BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013F18

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002521172.1|  diphosphomevalonate decarboxylase, putative        248   3e-77   Ricinus communis
gb|KDO47061.1|  hypothetical protein CISIN_1g014714mg                   239   4e-76   Citrus sinensis [apfelsine]
ref|XP_011024216.1|  PREDICTED: diphosphomevalonate decarboxylase...    243   1e-75   Populus euphratica
ref|XP_006367129.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   3e-75   
gb|KDO47060.1|  hypothetical protein CISIN_1g014714mg                   239   9e-75   Citrus sinensis [apfelsine]
ref|XP_002315441.1|  mevalonate disphosphate decarboxylase family...    241   9e-75   Populus trichocarpa [western balsam poplar]
gb|KJB78631.1|  hypothetical protein B456_013G012400                    237   2e-74   Gossypium raimondii
dbj|BAF98285.1|  diphosphomevelonate decarboxylase                      241   2e-74   Hevea brasiliensis [jebe]
gb|AAL18927.1|AF429386_1  mevalonate disphosphate decarboxylase         240   2e-74   Hevea brasiliensis [jebe]
gb|KDP35789.1|  hypothetical protein JCGZ_10425                         240   2e-74   Jatropha curcas
ref|XP_011032862.1|  PREDICTED: diphosphomevalonate decarboxylase...    240   3e-74   Populus euphratica
gb|ADR65113.1|  mevalonate 5-diphosphate decarboxylase                  239   4e-74   Catharanthus roseus [chatas]
gb|AII99848.1|  mevalonate disphosphate decarboxylase                   239   4e-74   Nicotiana tabacum [American tobacco]
gb|KJB78632.1|  hypothetical protein B456_013G012400                    237   6e-74   Gossypium raimondii
gb|KDO47059.1|  hypothetical protein CISIN_1g014714mg                   239   6e-74   Citrus sinensis [apfelsine]
ref|XP_009792788.1|  PREDICTED: diphosphomevalonate decarboxylase...    239   6e-74   Nicotiana sylvestris
ref|XP_002311015.1|  mevalonate disphosphate decarboxylase family...    239   8e-74   Populus trichocarpa [western balsam poplar]
ref|XP_009619582.1|  PREDICTED: diphosphomevalonate decarboxylase...    239   8e-74   Nicotiana tomentosiformis
gb|KHG20401.1|  Mvd                                                     238   3e-73   Gossypium arboreum [tree cotton]
gb|KHG20400.1|  Mvd                                                     239   3e-73   Gossypium arboreum [tree cotton]
ref|XP_009630346.1|  PREDICTED: diphosphomevalonate decarboxylase...    237   3e-73   Nicotiana tomentosiformis
gb|KJB78629.1|  hypothetical protein B456_013G012400                    237   5e-73   Gossypium raimondii
emb|CDO99902.1|  unnamed protein product                                236   1e-72   Coffea canephora [robusta coffee]
gb|AID51442.1|  mevalonate diphosphate decarboxylase                    236   1e-72   Astragalus membranaceus
ref|XP_009795010.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   4e-72   Nicotiana sylvestris
ref|XP_007142839.1|  hypothetical protein PHAVU_007G021200g             234   5e-72   Phaseolus vulgaris [French bean]
ref|XP_006359351.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   5e-72   
ref|XP_007010317.1|  Mevalonate diphosphate decarboxylase 1 isofo...    230   7e-72   
ref|XP_008232018.1|  PREDICTED: diphosphomevalonate decarboxylase...    233   2e-71   Prunus mume [ume]
ref|XP_007010316.1|  GHMP kinase family protein isoform 3               229   2e-71   
gb|EPS58761.1|  hypothetical protein M569_16051                         226   3e-71   Genlisea aurea
gb|KEH44325.1|  mevalonate diphosphate decarboxylase                    232   3e-71   Medicago truncatula
gb|KHN11470.1|  Diphosphomevalonate decarboxylase                       232   4e-71   Glycine soja [wild soybean]
ref|XP_007211744.1|  hypothetical protein PRUPE_ppa006290mg             232   4e-71   Prunus persica
ref|XP_003555870.1|  PREDICTED: diphosphomevalonate decarboxylase...    231   7e-71   Glycine max [soybeans]
ref|XP_004497159.1|  PREDICTED: diphosphomevalonate decarboxylase...    231   8e-71   Cicer arietinum [garbanzo]
ref|XP_006403598.1|  hypothetical protein EUTSA_v10010411mg             228   8e-71   
ref|XP_006411092.1|  hypothetical protein EUTSA_v10016888mg             228   1e-70   Eutrema salsugineum [saltwater cress]
gb|ABG24207.2|  mevalonate disphosphate decarboxylase                   230   2e-70   Arnebia euchroma
ref|XP_007010315.1|  GHMP kinase family protein isoform 2               229   3e-70   
ref|XP_007010314.1|  GHMP kinase family protein isoform 1               229   3e-70   
gb|AEM42974.1|  diphosphomevalonate decarboxylase                       228   8e-70   Siraitia grosvenorii [arhat fruit]
ref|XP_006403599.1|  hypothetical protein EUTSA_v10010411mg             228   1e-69   Eutrema salsugineum [saltwater cress]
gb|KFK36776.1|  hypothetical protein AALP_AA4G169000                    228   1e-69   Arabis alpina [alpine rockcress]
