DGDGC+
Sbjct  100  DGDGCV  105



>ref|XP_007910199.1| PREDICTED: calmodulin-A-like [Callorhinchus milii]
Length=191

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -1

Query  248  PGGESTPTSVLPALN-DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            PG  ++ +   P LN D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G 
Sbjct  29   PGATASDSHHTPKLNADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-  83

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            + P+  EL+ M++EVD DG+G I
Sbjct  84   QNPTEAELQDMINEVDADGNGTI  106



>ref|NP_001147205.1| calmodulin [Zea mays]
 gb|ACG26073.1| calmodulin [Zea mays]
Length=226

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            G  AEL + F+L D+D DG+I +EEL   L ++G   P  +EL  M++ VD +GDGC+
Sbjct  64   GESAELARVFELFDKDGDGRITREELAESLRKLGMGVPGDDELASMMARVDANGDGCV  121



>gb|EMT24894.1| Putative calcium-binding protein CML22 [Aegilops tauschii]
Length=174

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = -1

Query  197  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRD  18
            +SP   +   AEL + F+L DR+ DG+I +EELE  L ++G   P  +EL  M++ +D D
Sbjct  1    MSPSVKAADRAELARVFELFDRNGDGRITREELEDSLGKLGIPRPG-DELAAMIARIDAD  59

Query  17   GDGCI  3
            GDGC+
Sbjct  60   GDGCV  64



>ref|XP_006014812.1| PREDICTED: calmodulin [Alligator sinensis]
Length=200

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 53/86 (62%), Gaps = 11/86 (13%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G+KKP  ++T ++      D+++ +++    AE  +AF L D+D DG I  +EL  ++  
Sbjct  41   GFKKPKSQATWSA------DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRS  90

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +G + P+  EL+ M++EVD DG+G I
Sbjct  91   LG-QNPTEAELQDMINEVDADGNGTI  115



>ref|XP_011416014.1| PREDICTED: calmodulin-A-like isoform X2 [Crassostrea gigas]
Length=149

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F L D+D DG +  +EL  ++ Q+G E PS EELR M++EVD DG G I
Sbjct  10   AELRETFLLFDKDGDGTVNSDELGTVMRQLGQE-PSEEELRQMIAEVDEDGSGEI  63



>ref|XP_011079925.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF LID+D DG I  EEL +++  +  E P+ EE++ M+SEVD DGDG +
Sbjct  11   AEFREAFSLIDKDSDGVITVEELTSVMQSLN-EHPTMEEIQEMVSEVDGDGDGTV  64



>ref|XP_011416012.1| PREDICTED: calmodulin-A-like isoform X1 [Crassostrea gigas]
Length=162

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F L D+D DG +  +EL  ++ Q+G E PS EELR M++EVD DG G I
Sbjct  23   AELRETFLLFDKDGDGTVNSDELGTVMRQLGQE-PSEEELRQMIAEVDEDGSGEI  76



>ref|XP_003580040.2| PREDICTED: probable calcium-binding protein CML22 [Brachypodium 
distachyon]
Length=265

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L+DR+ DG+I +EELE  L ++G   P  +EL  M++ +D DGDGC+
Sbjct  105  AELSRVFQLLDRNGDGRITREELEDCLGKLGIPVPG-DELAAMIARIDADGDGCV  158



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFI  92



>gb|ACN35459.1| unknown [Zea mays]
 tpg|DAA37171.1| TPA: calmodulin [Zea mays]
Length=222

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L D+D DG+I +EEL   L ++G   P  +EL  M++ VD +GDGC+
Sbjct  67   AELARVFELFDKDGDGRITREELAESLRKLGMGVPGDDELASMMARVDANGDGCV  121



>gb|ACG37753.1| calmodulin [Zea mays]
Length=222

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L D+D DG+I +EEL   L ++G   P  +EL  M++ VD +GDGC+
Sbjct  67   AELARVFELFDKDGDGRITREELAESLRKLGMGVPGDDELASMMARVDANGDGCV  121



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 43/84 (51%), Gaps = 6/84 (7%)
 Frame = -1

Query  254  KKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  75
            +K    S   +  P++N     +E      EL Q FK  D + DGKI   EL A+   +G
Sbjct  4    RKAKASSGAMNSTPSMNSRAQIEE------ELEQVFKKFDVNGDGKISGSELGAIFRSLG  57

Query  74   AEPPSREELRLMLSEVDRDGDGCI  3
             E  + EEL+ M+ EVD DGDG I
Sbjct  58   GEAMAEEELKSMIREVDSDGDGFI  81



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL Q FK  D + DGKI   EL A++S +G +P + EEL  M+ EVD DGDG I
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFI  92



>ref|XP_011082591.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF +ID+D DG I  EEL +++  +  E P++EE+R M+ EVD DGDG +
Sbjct  11   AEFREAFCVIDKDSDGVITVEELASVIQSLN-EHPTKEEIREMMHEVDADGDGTV  64



>ref|XP_009617304.1| PREDICTED: calmodulin-like [Nicotiana tomentosiformis]
Length=147

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D +S +++S    E  +AF +ID+D DG IR EEL A++  +  E P++EE++ M++E
Sbjct  1    MADALSEEQIS----EFREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNE  55

Query  29   VDRDGDGCI  3
            VD DGDG I
Sbjct  56   VDPDGDGTI  64



>ref|XP_966558.2| PREDICTED: neo-calmodulin-like [Tribolium castaneum]
 ref|XP_008194563.1| PREDICTED: neo-calmodulin-like [Tribolium castaneum]
Length=206

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = -1

Query  239  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  60
            E+ P + L A + E+S  ++     E  +AF+L D+D DG I KEEL  ++  +G +   
Sbjct  23   ETKPPTRLSARHSEVSKSQMK----EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFAR  77

Query  59   REELRLMLSEVDRDGDGCI  3
             EEL+ ML EVD DGDG +
Sbjct  78   TEELQQMLQEVDVDGDGNV  96



>ref|XP_002090404.1| GE12824 [Drosophila yakuba]
 gb|EDW90116.1| GE12824 [Drosophila yakuba]
Length=198

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 8/85 (9%)
 Frame = -1

Query  257  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  78
            Y +PGG + P    P  N ++SP        +  Q F ++DRD  GKI   EL+A L   
Sbjct  10   YAQPGGYAPPPGAFPPQNAQVSP--------QAQQWFAMVDRDRSGKINASELQAALVNG  61

Query  77   GAEPPSREELRLMLSEVDRDGDGCI  3
              +  S    +LM+S  D D  G I
Sbjct  62   RGDHFSDNACKLMISMFDNDASGTI  86



>gb|EYC14046.1| hypothetical protein Y032_0042g679 [Ancylostoma ceylanicum]
Length=156