ref|XP_002266399.1|  PREDICTED: diphosphomevalonate decarboxylase       228   1e-69   Vitis vinifera
ref|NP_181404.1|  mevalonate diphosphate decarboxylase 1                228   1e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65399.1|  BnaCnng46900D                                          228   2e-69   Brassica napus [oilseed rape]
ref|XP_011469322.1|  PREDICTED: diphosphomevalonate decarboxylase       228   2e-69   Fragaria vesca subsp. vesca
ref|XP_009139253.1|  PREDICTED: diphosphomevalonate decarboxylase...    228   2e-69   Brassica rapa
emb|CDX76157.1|  BnaA04g04210D                                          227   2e-69   
ref|XP_010032077.1|  PREDICTED: diphosphomevalonate decarboxylase...    227   3e-69   Eucalyptus grandis [rose gum]
ref|XP_010676219.1|  PREDICTED: diphosphomevalonate decarboxylase...    227   3e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006361468.1|  PREDICTED: diphosphomevalonate decarboxylase...    227   3e-69   Solanum tuberosum [potatoes]
ref|NP_001234815.1|  mevalonate disphosphate decarboxylase              227   3e-69   Solanum lycopersicum
emb|CAN82519.1|  hypothetical protein VITISV_042700                     228   3e-69   Vitis vinifera
ref|XP_011084229.1|  PREDICTED: diphosphomevalonate decarboxylase...    227   3e-69   
ref|XP_010088787.1|  Diphosphomevalonate decarboxylase                  226   6e-69   
ref|XP_010515945.1|  PREDICTED: diphosphomevalonate decarboxylase...    226   7e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006391873.1|  hypothetical protein EUTSA_v10023484mg             226   1e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006294305.1|  hypothetical protein CARUB_v10023314mg             226   1e-68   Capsella rubella
ref|XP_003536712.1|  PREDICTED: diphosphomevalonate decarboxylase...    226   1e-68   Glycine max [soybeans]
ref|XP_010536297.1|  PREDICTED: diphosphomevalonate decarboxylase...    225   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_010536296.1|  PREDICTED: diphosphomevalonate decarboxylase...    225   2e-68   Tarenaya hassleriana [spider flower]
gb|ADI80345.1|  mevalonate diphosphate decarboxylase                    225   2e-68   Panax ginseng [Asiatic ginseng]
gb|ACO35355.1|  mevalonate pyrophosphate decarboxylase                  218   2e-68   Elaeis oleifera
ref|XP_010536295.1|  PREDICTED: diphosphomevalonate decarboxylase...    225   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_006445714.1|  hypothetical protein CICLE_v10015368mg             223   2e-68   
emb|CDX73494.1|  BnaC08g25090D                                          224   3e-68   
ref|NP_566995.1|  diphosphomevalonate decarboxylase                     224   6e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CAB70999.1|  DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein         223   6e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116111.1|  PREDICTED: diphosphomevalonate decarboxylase       223   7e-68   Brassica rapa
gb|AFM77982.1|  mevalonate diphosphate decarboxylase                    223   1e-67   Eleutherococcus senticosus
gb|AGZ15316.1|  mevalonate decarboxylase                                223   2e-67   Platycodon grandiflorus [balloon-flower]
ref|XP_006445713.1|  hypothetical protein CICLE_v10015368mg             223   2e-67   Citrus clementina [clementine]
gb|AEZ55675.1|  mevalonate diphosphate decarboxylase                    223   2e-67   Salvia miltiorrhiza [Chinese salvia]
gb|EYU19776.1|  hypothetical protein MIMGU_mgv1a007068mg                219   3e-67   Erythranthe guttata [common monkey flower]
ref|XP_008446768.1|  PREDICTED: diphosphomevalonate decarboxylase       221   5e-67   Cucumis melo [Oriental melon]
gb|AAM65192.1|  diphosphomevalonate decarboxylase-like protein          221   7e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244659.1|  PREDICTED: diphosphomevalonate decarboxylase...    221   9e-67   Nelumbo nucifera [Indian lotus]
gb|AEA72605.1|  mevalonate 5-diphosphate decarboxylase                  220   1e-66   Houttuynia cordata [chameleon-plant]
ref|XP_004236810.1|  PREDICTED: diphosphomevalonate decarboxylase...    220   1e-66   Solanum lycopersicum
ref|XP_010907122.1|  PREDICTED: diphosphomevalonate decarboxylase...    219   3e-66   Elaeis guineensis
gb|EYU19775.1|  hypothetical protein MIMGU_mgv1a007068mg                219   5e-66   Erythranthe guttata [common monkey flower]
gb|AAM64988.1|  mevalonate diphosphate decarboxylase                    218   5e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ABV02028.1|  mevalonate diphosphate decarboxylase                    218   6e-66   Nicotiana langsdorffii x Nicotiana sanderae
gb|AIK21783.1|  mevalonate diphosphate decarboxylase                    218   8e-66   Panax notoginseng [san-qi]
gb|EEC72316.1|  hypothetical protein OsI_05509                          211   1e-65   Oryza sativa Indica Group [Indian rice]
gb|ACW83616.2|  mevalonate diphosphate decarboxylase                    217   2e-65   Panax ginseng [Asiatic ginseng]
gb|KHN37414.1|  Diphosphomevalonate decarboxylase                       221   5e-65   Glycine soja [wild soybean]
ref|XP_008788072.1|  PREDICTED: diphosphomevalonate decarboxylase...    215   1e-64   Phoenix dactylifera
ref|XP_008345749.1|  PREDICTED: diphosphomevalonate decarboxylase...    214   2e-64   
ref|NP_001045633.2|  Os02g0107200                                       205   6e-64   
gb|AFW73866.1|  hypothetical protein ZEAMMB73_421648                    204   3e-63   
gb|EEC72312.1|  hypothetical protein OsI_05503                          208   4e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_008364764.1|  PREDICTED: diphosphomevalonate decarboxylase...    211   5e-63   
ref|XP_008356850.1|  PREDICTED: diphosphomevalonate decarboxylase...    211   6e-63   
ref|XP_010427097.1|  PREDICTED: diphosphomevalonate decarboxylase...    211   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009356125.1|  PREDICTED: diphosphomevalonate decarboxylase       211   7e-63   Pyrus x bretschneideri [bai li]
ref|XP_010554524.1|  PREDICTED: diphosphomevalonate decarboxylase...    209   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_006291202.1|  hypothetical protein CARUB_v10017330mg             209   1e-62   Capsella rubella
ref|XP_010505522.1|  PREDICTED: diphosphomevalonate decarboxylase...    209   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010509167.1|  PREDICTED: diphosphomevalonate decarboxylase...    209   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002877963.1|  hypothetical protein ARALYDRAFT_906831             209   3e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_010504223.1|  PREDICTED: diphosphomevalonate decarboxylase...    209   4e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009404708.1|  PREDICTED: diphosphomevalonate decarboxylase...    209   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT01953.1|  Diphosphomevalonate decarboxylase                       209   6e-62   
dbj|BAD27942.1|  putative mevalonate disphosphate decarboxylase         208   7e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006836043.1|  hypothetical protein AMTR_s00114p00051110          207   1e-61   Amborella trichopoda
emb|CDM86983.1|  unnamed protein product                                207   1e-61   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ21434.1|  hypothetical protein OsJ_05037                          209   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|ACN41090.1|  unknown                                                 207   2e-61   Picea sitchensis
ref|XP_002881611.1|  hypothetical protein ARALYDRAFT_482881             207   2e-61   
gb|AFJ93089.1|  mevalonate diphosphate decarboxylase                    202   2e-61   Bacopa monnieri
ref|XP_006646770.1|  PREDICTED: diphosphomevalonate decarboxylase...    205   9e-61   Oryza brachyantha
gb|KFK34679.1|  hypothetical protein AALP_AA5G177200                    204   1e-60   Arabis alpina [alpine rockcress]
ref|NP_001149256.1|  LOC100282878                                       204   2e-60   Zea mays [maize]
ref|XP_008665378.1|  PREDICTED: diphosphomevalonate decarboxylase...    204   2e-60   Zea mays [maize]
ref|XP_008668934.1|  PREDICTED: diphosphomevalonate decarboxylase...    196   2e-60   Zea mays [maize]
ref|XP_008668933.1|  PREDICTED: diphosphomevalonate decarboxylase...    196   2e-60   Zea mays [maize]
ref|XP_004150845.1|  PREDICTED: diphosphomevalonate decarboxylase...    204   3e-60   Cucumis sativus [cucumbers]
ref|XP_002452980.1|  hypothetical protein SORBIDRAFT_04g035950          203   4e-60   Sorghum bicolor [broomcorn]
ref|XP_008665377.1|  PREDICTED: diphosphomevalonate decarboxylase...    205   5e-60   Zea mays [maize]
gb|AAV32433.1|  mevalonate disphosphate decarboxylase                   202   9e-60   Ginkgo biloba [ginkgo]
ref|NP_001045642.2|  Os02g0109100                                       189   1e-57   
tpg|DAA51252.1|  TPA: hypothetical protein ZEAMMB73_408503              205   2e-57   
ref|XP_010067138.1|  PREDICTED: diphosphomevalonate decarboxylase...    194   2e-57   
tpg|DAA51253.1|  TPA: hypothetical protein ZEAMMB73_408503              205   3e-57   
ref|XP_001773902.1|  predicted protein                                  195   8e-57   
ref|XP_010067136.1|  PREDICTED: diphosphomevalonate decarboxylase...    194   2e-56   Eucalyptus grandis [rose gum]
gb|AGT17596.1|  mevalonate diphosphate decarboxylase                    192   1e-55   Picrorhiza kurrooa
ref|XP_003565147.1|  PREDICTED: diphosphomevalonate decarboxylase...    191   2e-55   Brachypodium distachyon [annual false brome]
ref|XP_004954217.1|  PREDICTED: diphosphomevalonate decarboxylase...    189   8e-55   Setaria italica
ref|XP_004963234.1|  PREDICTED: diphosphomevalonate decarboxylase...    189   1e-54   Setaria italica