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL + FK  D++ DGKI KEELE  L Q+G E PS  ++  ++S+ D DG+GCI
Sbjct  17   SELREVFKEFDKNGDGKITKEELELALVQLG-EKPSNSKIDAIISQADTDGNGCI  70



>gb|EYC14045.1| hypothetical protein Y032_0042g679 [Ancylostoma ceylanicum]
Length=146

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL + FK  D++ DGKI KEELE  L Q+G E PS  ++  ++S+ D DG+GCI
Sbjct  7    SELREVFKEFDKNGDGKITKEELELALVQLG-EKPSNSKIDAIISQADTDGNGCI  60



>ref|XP_005483194.1| PREDICTED: calmodulin [Zonotrichia albicollis]
Length=183

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G  +P  +ST TS      D+++ +++    AE  +AF L D+D DG I  +EL  ++  
Sbjct  23   GASQPAFDSTGTSA-----DQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRS  73

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +G + P+  EL+ M++EVD DG+G I
Sbjct  74   LG-QNPTEAELQDMINEVDADGNGTI  98



>ref|XP_002415538.1| centrin, putative [Ixodes scapularis]
 gb|EEC19203.1| centrin, putative, partial [Ixodes scapularis]
Length=151

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -1

Query  248  PGGESTPTSV----LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            PG  STP +      PA N ++S +    + AE  +AF L D+D DG I  +EL  ++  
Sbjct  43   PGSASTPVTTGASPAPAQNMQLSEE----VIAEFREAFALFDKDGDGVISTKELGTVMRA  98

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +G + P+  EL+ M++EVD DG G I
Sbjct  99   LG-QNPTEAELKDMIAEVDIDGSGNI  123



>ref|NP_001150915.1| calmodulin-related protein 2, touch-induced [Zea mays]
 gb|ACG40934.1| calmodulin-related protein 2, touch-induced [Zea mays]
Length=199

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL  AF + D D DG+I   EL ++L+++G E  S EE R M++ VD DGDGC+
Sbjct  112  AELRAAFAVYDADGDGRITAAELGSVLARIG-EGCSAEECRRMIAGVDADGDGCV  165



>ref|XP_002520954.1| calmodulin, putative [Ricinus communis]
 gb|EEF41371.1| calmodulin, putative [Ricinus communis]
Length=148

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D ++ D++    AE  +AF LID+D DG I  EEL  ++  +    P++EE+R M+SE
Sbjct  1    MADALTEDQI----AEFHEAFCLIDKDSDGFITMEELATVIQSLDG-HPTKEEIRDMISE  55

Query  29   VDRDGDGCI  3
            VD DG+G I
Sbjct  56   VDFDGNGTI  64



>ref|XP_007144825.1| hypothetical protein PHAVU_007G187200g [Phaseolus vulgaris]
 gb|ESW16819.1| hypothetical protein PHAVU_007G187200g [Phaseolus vulgaris]
Length=149

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  GLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
             L  + ++AF L DRD DG I  EEL + +  +    P +EEL++M+SEVD +G+G I
Sbjct  8    NLIGDFLEAFCLFDRDGDGCITMEELASAIRVLNQNNPRKEELQVMMSEVDMNGNGMI  65



>gb|EYC14044.1| hypothetical protein Y032_0042g679 [Ancylostoma ceylanicum]
Length=180

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL + FK  D++ DGKI KEELE  L Q+G E PS  ++  ++S+ D DG+GCI
Sbjct  41   SELREVFKEFDKNGDGKITKEELELALVQLG-EKPSNSKIDAIISQADTDGNGCI  94



>gb|EAY86614.1| hypothetical protein OsI_07995 [Oryza sativa Indica Group]
Length=161

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L DRD DG+I +EEL   L ++G  P  REEL   ++ +D +GDGC+
Sbjct  7    AELRRVFELFDRDGDGRITREELTESLERLGM-PVHREELAATIARIDANGDGCV  60



>gb|KFO18269.1| Calmodulin [Fukomys damarensis]
Length=179

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 8/83 (10%)
 Frame = -1

Query  230  PTSVLPALNDEISPDELSGL-------YAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            P + LPA   +  P  L+          AE  +AF L D+D DG I  +EL  ++  +G 
Sbjct  13   PRATLPATTTDADPSTLAAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG-  71

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            + P+  EL+ M++EVD DG+G I
Sbjct  72   QNPTEAELQDMINEVDADGNGTI  94



>ref|XP_001785090.1| predicted protein [Physcomitrella patens]
 gb|EDQ50089.1| predicted protein [Physcomitrella patens]
Length=182

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = -1

Query  212  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  33
             LN EISPD        +  AF++ D+D D +I   EL+++L  +G +  S EE R M++
Sbjct  106  VLNGEISPD-----MDPMRDAFQMFDKDGDSRISANELQSVLVSLGDKGHSIEECRQMIN  160

Query  32   EVDRDGDGCI  3
             VD+DGDG +
Sbjct  161  SVDKDGDGHV  170



>gb|KGG50401.1| calmodulin [Microsporidia sp. UGP3]
Length=170

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLS  84
            G+ + G    P S   A+N      +LS    AEL +AF L D+++DG+I  +EL  ++ 
Sbjct  3    GHARHGRHLGPPS---AVNRSTGQHQLSEEQIAELKEAFSLFDKNNDGRITIQELGRVMH  59

Query  83   QVGAEPPSREELRLMLSEVDRDGDGCI  3
             +G + PS  E+  ML+EVD DGDG I
Sbjct  60   ALG-QHPSESEISDMLNEVDADGDGTI  85



>gb|AHY86315.1| Y-GECO1f [synthetic construct]
Length=420

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG +  EEL  +L  +G + PS  ELR M++EVD DGDG I
Sbjct  282  AEFKEAFSLFDKDGDGTMTTEELGTVLRSLG-QNPSEAELRDMINEVDADGDGTI  335



>ref|XP_009340773.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=201

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            +EL+ AF++ D D +GKI  EEL+ +L  +G +  S +E R M+  VDR+GDG +
Sbjct  132  SELMDAFRIFDADKNGKISAEELQKVLVSLGCQKCSLKESRKMIKGVDRNGDGAV  186



>gb|AHY86314.1| Y-GECO1 [synthetic construct]
Length=421

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG +  EEL  +L  +G + PS  ELR M++EVD DGDG I
Sbjct  283  AEFKEAFSLFDKDGDGTMTTEELGTVLRSLG-QNPSEAELRDMINEVDADGDGTI  336