ref|XP_001774493.1|  predicted protein                                  187   1e-53   
ref|XP_002979347.1|  hypothetical protein SELMODRAFT_268244             176   8e-50   Selaginella moellendorffii
ref|XP_002992344.1|  hypothetical protein SELMODRAFT_135101             176   8e-50   Selaginella moellendorffii
gb|AFW73864.1|  hypothetical protein ZEAMMB73_421648                    139   5e-36   
ref|XP_001121619.2|  PREDICTED: diphosphomevalonate decarboxylase...    133   9e-34   Apis mellifera [bee]
ref|XP_006623086.1|  PREDICTED: diphosphomevalonate decarboxylase...    132   2e-33   Apis dorsata [rock honeybee]
ref|XP_003693647.1|  PREDICTED: diphosphomevalonate decarboxylase...    131   4e-33   Apis florea [dwarf honeybee]
ref|XP_004356734.1|  diphosphomevalonate decarboxylase                  130   9e-33   Acanthamoeba castellanii str. Neff
ref|XP_005708031.1|  diphosphomevalonate decarboxylase isoform 1        128   7e-32   Galdieria sulphuraria
ref|XP_004600545.1|  PREDICTED: diphosphomevalonate decarboxylase       128   9e-32   Sorex araneus [Eurasian shrew]
gb|ABO27200.1|  cytosolic mevalonate-5-diphosphate decarboxylase        120   9e-32   Mesostigma viride
ref|XP_005708030.1|  diphosphomevalonate decarboxylase isoform 2        128   9e-32   Galdieria sulphuraria
ref|XP_003424007.1|  PREDICTED: diphosphomevalonate decarboxylase...    127   1e-31   Nasonia vitripennis
ref|XP_006097406.1|  PREDICTED: diphosphomevalonate decarboxylase       127   1e-31   Myotis lucifugus
ref|XP_003758532.1|  PREDICTED: diphosphomevalonate decarboxylase       127   2e-31   Sarcophilus harrisii
gb|ELK31386.1|  Diphosphomevalonate decarboxylase                       126   2e-31   Myotis davidii
ref|XP_010996754.1|  PREDICTED: diphosphomevalonate decarboxylase...    124   2e-31   Camelus dromedarius [camel]
ref|XP_006762259.1|  PREDICTED: diphosphomevalonate decarboxylase...    126   3e-31   Myotis davidii
ref|XP_011497479.1|  PREDICTED: diphosphomevalonate decarboxylase       125   5e-31   Ceratosolen solmsi marchali
ref|XP_002735076.1|  PREDICTED: diphosphomevalonate decarboxylase...    125   5e-31   Saccoglossus kowalevskii
ref|XP_008137975.1|  PREDICTED: diphosphomevalonate decarboxylase       125   7e-31   Eptesicus fuscus
ref|NP_001133968.1|  Diphosphomevalonate decarboxylase                  125   8e-31   Salmo salar
ref|NP_001093300.1|  diphosphomevalonate decarboxylase                  125   9e-31   Bombyx mori [silk moth]
emb|CDQ87522.1|  unnamed protein product                                124   1e-30   Oncorhynchus mykiss
ref|XP_005862569.1|  PREDICTED: diphosphomevalonate decarboxylase...    124   1e-30   Myotis brandtii
ref|XP_011315112.1|  PREDICTED: diphosphomevalonate decarboxylase...    124   2e-30   Fopius arisanus
ref|XP_001200662.2|  PREDICTED: diphosphomevalonate decarboxylase...    124   2e-30   
ref|XP_010966484.1|  PREDICTED: diphosphomevalonate decarboxylase       124   2e-30   Camelus bactrianus [camel]
ref|XP_003228605.1|  PREDICTED: diphosphomevalonate decarboxylase       124   2e-30   Anolis carolinensis [Carolina anole]
ref|XP_006008326.1|  PREDICTED: diphosphomevalonate decarboxylase...    123   3e-30   
ref|XP_001376834.1|  PREDICTED: diphosphomevalonate decarboxylase       123   4e-30   Monodelphis domestica
emb|CDQ81132.1|  unnamed protein product                                123   4e-30   Oncorhynchus mykiss
ref|XP_006008325.1|  PREDICTED: diphosphomevalonate decarboxylase...    123   5e-30   Latimeria chalumnae
ref|XP_004310733.1|  PREDICTED: diphosphomevalonate decarboxylase       123   5e-30   
ref|XP_008553889.1|  PREDICTED: diphosphomevalonate decarboxylase       123   5e-30   Microplitis demolitor
gb|KDR21975.1|  Diphosphomevalonate decarboxylase                       122   8e-30   Zootermopsis nevadensis
gb|ELU01936.1|  hypothetical protein CAPTEDRAFT_176844                  122   9e-30   Capitella teleta
ref|XP_002913420.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    122   1e-29   
ref|XP_003484695.1|  PREDICTED: diphosphomevalonate decarboxylase...    122   1e-29   
ref|XP_007468497.1|  PREDICTED: diphosphomevalonate decarboxylase       122   1e-29   Lipotes vexillifer [baiji]
ref|NP_001267865.1|  diphosphomevalonate decarboxylase                  122   1e-29   Bombus terrestris [large earth bumblebee]
gb|KJA27615.1|  hypothetical protein HYPSUDRAFT_130498                  122   1e-29   Hypholoma sublateritium FD-334 SS-4
ref|XP_005805001.1|  PREDICTED: diphosphomevalonate decarboxylase...    122   1e-29   Xiphophorus maculatus
ref|NP_619597.2|  diphosphomevalonate decarboxylase                     121   2e-29   Mus musculus [mouse]
ref|XP_004280113.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   Orcinus orca [Orca]
dbj|BAE42019.1|  unnamed protein product                                121   2e-29   Mus musculus [mouse]
emb|CAC35731.1|  diphosphomevalonate decarboxylase                      121   2e-29   Mus musculus [mouse]