>ref|NP_001173067.1| Os02g0606501 [Oryza sativa Japonica Group]
 sp|Q0DZP5.1|CML17_ORYSJ RecName: Full=Probable calcium-binding protein CML17; AltName: 
Full=Calmodulin-like protein 17 [Oryza sativa Japonica Group]
 dbj|BAH91796.1| Os02g0606501 [Oryza sativa Japonica Group]
Length=164

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L DRD DG+I +EEL   L ++G  P  REEL   ++ +D +GDGC+
Sbjct  7    AELRRVFELFDRDGDGRITREELTESLERLGM-PVHREELAATIARIDANGDGCV  60



>gb|AFW79981.1| calmodulin protein 2, touch-induced [Zea mays]
Length=205

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL  AF + D D DG+I   EL ++L+++G E  S EE R M++ VD DGDGC+
Sbjct  116  AELRAAFAVYDADGDGRITAAELGSVLARIG-EGCSAEECRRMIAGVDADGDGCV  169



>gb|EFA05282.1| hypothetical protein TcasGA2_TC015439 [Tribolium castaneum]
Length=289

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 5/79 (6%)
 Frame = -1

Query  239  ESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  60
            E+ P + L A + E+S  ++     E  +AF+L D+D DG I KEEL  ++  +G +   
Sbjct  106  ETKPPTRLSARHSEVSKSQMK----EFREAFRLFDKDGDGSITKEELGRVMRSLG-QFAR  160

Query  59   REELRLMLSEVDRDGDGCI  3
             EEL+ ML EVD DGDG +
Sbjct  161  TEELQQMLQEVDVDGDGNV  179



>gb|EKC32559.1| Calmodulin [Crassostrea gigas]
Length=338

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F L D+D DG +  +EL  ++ Q+G E PS EELR M++EVD DG G I
Sbjct  23   AELRETFLLFDKDGDGTVNSDELGTVMRQLGQE-PSEEELRQMIAEVDEDGSGEI  76



>ref|XP_001785095.1| predicted protein [Physcomitrella patens]
 gb|EDQ50094.1| predicted protein [Physcomitrella patens]
Length=144

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = -1

Query  212  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  33
             LN EISPD        +  AF++ D+D D +I   EL+++L  +G +  S EE R M++
Sbjct  68   VLNGEISPD-----MDPMRDAFQMFDKDGDSRISANELQSVLVSLGDKGHSIEECRQMIN  122

Query  32   EVDRDGDGCI  3
             VD+DGDG +
Sbjct  123  SVDKDGDGHV  132



>ref|XP_004344761.1| calmodulin, putative, partial [Acanthamoeba castellanii str. 
Neff]
 gb|ELR21018.1| calmodulin, putative, partial [Acanthamoeba castellanii str. 
Neff]
Length=67

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L DRD DGKI  +EL  ++  +GA  P+  EL+ M+ E+D D +G I
Sbjct  11   AEFKEAFSLFDRDGDGKITSKELGTVMRSLGAN-PTEAELKEMIKEIDTDNNGTI  64



>ref|XP_002129217.1| PREDICTED: calglandulin-like [Ciona intestinalis]
Length=155

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = -1

Query  251  KPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            KP G+ + +  +  +    S ++      EL +AFK+ D+D  G I  EEL+ ++   G 
Sbjct  57   KPRGKMSKSQFMNLMEIWCSDNKEKHSDEELAKAFKVFDKDGSGYIEWEELKYVMQGTG-  115

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            EP S EE+ +M+ E D+DGDG I
Sbjct  116  EPLSDEEVTIMMKEADKDGDGRI  138



>ref|XP_006088486.1| PREDICTED: calmodulin-like protein 3 [Myotis lucifugus]
Length=149

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D+++ ++L    AE  +AF L D+D DG I  +EL  ++  +G + P++ EL  M+SE
Sbjct  1    MADQLTEEQL----AEFREAFSLFDKDGDGTITTQELGTVMRALG-QNPTQAELEAMVSE  55

Query  29   VDRDGDGCI  3
            +DRDG+G +
Sbjct  56   IDRDGNGTV  64



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF LID+D DG I  EEL AL  Q   E P+ EE++ M++E D DGDG +
Sbjct  11   AEFREAFSLIDKDSDGVITVEEL-ALAIQSLNEHPTSEEIQEMVNEADSDGDGTV  64



>ref|XP_004867158.1| PREDICTED: calmodulin isoform X3 [Heterocephalus glaber]
Length=158

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 48/77 (62%), Gaps = 6/77 (8%)
 Frame = -1

Query  230  PTSVLPALN-DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSRE  54
              S+LPA   D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  
Sbjct  2    TNSLLPAFQADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEA  56

Query  53   ELRLMLSEVDRDGDGCI  3
            EL+ M++EVD DG+G I
Sbjct  57   ELQDMINEVDADGNGTI  73



>emb|CDW53538.1| Calmodulin [Trichuris trichiura]
Length=188

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I
Sbjct  21   AEFQEAFNLFDKDGDGKITSQELGVVMRSLG-QRPTESELRDMVNEVDEDGNGTI  74



>ref|NP_001152708.1| LOC100286349 [Zea mays]
 gb|ACG49078.1| calmodulin-related protein 2, touch-induced [Zea mays]
Length=201

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL  AF + D D DG+I   EL ++L+++G E  S EE R M++ VD DGDGC+
Sbjct  116  AELRAAFAVYDADGDGRITAAELGSVLARIG-EGCSAEECRRMIAGVDADGDGCV  169



>ref|XP_011099473.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=152

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF L D+D +GKI   EL ++L  +G E  S ++ R M+S VD DGDGC+
Sbjct  86   ELKEAFDLYDKDKNGKISASELHSVLRSLG-EKCSLKDCRRMISSVDVDGDGCV  138



>ref|XP_002512001.1| Calmodulin, putative [Ricinus communis]
 gb|EEF50670.1| Calmodulin, putative [Ricinus communis]
Length=163

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = -1

Query  230  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  51
             +++LP +N+E   ++      +L+  F+L DRD +G I   EL   ++++G +P + +E
Sbjct  72   ASAILPDMNEETFVNQ-----EQLLDVFQLFDRDGNGYISAAELAGSMAKMG-QPLTYKE  125

Query  50   LRLMLSEVDRDGDGCI  3
            LR M+ E D DGDG I
Sbjct  126  LREMIKEADTDGDGVI  141



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            ++ Q F   D++ DGKI  +EL  +LS +G+ P +REE +  ++E+D+DGDG I
Sbjct  38   QVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDKDGDGFI  91



>ref|XP_004308823.1| PREDICTED: calmodulin-5/6/7/8-like [Fragaria vesca subsp. vesca]
Length=195