dbj|BAC40852.1|  unnamed protein product                                121   2e-29   Mus musculus [mouse]
ref|XP_010739786.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   Larimichthys crocea [croceine croaker]
gb|ELR58766.1|  Diphosphomevalonate decarboxylase                       121   2e-29   Bos mutus
ref|XP_007244091.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   
pdb|3F0N|A  Chain A, Mus Musculus Mevalonate Pyrophosphate Decarb...    121   2e-29   Mus musculus [mouse]
ref|XP_006027907.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   Alligator sinensis
gb|AAH08526.1|  Mevalonate (diphospho) decarboxylase                    121   2e-29   Mus musculus [mouse]
ref|XP_010842266.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   Bison bison bison
ref|XP_005892469.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   Bos mutus
ref|XP_005531982.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004437181.1|  PREDICTED: diphosphomevalonate decarboxylase       121   2e-29   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007125573.1|  PREDICTED: diphosphomevalonate decarboxylase...    121   3e-29   Physeter catodon
ref|NP_001068892.1|  diphosphomevalonate decarboxylase                  121   3e-29   Bos taurus [bovine]
ref|XP_546783.2|  PREDICTED: diphosphomevalonate decarboxylase          121   3e-29   Canis lupus familiaris [dogs]
ref|XP_003702160.1|  PREDICTED: diphosphomevalonate decarboxylase...    120   3e-29   Megachile rotundata
ref|XP_009029357.1|  hypothetical protein HELRODRAFT_185177             120   4e-29   Helobdella robusta
ref|XP_010877776.1|  PREDICTED: diphosphomevalonate decarboxylase       120   4e-29   Esox lucius
ref|XP_006734134.1|  PREDICTED: diphosphomevalonate decarboxylase       120   4e-29   Leptonychotes weddellii
ref|XP_007172621.1|  PREDICTED: diphosphomevalonate decarboxylase       120   4e-29   Balaenoptera acutorostrata scammoni
ref|XP_007549941.1|  PREDICTED: diphosphomevalonate decarboxylase       120   4e-29   Poecilia formosa
ref|XP_008403677.1|  PREDICTED: diphosphomevalonate decarboxylase       120   5e-29   Poecilia reticulata
ref|XP_011370192.1|  PREDICTED: diphosphomevalonate decarboxylase       120   5e-29   Pteropus vampyrus
ref|XP_004392172.1|  PREDICTED: diphosphomevalonate decarboxylase       120   5e-29   Odobenus rosmarus divergens
ref|XP_005956369.1|  PREDICTED: diphosphomevalonate decarboxylase       120   5e-29   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004067388.1|  PREDICTED: diphosphomevalonate decarboxylase       120   5e-29   
ref|XP_011163917.1|  PREDICTED: diphosphomevalonate decarboxylase...    120   5e-29   Solenopsis invicta [imported red fire ant]
ref|XP_002111980.1|  hypothetical protein TRIADDRAFT_55561              120   5e-29   Trichoplax adhaerens
ref|XP_004666010.1|  PREDICTED: diphosphomevalonate decarboxylase       120   6e-29   Jaculus jaculus
ref|XP_011163916.1|  PREDICTED: diphosphomevalonate decarboxylase...    120   6e-29   Solenopsis invicta [imported red fire ant]
gb|ACO09861.1|  Diphosphomevalonate decarboxylase                       120   6e-29   Osmerus mordax
ref|XP_008308874.1|  PREDICTED: diphosphomevalonate decarboxylase       120   6e-29   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006043222.1|  PREDICTED: diphosphomevalonate decarboxylase       120   6e-29   
ref|XP_002592260.1|  hypothetical protein BRAFLDRAFT_277163             120   6e-29   Branchiostoma floridae
ref|XP_002432413.1|  Diphosphomevalonate decarboxylase, putative        120   8e-29   Pediculus humanus corporis [human body lice]
ref|XP_004753891.1|  PREDICTED: diphosphomevalonate decarboxylase       119   8e-29   Mustela putorius furo [black ferret]
gb|KIY47272.1|  Diphosphomevalonate decarboxylase                       119   8e-29   Fistulina hepatica ATCC 64428
ref|NP_001007423.1|  diphosphomevalonate decarboxylase                  119   9e-29   Danio rerio [leopard danio]
ref|XP_004913618.1|  PREDICTED: diphosphomevalonate decarboxylase...    119   1e-28   Xenopus tropicalis [western clawed frog]
ref|XP_004362385.1|  diphosphomevalonate decarboxylase                  119   1e-28   Cavenderia fasciculata
gb|ELK00496.1|  Diphosphomevalonate decarboxylase                       118   1e-28   Pteropus alecto
gb|AAH81784.1|  Mevalonate (diphospho) decarboxylase                    119   1e-28   Rattus norvegicus [brown rat]
ref|XP_005769632.1|  mevalonate-5-diphosphate decarboxylase             119   1e-28   Emiliania huxleyi CCMP1516
ref|XP_002942038.1|  PREDICTED: diphosphomevalonate decarboxylase...    119   1e-28   Xenopus tropicalis [western clawed frog]
ref|XP_008838768.1|  PREDICTED: diphosphomevalonate decarboxylase       119   1e-28   Nannospalax galili
ref|XP_006926815.1|  PREDICTED: diphosphomevalonate decarboxylase       119   1e-28   Pteropus alecto
ref|XP_009089159.1|  PREDICTED: diphosphomevalonate decarboxylase       119   1e-28   Serinus canaria [canary]
ref|XP_010792093.1|  PREDICTED: diphosphomevalonate decarboxylase       119   1e-28   Notothenia coriiceps [yellowbelly rockcod]
ref|NP_112324.1|  diphosphomevalonate decarboxylase                     119   2e-28   Rattus norvegicus [brown rat]
ref|XP_007532001.1|  PREDICTED: diphosphomevalonate decarboxylase       118   2e-28   Erinaceus europaeus [common hedgehog]
ref|XP_004377812.1|  PREDICTED: diphosphomevalonate decarboxylase       118   2e-28   Trichechus manatus latirostris
ref|XP_004058175.1|  PREDICTED: diphosphomevalonate decarboxylase       118   2e-28   
ref|XP_003998380.1|  PREDICTED: diphosphomevalonate decarboxylase       118   2e-28   
ref|XP_002413928.1|  diphosphomevalonate decarboxylase, putative        118   3e-28   Ixodes scapularis [blacklegged tick]
ref|XP_006888835.1|  PREDICTED: diphosphomevalonate decarboxylase       118   3e-28   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005691918.1|  PREDICTED: diphosphomevalonate decarboxylase       118   3e-28   
dbj|GAM24015.1|  hypothetical protein SAMD00019534_071900               118   3e-28   Acytostelium subglobosum LB1
ref|XP_008506971.1|  PREDICTED: diphosphomevalonate decarboxylase       118   3e-28   Equus przewalskii [Przewalski horse]
ref|XP_005052358.1|  PREDICTED: diphosphomevalonate decarboxylase       118   3e-28   
ref|XP_523460.3|  PREDICTED: diphosphomevalonate decarboxylase          118   3e-28   
ref|XP_011058925.1|  PREDICTED: diphosphomevalonate decarboxylase       118   3e-28   Acromyrmex echinatior
gb|ACO11575.1|  Diphosphomevalonate decarboxylase                       118   3e-28   Caligus rogercresseyi
ref|XP_005915248.1|  PREDICTED: diphosphomevalonate decarboxylase...    118   3e-28   Haplochromis burtoni
ref|XP_006780089.1|  PREDICTED: diphosphomevalonate decarboxylase...    118   4e-28   Neolamprologus brichardi [lyretail cichlid]
ref|XP_006641302.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    117   4e-28   
ref|XP_005753004.1|  PREDICTED: diphosphomevalonate decarboxylase...    117   4e-28   Pundamilia nyererei
gb|AAP36301.1|  Homo sapiens mevalonate (diphospho) decarboxylase       117   4e-28   synthetic construct
ref|NP_002452.1|  diphosphomevalonate decarboxylase                     117   4e-28   Homo sapiens [man]
ref|XP_006212468.1|  PREDICTED: diphosphomevalonate decarboxylase       117   5e-28   Vicugna pacos
gb|AAH63907.1|  mvd-prov protein                                        117   5e-28   Xenopus tropicalis [western clawed frog]
ref|XP_001488083.1|  PREDICTED: diphosphomevalonate decarboxylase       117   5e-28   Equus caballus [domestic horse]
gb|AJP70489.1|  diphosphomevalonate decarboxylase                       117   5e-28   Helicoverpa armigera [American bollworm]
ref|XP_642143.1|  diphosphomevalonate decarboxylase                     117   5e-28   Dictyostelium discoideum AX4
ref|XP_003287684.1|  hypothetical protein DICPUDRAFT_32847              117   5e-28   Dictyostelium purpureum
ref|XP_007937353.1|  PREDICTED: diphosphomevalonate decarboxylase       117   6e-28   Orycteropus afer afer
ref|XP_003442298.1|  PREDICTED: diphosphomevalonate decarboxylase...    117   6e-28   Oreochromis niloticus
ref|XP_008300019.1|  PREDICTED: diphosphomevalonate decarboxylase       117   7e-28   Stegastes partitus
ref|XP_004539436.1|  PREDICTED: diphosphomevalonate decarboxylase...    117   7e-28   Maylandia zebra
ref|XP_005292289.1|  PREDICTED: diphosphomevalonate decarboxylase       117   7e-28   Chrysemys picta bellii
ref|XP_004584295.1|  PREDICTED: diphosphomevalonate decarboxylase       117   8e-28   Ochotona princeps [southern American pika]
ref|XP_002761300.1|  PREDICTED: diphosphomevalonate decarboxylase       117   9e-28   Callithrix jacchus [common marmoset]
ref|XP_006860173.1|  PREDICTED: diphosphomevalonate decarboxylase       116   1e-27   Chrysochloris asiatica
ref|XP_005345851.1|  PREDICTED: diphosphomevalonate decarboxylase       116   1e-27   Microtus ochrogaster [prairie voles]
ref|XP_010577890.1|  PREDICTED: diphosphomevalonate decarboxylase       116   1e-27   Haliaeetus leucocephalus
ref|XP_004015005.1|  PREDICTED: diphosphomevalonate decarboxylase       116   1e-27   
ref|XP_001978042.1|  GG17907                                            116   1e-27   Drosophila erecta
ref|XP_003805806.1|  PREDICTED: diphosphomevalonate decarboxylase       116   1e-27   Pan paniscus [bonobo]
ref|XP_009561527.1|  PREDICTED: diphosphomevalonate decarboxylase       115   2e-27   Cuculus canorus
ref|XP_004645091.1|  PREDICTED: diphosphomevalonate decarboxylase       115   2e-27   Octodon degus
ref|XP_010716493.1|  PREDICTED: diphosphomevalonate decarboxylase       115   2e-27   Meleagris gallopavo [common turkey]
ref|XP_003281885.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    115   2e-27   