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = -1

Query  212  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  33
            ++ D++SPD+ S    E  +AF L D+D DG I  +EL  ++  +G + P+ EEL+ M++
Sbjct  5    SVADQLSPDQKS----EFKEAFGLFDKDGDGSITTKELGTVMRSLG-QNPTEEELQDMIN  59

Query  32   EVDRDGDGCI  3
            EVD DG G +
Sbjct  60   EVDADGSGTV  69



>gb|EPS69688.1| hypothetical protein M569_05080, partial [Genlisea aurea]
Length=139

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF L D+D +GKI   EL + L  +G E  S ++ R M+S VD DGDGC+
Sbjct  77   ELKEAFDLYDKDKNGKISAAELHSTLRSLG-EKCSMKDCRKMISSVDVDGDGCV  129



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFV  64


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  
Sbjct  72   LNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGG  131

Query  29   VDRDGDGCI  3
            VD DGDG +
Sbjct  132  VDSDGDGFV  140



>gb|AFJ91796.1| calmodulin, partial [Ostrea edulis]
Length=81

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = -1

Query  224  SVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  45
            S + A+ D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+
Sbjct  15   STVSAMADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQ  69

Query  44   LMLSEVDRDGDG  9
             M++EVD DG+G
Sbjct  70   DMINEVDADGNG  81



>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human 
N60d Calmodulin Refined With Paramagnetism Based Strategy
Length=79

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DGDG I
Sbjct  10   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGDGTI  63



>ref|XP_004425517.1| PREDICTED: calmodulin-like protein 3 [Ceratotherium simum simum]
Length=149

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+SE+DRDG+G +
Sbjct  11   AEYREAFSLFDKDGDGTITTQELGTVMRSLG-QNPTEAELQAMVSEIDRDGNGTV  64



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL Q FK  D + DGKI   EL A++  +G +P   EELR M+ EVD DGDG I
Sbjct  44   ELEQVFKKFDVNGDGKISSSELGAIMGSLG-QPSGEEELRKMIKEVDSDGDGFI  96



>gb|EHH17309.1| hypothetical protein EGK_13688 [Macaca mulatta]
Length=149

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL A+++ +G + P+  EL+ M++EVD DG+G I
Sbjct  11   AEFKEAFSLFDKDGDGTITTKELGAVMTSLG-QNPTEAELQDMINEVDADGNGTI  64



>gb|KFD49502.1| hypothetical protein M513_09613 [Trichuris suis]
 gb|KFD65676.1| hypothetical protein M514_09613 [Trichuris suis]
Length=243

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I
Sbjct  69   AEFQEAFNLFDKDGDGKITSQELGVVMRSLG-QRPTESELRDMVNEVDEDGNGTI  122



>gb|KDP20063.1| hypothetical protein JCGZ_05832 [Jatropha curcas]
Length=163

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 47/75 (63%), Gaps = 6/75 (8%)
 Frame = -1

Query  227  TSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  48
            +++LP +N++I  ++      +L+  F+L D+D +G I   EL   ++++G +P + +EL
Sbjct  73   SAILPDMNEQIFGNQ-----EQLLDVFQLFDKDGNGYISAAELAGAMAKMG-QPLTYKEL  126

Query  47   RLMLSEVDRDGDGCI  3
            R M+ E D DGDG I
Sbjct  127  REMIKEADTDGDGVI  141



>ref|XP_006158531.1| PREDICTED: calmodulin-like protein 5 [Tupaia chinensis]
 gb|ELW48331.1| Calmodulin-like protein 5 [Tupaia chinensis]
Length=148

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  179  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            S + AE  +AF  +D + DGKI  +EL A++  VG +  S EEL+++++ VD DGDG I
Sbjct  7    SEVVAEYKEAFDRVDTNGDGKINVQELGAMMKAVG-KNASEEELKMLIASVDTDGDGAI  64



>gb|ETK82424.1| calmodulin, partial [Phytophthora parasitica]
Length=194

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 6/79 (8%)
 Frame = -1

Query  236  STPTS-VLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPS  60
            STP+S     + D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+
Sbjct  36   STPSSETRSTMADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPT  90

Query  59   REELRLMLSEVDRDGDGCI  3
              EL+ M++EVD DG+G I
Sbjct  91   EAELQDMINEVDADGNGTI  109



>ref|XP_009037109.1| hypothetical protein AURANDRAFT_26147 [Aureococcus anophagefferens]
 gb|EGB08391.1| hypothetical protein AURANDRAFT_26147 [Aureococcus anophagefferens]
Length=229

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 5/66 (8%)
 Frame = -1

Query  200  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDR  21
            EI  DEL    AEL +AFK+ D+D +G + KEEL  ++  +G E  + E L L+ + VD 
Sbjct  53   EIPEDEL----AELAEAFKMFDQDGNGTMNKEELGTVMRSLGQE-ITHENLDLIFASVDN  107

Query  20   DGDGCI  3
            D  GCI
Sbjct  108  DKSGCI  113



>ref|XP_001609057.1| calmodulin [Babesia bovis T2Bo]
 gb|EDO05489.1| calmodulin [Babesia bovis]
Length=149

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            ELVQAFK+ DRD +G I  +EL  +++ +G E  + EE+  ML E D DGDG I
Sbjct  85   ELVQAFKVFDRDGNGFISAQELRHVMTNLG-EKLTNEEVEEMLREADVDGDGKI  137



>emb|CDR97700.1| calmodulin, putative [Babesia bigemina]
Length=149

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            ELVQAFK+ DRD +G I  +EL  +++ +G E  + EE+  ML E D DGDG I
Sbjct  85   ELVQAFKVFDRDGNGFISAQELRHVMTNLG-EKLTNEEVEEMLREADVDGDGKI  137



>ref|XP_002721725.1| PREDICTED: calmodulin-like protein 3 [Oryctolagus cuniculus]
Length=149

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + +E+SP+++    AE  QAF   D++ DG I  EEL A++  +G +  S EEL+ +++ 
Sbjct  1    MAEELSPEQV----AEFKQAFSRFDKNGDGTISVEELGAVMQLLG-KKLSEEELKALITR  55

Query  29   VDRDGDGCI  3
            VD+DGDG I
Sbjct  56   VDKDGDGAI  64



>gb|ELU13700.1| hypothetical protein CAPTEDRAFT_169155 [Capitella teleta]
Length=184

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 12/84 (14%)
 Frame = -1

Query  221  VLPALNDE----------ISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEALLSQVG  75
            VLP+L D+             D+L+     E  +AF L D+D DG I   EL++++  +G
Sbjct  16   VLPSLRDQNGFSDSFIRDTQADQLTQEQIEEFKEAFALFDKDGDGTITLHELDSVMRGLG  75