ref|XP_003970115.1|  PREDICTED: diphosphomevalonate decarboxylase...    115   2e-27   Takifugu rubripes [tiger puffer]
ref|XP_002100713.1|  GE17215                                            115   2e-27   Drosophila yakuba
ref|XP_010353865.1|  PREDICTED: diphosphomevalonate decarboxylase...    115   3e-27   Rhinopithecus roxellana
ref|XP_004704798.1|  PREDICTED: diphosphomevalonate decarboxylase       115   3e-27   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003460964.1|  PREDICTED: diphosphomevalonate decarboxylase       115   3e-27   Cavia porcellus [guinea pig]
gb|KIM44772.1|  hypothetical protein M413DRAFT_442732                   115   4e-27   Hebeloma cylindrosporum h7
ref|XP_010353864.1|  PREDICTED: diphosphomevalonate decarboxylase...    115   4e-27   Rhinopithecus roxellana
ref|XP_007266924.1|  Diphosphomevalonate decarboxylase                  115   4e-27   Fomitiporia mediterranea MF3/22
ref|XP_005073260.1|  PREDICTED: diphosphomevalonate decarboxylase       115   4e-27   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007887516.1|  PREDICTED: diphosphomevalonate decarboxylase       115   4e-27   
ref|XP_007371446.1|  Diphosphomevalonate decarboxylase                  115   4e-27   
ref|XP_003495141.1|  PREDICTED: diphosphomevalonate decarboxylase...    115   4e-27   
ref|XP_007651118.1|  PREDICTED: diphosphomevalonate decarboxylase...    114   4e-27   
gb|KIK02242.1|  hypothetical protein K443DRAFT_677763                   115   5e-27   
ref|XP_005592828.1|  PREDICTED: diphosphomevalonate decarboxylase...    114   5e-27   
ref|XP_005592827.1|  PREDICTED: diphosphomevalonate decarboxylase...    114   5e-27   
ref|NP_001247472.1|  diphosphomevalonate decarboxylase                  114   5e-27   
ref|XP_423130.3|  PREDICTED: diphosphomevalonate decarboxylase is...    114   5e-27   
ref|XP_003917347.1|  PREDICTED: diphosphomevalonate decarboxylase       114   6e-27   
ref|XP_003922886.1|  PREDICTED: diphosphomevalonate decarboxylase       114   6e-27   
ref|XP_004944354.1|  PREDICTED: diphosphomevalonate decarboxylase...    114   6e-27   
ref|XP_002044182.1|  GM22575                                            114   8e-27   
ref|XP_001873551.1|  predicted protein                                  114   8e-27   
ref|XP_003743316.1|  PREDICTED: diphosphomevalonate decarboxylase...    114   8e-27   
ref|XP_006987448.1|  PREDICTED: diphosphomevalonate decarboxylase       114   9e-27   
ref|XP_001880930.1|  predicted protein                                  114   9e-27   
ref|XP_007992525.1|  PREDICTED: diphosphomevalonate decarboxylase...    113   1e-26   
gb|EUC58622.1|  diphosphomevalonate decarboxylase                       114   1e-26   
ref|XP_004989623.1|  diphosphomevalonate decarboxylase                  114   1e-26   
ref|XP_007992523.1|  PREDICTED: diphosphomevalonate decarboxylase...    114   1e-26   
gb|EFX83630.1|  hypothetical protein DAPPUDRAFT_301631                  113   1e-26   
ref|XP_011257108.1|  PREDICTED: diphosphomevalonate decarboxylase       112   2e-26   
ref|XP_004842741.1|  PREDICTED: diphosphomevalonate decarboxylase       113   2e-26   
ref|XP_001648384.1|  AAEL004050-PA                                      112   3e-26   
ref|XP_003029710.1|  hypothetical protein SCHCODRAFT_69496              112   3e-26   
gb|KJE94985.1|  diphosphomevalonate decarboxylase, variant 3            111   3e-26   
gb|EFA74532.1|  diphosphomevalonate decarboxylase                       112   3e-26   
ref|XP_007334426.1|  hypothetical protein AGABI1DRAFT_116646            112   4e-26   
ref|XP_006457330.1|  hypothetical protein AGABI2DRAFT_196085            112   4e-26   
gb|KIM45531.1|  hypothetical protein M413DRAFT_442202                   112   4e-26   
gb|AEE63249.1|  unknown                                                 112   5e-26   
gb|KDR67556.1|  hypothetical protein GALMADRAFT_258221                  112   5e-26   
ref|XP_004346191.2|  diphosphomevalonate decarboxylase                  111   6e-26   
ref|XP_970108.1|  PREDICTED: diphosphomevalonate decarboxylase is...    111   6e-26   
ref|XP_010625831.1|  PREDICTED: diphosphomevalonate decarboxylase       111   7e-26   
ref|XP_002394746.1|  hypothetical protein MPER_05313                    105   9e-26   
gb|KIJ60024.1|  hypothetical protein HYDPIDRAFT_99556                   111   9e-26   
gb|KDO31253.1|  diphosphomevalonate decarboxylase                       110   1e-25   
ref|XP_008613422.1|  hypothetical protein SDRG_09280                    111   1e-25   
ref|XP_009066482.1|  hypothetical protein LOTGIDRAFT_211321             110   1e-25   
gb|ELU38465.1|  diphosphomevalonate decarboxylase                       110   1e-25   
gb|AEB00646.1|  mevalonate pyrophosphate decarboxylase                  110   1e-25   
ref|XP_011153018.1|  PREDICTED: diphosphomevalonate decarboxylase...    110   2e-25   
gb|ENN75638.1|  hypothetical protein YQE_07816                          110   2e-25   