Query  74   AEPPSREELRLMLSEVDRDGDGCI  3
             + P+REEL  M++EVD DG+G I
Sbjct  76   -QNPTREELTQMIAEVDSDGNGSI  98



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = -1

Query  206  NDEISPDE---LSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  36
            ND IS       SG   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ ++
Sbjct  4    NDSISKGSGIGASGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIM  63

Query  35   SEVDRDGDGCI  3
            +E D+DGDG I
Sbjct  64   AEFDKDGDGHI  74



>gb|KJB39976.1| hypothetical protein B456_007G041100 [Gossypium raimondii]
Length=162

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = -1

Query  230  PTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREE  51
              ++LP + DEI  ++      +L + F+L DRD +G I   EL   ++++G  P + +E
Sbjct  69   ANTILPTMKDEILVNQ-----EQLTEVFRLFDRDGNGYITAAELAGCMAKMG-HPLTYKE  122

Query  50   LRLMLSEVDRDGDGCI  3
            L  M+ E D DGDG I
Sbjct  123  LTDMIKEADADGDGVI  138



>emb|CCD75848.1| putative centrin [Schistosoma mansoni]
Length=163

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDG  9
             E+V+AFKL D DD GKI    L+ +  ++G E  S +ELR M+ E DRDGDG
Sbjct  97   TEMVRAFKLFDEDDSGKITYRNLKKISKELG-ENLSDQELRAMIEEFDRDGDG  148



>ref|XP_011288132.1| PREDICTED: calmodulin, partial [Felis catus]
Length=156

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 5/74 (7%)
 Frame = -1

Query  224  SVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELR  45
            S LP   D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+
Sbjct  3    SSLPFQADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQ  57

Query  44   LMLSEVDRDGDGCI  3
             M++EVD DG+G I
Sbjct  58   DMINEVDADGNGTI  71



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGDGC+
Sbjct  92   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGDGCV  144



>ref|XP_005869569.1| PREDICTED: calmodulin-like protein 3 [Myotis brandtii]
 ref|XP_006772690.1| PREDICTED: calmodulin-like protein 3 [Myotis davidii]
 ref|XP_008153574.1| PREDICTED: calmodulin-like protein 3 [Eptesicus fuscus]
 gb|ELK23559.1| Calmodulin-like protein 3 [Myotis davidii]
 gb|EPQ09736.1| Calmodulin-like protein 3 [Myotis brandtii]
Length=149

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D+++ ++L    AE  +AF L D+D DG I  +EL  ++  +G + P++ EL  M+SE
Sbjct  1    MADQLTEEQL----AEFREAFSLFDKDGDGTITTQELGTVMRALG-QNPTQAELEGMVSE  55

Query  29   VDRDGDGCI  3
            +DRDG+G +
Sbjct  56   IDRDGNGTV  64



>gb|EHB13359.1| Calmodulin [Heterocephalus glaber]
Length=149

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL  ++  +G + P+  ELR M+SEVD DG+G I
Sbjct  11   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELRDMISEVDADGNGTI  64



>ref|XP_003695096.1| PREDICTED: calmodulin-like [Apis florea]
Length=162

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 11/75 (15%)
 Frame = -1

Query  197  ISPDELSGLY----------AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  48
            I P  L G +          AE  +AF L D+D+DG I   EL  ++  +G + PS  EL
Sbjct  3    IQPSLLVGFFSEYGLTEDQVAEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETEL  61

Query  47   RLMLSEVDRDGDGCI  3
            R M++EVD+DG+G I
Sbjct  62   RDMVNEVDQDGNGTI  76



>ref|XP_008119752.1| PREDICTED: calmodulin [Anolis carolinensis]
Length=209

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (63%), Gaps = 5/75 (7%)
 Frame = -1

Query  227  TSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  48
            TS+ P   D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL
Sbjct  55   TSLQPYQADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAEL  109

Query  47   RLMLSEVDRDGDGCI  3
            + M++EVD DG+G I
Sbjct  110  QDMINEVDADGNGTI  124



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFV  64


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 37/72 (51%), Gaps = 0/72 (0%)
 Frame = -1

Query  218  LPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLM  39
               LN EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M
Sbjct  69   FVHLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRM  128

Query  38   LSEVDRDGDGCI  3
            +  VD DGDG +
Sbjct  129  IGGVDSDGDGFV  140



>ref|XP_004757981.1| PREDICTED: calmodulin-like protein 3 [Mustela putorius furo]
Length=149

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D++S +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  ELR M+SE
Sbjct  1    MADQLSEEQV----AEFKEAFCLFDKDGDGVITTQELGTVMRSLG-QNPTEAELRDMVSE  55

Query  29   VDRDGDGCI  3
            +DRDG+G +
Sbjct  56   IDRDGNGTV  64



>ref|XP_009170077.1| hypothetical protein T265_06530 [Opisthorchis viverrini]
 gb|KER26178.1| hypothetical protein T265_06530 [Opisthorchis viverrini]
Length=137

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
             E+++AFKL D DD G+I    L+ +  ++G E  + +ELR M+ E DRDGDG I
Sbjct  71   TEIIRAFKLFDDDDSGRITYRNLKKVAKELG-ENLTDQELRAMIEEFDRDGDGAI  124



>ref|XP_004806636.1| PREDICTED: calmodulin-like protein 3 [Mustela putorius furo]
Length=149

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D++S +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  ELR M+SE
Sbjct  1    MADQLSEEQV----AEFKEAFCLFDKDGDGVITTQELGTVMRSLG-QNPTEAELRDMVSE  55

Query  29   VDRDGDGCI  3
            +DRDG+G +
Sbjct  56   IDRDGNGTV  64



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC+
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCV  146



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -1

Query  179  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDG  9
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG
Sbjct  1    SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDG  59



>pdb|4Q57|A Chain A, Crystal Structure Of The Plectin 1a Actin-binding Domain/n-terminal 
Domain Of Calmodulin Complex
Length=65

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I
Sbjct  2    AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTI  55



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S VD DGDGC+
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCV  146



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL +AF L D+D +GKI   EL +++  +G E  S ++ R M+S+VD DGDGC+
Sbjct  92   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGDGCV  144



>ref|XP_004976061.1| PREDICTED: probable calcium-binding protein CML22-like [Setaria 
italica]
Length=251

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L D++ DG+I +EELE  L ++G   P  +EL  M++ +D +GDGC+
Sbjct  86   AELARVFELFDKNGDGRITREELEESLGKLGMSVPG-DELASMIARIDANGDGCV  139



>ref|XP_011150177.1| PREDICTED: neo-calmodulin-like isoform X4 [Harpegnathos saltator]
Length=180

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  94



>emb|CDP19328.1| unnamed protein product [Coffea canephora]
Length=152

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF LIDRD DG I   EL A++  +  E P++EE++ M+ EVD DG+G I
Sbjct  11   AEFREAFCLIDRDSDGFITIAELAAVIQSLH-ERPTKEEIQEMVHEVDADGNGSI  64



>ref|XP_006125555.1| PREDICTED: calmodulin-like isoform X2 [Pelodiscus sinensis]
 ref|XP_006125557.1| PREDICTED: calmodulin isoform X1 [Pelodiscus sinensis]
Length=159

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = -1

Query  215  PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  36
            P L D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+
Sbjct  9    PNLADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMI  63

Query  35   SEVDRDGDGCI  3
            +EVD DG+G I
Sbjct  64   NEVDADGNGTI  74



>ref|XP_008557060.1| PREDICTED: probable calcium-binding protein CML11 isoform X2 
[Microplitis demolitor]
 ref|XP_008557061.1| PREDICTED: probable calcium-binding protein CML11 isoform X2 
[Microplitis demolitor]
Length=331

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 9/80 (11%)
 Frame = -1

Query  242  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  63
            G +TP+  +PA++             E  +AF L D+D DG I KEEL  ++  +G +  
Sbjct  146  GSTTPSDKMPAIS--------KAQMKEFEEAFNLFDKDRDGSITKEELGRVMRGLG-QFA  196

Query  62   SREELRLMLSEVDRDGDGCI  3
              EELR ML E+D DGDG +
Sbjct  197  RTEELRTMLEEIDTDGDGNV  216



>ref|XP_011427007.1| PREDICTED: calmodulin-A-like [Crassostrea gigas]
Length=148

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AFKL D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I
Sbjct  10   AEFKEAFKLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMVNEVDEDGNGTI  63


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL +AF + D+D DG I   EL++++SQ+G E  + E++  M+ E D+DGDG I
Sbjct  83   AELREAFAVFDKDGDGFIGATELQSVMSQLG-ENLTLEDVHSMIREADQDGDGRI  136



>ref|XP_003758346.1| PREDICTED: calmodulin-like [Sarcophilus harrisii]
Length=167

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 9/86 (10%)
 Frame = -1

Query  260  GYKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQ  81
            G++ P       S LP   D+++ +++    AE  +AF L D+D DG I  +EL  ++  
Sbjct  6    GFRGPA----RISKLPGEADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRS  57

Query  80   VGAEPPSREELRLMLSEVDRDGDGCI  3
            +G + P+  EL+ M++EVD DG+G I
Sbjct  58   LG-QNPTEAELQDMINEVDADGNGTI  82



>dbj|GAA53816.1| centrin-3 [Clonorchis sinensis]
Length=137

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
             E+++AFKL D DD G+I    L+ +  ++G E  + +ELR M+ E DRDGDG I
Sbjct  71   TEIIRAFKLFDDDDSGRITYRNLKKVAKELG-ENLTDQELRAMIEEFDRDGDGAI  124



>ref|XP_011150176.1| PREDICTED: neo-calmodulin-like isoform X3 [Harpegnathos saltator]
Length=244

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  158



>gb|EFN67816.1| Calmodulin [Camponotus floridanus]
Length=231

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  92   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  145



>gb|EKC20233.1| Calmodulin [Crassostrea gigas]
Length=454

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = -1

Query  248  PGGE-STPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGA  72
            PGG      + +P +  ++SP+++     E   AF L D+D+DG I  +EL  ++  +G 
Sbjct  157  PGGHIYYEENHIPCMASKLSPEQI----MEFRVAFSLFDKDNDGSINAKELGTVMRALG-  211

Query  71   EPPSREELRLMLSEVDRDGDGCI  3
            + PS  ELR M+ EVD DG+G I
Sbjct  212  QNPSVTELRAMVDEVDLDGNGVI  234



>ref|XP_009386769.1| PREDICTED: calmodulin-like [Musa acuminata subsp. malaccensis]
Length=147

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
             E  + F L D+D DG I  EEL  +++ +G   P REEL+ M+SEVD DG+G I
Sbjct  10   TEFYETFCLFDKDGDGSIALEELSTVITSLGL-KPFREELQGMISEVDVDGNGTI  63



>gb|EGI57712.1| Calmodulin [Acromyrmex echinatior]
Length=186

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  94



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            L+ + S D  +G   EL + F   D++ DG+I  EEL  +   +G+E  S EE++ +++E
Sbjct  6    LDSKGSGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAE  65

Query  29   VDRDGDGCI  3
             D+DGDG I
Sbjct  66   FDKDGDGHI  74



>sp|Q39752.3|CALM_FAGSY RecName: Full=Calmodulin; Short=CaM [Fagus sylvatica]
 emb|CAA66215.1| CaMF-1 [Fagus sylvatica]
Length=148

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -1

Query  209  LNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSE  30
            + D+++ D++S    E  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E
Sbjct  1    MADQLTDDQIS----EFKEAFSLFDKDGDGCITTKELGTVMRSLG-QNPTEAELQDMINE  55

Query  29   VDRDGDGCI  3
            VDRDG+G I
Sbjct  56   VDRDGNGTI  64



>gb|EZA54087.1| Calmodulin, partial [Cerapachys biroi]
Length=231

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  92   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  145



>gb|AFQ60635.1| Nano-lantern_Ca2+_CaM-4GS [synthetic construct]
Length=723

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = -1

Query  215  PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  36
            P ++D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+
Sbjct  457  PWMHDQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMI  511

Query  35   SEVDRDGDGCI  3
            +EVD DG+G I
Sbjct  512  NEVDADGNGTI  522



>gb|AFQ60634.1| Nano-lantern_Ca2+_CaM-2GS [synthetic construct]
Length=721

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = -1

Query  215  PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  36
            P ++D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M+
Sbjct  457  PWMHDQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMI  511

Query  35   SEVDRDGDGCI  3
            +EVD DG+G I
Sbjct  512  NEVDADGNGTI  522



>gb|EMT00032.1| Calmodulin [Aegilops tauschii]
Length=161

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 5/67 (7%)
 Frame = -1

Query  203  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVD  24
            DE+S +++    A    AF L D+D DG I  +EL  ++  +G + PS EELR M++EVD
Sbjct  2    DELSKEQIDEFRA----AFNLFDKDGDGTITTKELGTVMRSLG-QRPSEEELREMIAEVD  56

Query  23   RDGDGCI  3
             DG+G +
Sbjct  57   TDGNGVV  63



>ref|XP_004829358.1| calmodulin, putative [Babesia equi]
 gb|AFZ79692.1| calmodulin, putative [Babesia equi strain WA]
Length=149

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            ELVQAFK+ DRD +G I  +EL  +++ +G E  + EE+  ML E D DGDG I
Sbjct  85   ELVQAFKVFDRDGNGFISAQELRHVMTNLG-EKLTNEEVDEMLREADVDGDGKI  137



>ref|XP_011307674.1| PREDICTED: neo-calmodulin-like isoform X3 [Fopius arisanus]
Length=245

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  159



>gb|EPY50961.1| calmodulin Cam1 [Schizosaccharomyces cryophilus OY26]
Length=150

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L DRD DG I   EL  ++  +G + P+  EL+ M++EVD DG+G I
Sbjct  12   AEFREAFSLFDRDQDGNITSNELGVVMRSLG-QSPTAAELQDMINEVDADGNGTI  65



>ref|XP_011066820.1| PREDICTED: neo-calmodulin-like [Acromyrmex echinatior]
Length=244

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  158



>ref|XP_006647478.1| PREDICTED: probable calcium-binding protein CML17-like [Oryza 
brachyantha]
Length=158

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L DRD DG+I +EEL   L ++G  P + EEL   ++ VD +GDGC+
Sbjct  6    AELRRVFELFDRDGDGRITREELTESLERLGM-PVAGEELAATIARVDANGDGCV  59



>ref|XP_011257081.1| PREDICTED: neo-calmodulin-like isoform X3 [Camponotus floridanus]
Length=244

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  158



>ref|XP_006616491.1| PREDICTED: calmodulin-like isoform X5 [Apis dorsata]
Length=245

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  159



>ref|XP_006558598.1| PREDICTED: calmodulin-like isoform X5 [Apis mellifera]
Length=245

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  106  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  159



>gb|EPX74846.1| calmodulin Cam1 [Schizosaccharomyces octosporus yFS286]
Length=150

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L DRD DG I   EL  ++  +G + P+  EL+ M++EVD DG+G I
Sbjct  12   AEFREAFSLFDRDQDGNITSNELGVVMRSLG-QSPTAAELQDMINEVDADGNGTI  65



>ref|NP_593340.1| calmodulin Cam1 [Schizosaccharomyces pombe 972h-]
 sp|P05933.1|CALM_SCHPO RecName: Full=Calmodulin; Short=CaM [Schizosaccharomyces pombe 
972h-]
 gb|AAA35291.1| calmodulin [Schizosaccharomyces pombe]
 emb|CAB08742.1| calmodulin Cam1 [Schizosaccharomyces pombe]
Length=150

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L DRD DG I   EL  ++  +G + P+  EL+ M++EVD DG+G I
Sbjct  12   AEFREAFSLFDRDQDGNITSNELGVVMRSLG-QSPTAAELQDMINEVDADGNGTI  65



>ref|XP_002175972.1| calmodulin Cam1 [Schizosaccharomyces japonicus yFS275]
 gb|EEB09679.1| calmodulin Cam1 [Schizosaccharomyces japonicus yFS275]
Length=150

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L DRD DG I   EL  ++  +G + P+  EL+ M++EVD DG+G I
Sbjct  12   AEFKEAFSLFDRDQDGNITSNELGVVMRSLG-QSPTAAELQDMINEVDADGNGTI  65



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL + F+L D + DGKI   EL+  ++++G  P +  EL +M+ E D DGDG I
Sbjct  30   ELERVFRLYDTNGDGKISAAELQETMAKLGHHPANDHELEMMMKEADADGDGFI  83



>ref|XP_011339099.1| PREDICTED: neo-calmodulin-like isoform X3 [Cerapachys biroi]
Length=244

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  105  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  158



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -1

Query  179  SGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVG--AEPPSREELRLMLSEVDRDGDG  9
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG
Sbjct  61   SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDG  119



>gb|KIW04752.1| hypothetical protein PV09_04478 [Verruconis gallopava]
Length=150

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  ELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            EL+QAFK+ D+D  G I  +EL+ L+  +G E  S++E+  M+ E D+DGDG I
Sbjct  86   ELLQAFKVFDKDGSGTISAQELKELMISIG-ESLSKDEIDEMIREADKDGDGVI  138



>ref|XP_008557059.1| PREDICTED: uncharacterized protein LOC103577942 isoform X1 [Microplitis 
demolitor]
Length=390

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 9/80 (11%)
 Frame = -1

Query  242  GESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPP  63
            G +TP+  +PA++             E  +AF L D+D DG I KEEL  ++  +G +  
Sbjct  205  GSTTPSDKMPAIS--------KAQMKEFEEAFNLFDKDRDGSITKEELGRVMRGLG-QFA  255

Query  62   SREELRLMLSEVDRDGDGCI  3
              EELR ML E+D DGDG +
Sbjct  256  RTEELRTMLEEIDTDGDGNV  275



>ref|XP_011150174.1| PREDICTED: calmodulin-beta-like isoform X1 [Harpegnathos saltator]
Length=274

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  188



>ref|XP_006558597.1| PREDICTED: calmodulin-like isoform X4 [Apis mellifera]
Length=254

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  115  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  168



>ref|XP_006669179.1| calmodulin [Cordyceps militaris CM01]
 gb|EGX92595.1| calmodulin [Cordyceps militaris CM01]
Length=171

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = -1

Query  215  PALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLML  36
            PA+ D ++ D++    AE  +AF L D+D DG+I  +EL  ++  +G + PS  EL+ M+
Sbjct  21   PAVADALTEDQV----AEFKEAFSLFDKDGDGQITTKELGTVMRSLG-QNPSESELQDMI  75

Query  35   SEVDRDGDGCI  3
            +EVD D +G I
Sbjct  76   NEVDADNNGTI  86



>ref|XP_006616488.1| PREDICTED: calmodulin-like isoform X2 [Apis dorsata]
Length=268

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  129  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  182



>ref|XP_005605456.1| PREDICTED: calmodulin [Equus caballus]
Length=157

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = -1

Query  212  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  33
            AL D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++
Sbjct  8    ALADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMIN  62

Query  32   EVDRDGDGCI  3
            EVD DG+G I
Sbjct  63   EVDADGNGTI  72



>gb|EHB00855.1| Calmodulin [Heterocephalus glaber]
Length=188

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = -1

Query  212  ALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLS  33
            AL D+++ +++    AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++
Sbjct  39   ALADQLTEEQI----AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMIN  93

Query  32   EVDRDGDGCI  3
            EVD DG+G I
Sbjct  94   EVDADGNGTI  103



>ref|XP_009786057.1| PREDICTED: calmodulin-like protein 8 [Nicotiana sylvestris]
Length=150

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
             EL +AF L DRD DG I  EEL  ++  +  + P++EEL+ M++EVD DG+G I
Sbjct  11   VELQEAFSLFDRDGDGCITVEELATVIRSLD-QNPTKEELQDMITEVDSDGNGTI  64



>ref|XP_006616490.1| PREDICTED: calmodulin-like isoform X4 [Apis dorsata]
Length=254

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  115  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  168



>ref|XP_004897704.1| PREDICTED: calmodulin-like protein 3 [Heterocephalus glaber]
 ref|XP_004854571.1| PREDICTED: calmodulin-like protein 3 [Heterocephalus glaber]
 gb|EHB11205.1| Calmodulin-like protein 3 [Heterocephalus glaber]
Length=149

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++E+DRDG+G +
Sbjct  11   AEFKEAFSLFDKDGDGCITTQELGTVMRSLG-QNPTEAELQCMVNEIDRDGNGTV  64



>ref|XP_011307672.1| PREDICTED: calmodulin-beta-like isoform X1 [Fopius arisanus]
Length=275

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  189



>ref|XP_011257082.1| PREDICTED: neo-calmodulin-like isoform X4 [Camponotus floridanus]
Length=180

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  41   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  94



>ref|XP_011150175.1| PREDICTED: calmodulin-A-like isoform X2 [Harpegnathos saltator]
Length=260

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  174



>ref|XP_624589.2| PREDICTED: calmodulin-like isoformX2 [Apis mellifera]
Length=276

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  137  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  190



>ref|XP_008550049.1| PREDICTED: calmodulin-A-like [Microplitis demolitor]
Length=260

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  174



>ref|XP_011498410.1| PREDICTED: neo-calmodulin-like isoform X2 [Ceratosolen solmsi 
marchali]
Length=235

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  96   AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  149



>ref|XP_004298507.1| PREDICTED: probable calcium-binding protein CML25 [Fragaria vesca 
subsp. vesca]
Length=184

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL Q F   D + DGKI   EL A++  +G  P + +ELR M+ EVD DGDG I
Sbjct  36   AELEQVFNKFDVNGDGKISSSELGAIMGSLG-HPATEDELRSMILEVDADGDGFI  89



>ref|XP_004349444.1| calmodulin [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91569.1| calmodulin [Capsaspora owczarzaki ATCC 30864]
Length=149

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL  ++  +G + P+  ELR M++EVD DG+G I
Sbjct  11   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELRDMINEVDTDGNGTI  64



>ref|XP_011090880.1| PREDICTED: probable calcium-binding protein CML23 [Sesamum indicum]
Length=203

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = -1

Query  221  VLPALNDEISPDELSGLY--AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREEL  48
             L A+  + + D  +G+   +E+++AF++ D D++G I  +EL+++L ++G    S +E 
Sbjct  115  FLIAMGTDQNQDAANGICRESEIMEAFRVFDADNNGLISAKELKSVLERLGCGKCSIKEC  174

Query  47   RLMLSEVDRDGDGCI  3
            R M+  VDRDGDG +
Sbjct  175  RKMIRGVDRDGDGFV  189



>ref|XP_011257079.1| PREDICTED: calmodulin-beta-like isoform X1 [Camponotus floridanus]
Length=274

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  188



>gb|KIW16124.1| calmodulin [Exophiala spinifera]
Length=209

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = -1

Query  257  YKKPGGESTPTSVLPALNDEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEALLSQV  78
            Y       +  + LP + D ++ +++S    E  +AF L D+D DG+I  +EL  ++  +
Sbjct  45   YHSIATTDSSFARLPNMADSLTEEQVS----EFKEAFSLFDKDGDGQITTKELGTVMRSL  100

Query  77   GAEPPSREELRLMLSEVDRDGDGCI  3
            G + PS  EL+ M++EVD D +G I
Sbjct  101  G-QNPSESELQDMINEVDADNNGTI  124



>ref|XP_003400211.1| PREDICTED: calmodulin-like [Bombus terrestris]
 ref|XP_003494411.1| PREDICTED: calmodulin-like [Bombus impatiens]
Length=275

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  136  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  189



>ref|XP_003372739.1| EF hand domain containing protein [Trichinella spiralis]
 gb|EFV53117.1| EF hand domain containing protein [Trichinella spiralis]
Length=239

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DGKI  +EL  ++  +G + P+  ELR M++EVD DG+G I
Sbjct  101  AEFQEAFNLFDKDGDGKITSQELGIVMRSLG-QRPTESELRDMVNEVDEDGNGTI  154



>ref|XP_011257080.1| PREDICTED: calmodulin-A-like isoform X2 [Camponotus floridanus]
Length=260

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  121  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  174



>ref|XP_006616487.1| PREDICTED: calmodulin-like isoform X1 [Apis dorsata]
Length=276

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  137  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  190



>ref|XP_011339096.1| PREDICTED: calmodulin-beta-like isoform X1 [Cerapachys biroi]
 ref|XP_011339097.1| PREDICTED: calmodulin-beta-like isoform X1 [Cerapachys biroi]
Length=274

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  135  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  188



>ref|NP_001053179.1| Os04g0492800 [Oryza sativa Japonica Group]
 sp|Q0JC44.1|CML22_ORYSJ RecName: Full=Probable calcium-binding protein CML22; AltName: 
Full=Calmodulin-like protein 22 [Oryza sativa Japonica Group]
 dbj|BAF15093.1| Os04g0492800 [Oryza sativa Japonica Group]
Length=250

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AEL + F+L DR+ DG+I +EELE  L ++G   P+ +EL  +++ +D +GDGC+
Sbjct  91   AELARVFELFDRNGDGRITREELEDSLGKLGIPVPA-DELAAVIARIDANGDGCV  144



>gb|AET43975.1| calmodulin, partial [Reishia clavigera]
Length=72

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D DG I  +EL  ++  +G + P+  EL+ M++EVD DG+G I
Sbjct  13   AEFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTI  66



>ref|XP_011307673.1| PREDICTED: calmodulin-A-like isoform X2 [Fopius arisanus]
Length=261

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  AELVQAFKLIDRDDDGKIRKEELEALLSQVGAEPPSREELRLMLSEVDRDGDGCI  3
            AE  +AF L D+D+DG I   EL  ++  +G + PS  ELR M++EVD+DG+G I
Sbjct  122  AEFKEAFMLFDKDEDGTITMAELGVVMRSLG-QRPSETELRDMVNEVDQDGNGTI  175



Lambda      K        H        a         alpha
   0.311    0.135    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840