gb|ERL86359.1|  hypothetical protein D910_03767                         110   2e-25   
gb|AFI45055.1|  diphosphomevalonate decarboxylase                       110   2e-25   
gb|ETN57980.1|  diphosphomevalonate decarboxylase                       110   2e-25   
gb|KFM61632.1|  Diphosphomevalonate decarboxylase                       110   2e-25   
ref|XP_008034164.1|  Diphosphomevalonate decarboxylase                  110   2e-25   
gb|KIY64502.1|  Diphosphomevalonate decarboxylase                       110   2e-25   
gb|KDN34074.1|  hypothetical protein RSAG8_12833                        110   3e-25   
ref|XP_007851999.1|  diphosphomevalonate decarboxylase                  110   3e-25   
gb|EJK65080.1|  hypothetical protein THAOC_14117                        108   3e-25   
ref|XP_001986237.1|  GH20637                                            109   3e-25   
ref|XP_009821609.1|  diphosphomevalonate decarboxylase, variant         109   3e-25   
ref|XP_007308164.1|  Diphosphomevalonate decarboxylase                  109   4e-25   
ref|XP_009821608.1|  diphosphomevalonate decarboxylase                  109   4e-25   
gb|KIR85269.1|  diphosphomevalonate decarboxylase                       109   5e-25   
gb|KDQ21756.1|  hypothetical protein BOTBODRAFT_26181                   109   5e-25   
ref|XP_001844728.1|  diphosphomevalonate decarboxylase                  108   6e-25   
ref|XP_007317911.1|  hypothetical protein SERLADRAFT_466408             108   6e-25   
gb|KFK34801.1|  hypothetical protein AALP_AA5G195000                    103   6e-25   
gb|EIE86507.1|  diphosphomevalonate decarboxylase                       108   7e-25   
ref|NP_573068.3|  CG8239, isoform A                                     108   7e-25   
emb|CDR37714.1|  CYFA0S01e15566g1_1                                     108   7e-25   
emb|CBJ48557.1|  Diphosphomevalonate decarboxylase                      108   8e-25   
emb|CDO69145.1|  hypothetical protein BN946_scf185042.g47               108   8e-25   
gb|KIL66419.1|  hypothetical protein M378DRAFT_389057                   108   8e-25   
ref|XP_009547604.1|  hypothetical protein HETIRDRAFT_440521             108   8e-25   
ref|XP_003383859.1|  PREDICTED: diphosphomevalonate decarboxylase...    108   1e-24   
gb|KDN43409.1|  putative MVD1-mevalonate pyrophosphate decarboxylase    108   1e-24   
ref|XP_008862510.1|  diphosphomevalonate decarboxylase                  108   1e-24   
ref|XP_002287031.1|  mevalonate disphosphate decarboxylase-like p...    107   1e-24   
gb|KIR59630.1|  diphosphomevalonate decarboxylase                       107   2e-24   
ref|XP_003418108.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    107   2e-24   
gb|KIR46285.1|  diphosphomevalonate decarboxylase                       107   2e-24   
ref|XP_003193399.1|  diphosphomevalonate decarboxylase                  107   2e-24   
gb|KIR53986.1|  diphosphomevalonate decarboxylase                       107   2e-24   
emb|CEI99330.1|  Putative Diphosphomevalonate decarboxylase             107   2e-24   
ref|XP_002176299.1|  MPDC mevalonate diphosphate decarboxylase          107   2e-24   
gb|KII92627.1|  hypothetical protein PLICRDRAFT_102539                  107   2e-24   
emb|CEG64400.1|  Putative Diphosphomevalonate decarboxylase             107   3e-24   
gb|KIS02378.1|  diphosphomevalonate decarboxylase                       107   3e-24   
ref|XP_005819249.1|  mevalonate pyrophosphate decarboxylase             107   3e-24   
ref|XP_008190498.1|  PREDICTED: diphosphomevalonate decarboxylase...    107   3e-24   
emb|CAF99534.1|  unnamed protein product                                106   3e-24   
gb|KGB78727.1|  diphosphomevalonate decarboxylase                       106   3e-24   
gb|KIJ49692.1|  hypothetical protein M422DRAFT_205223                   106   5e-24   
ref|XP_007339537.1|  Diphosphomevalonate decarboxylase                  106   5e-24   
gb|EHJ66886.1|  diphosphomevalonate decarboxylase                       106   6e-24   
ref|XP_005105464.1|  PREDICTED: diphosphomevalonate decarboxylase...    106   6e-24   
emb|CDS06586.1|  hypothetical protein LRAMOSA09114                      106   6e-24   
dbj|BAO38704.1|  diphosphomevalonate decarboxylase                      105   6e-24   
ref|XP_002497180.1|  ZYRO0D17270p                                       105   6e-24   
ref|XP_321487.3|  AGAP001611-PA                                         105   6e-24   
ref|XP_001600914.2|  PREDICTED: diphosphomevalonate decarboxylase...    105   9e-24   
ref|XP_003688208.1|  hypothetical protein TPHA_0M01990                  105   1e-23   
ref|XP_455548.1|  hypothetical protein                                  105   1e-23   
ref|XP_002050863.1|  GJ19966                                            105   1e-23   
gb|KFH65647.1|  diphosphomevalonate decarboxylase                       105   1e-23   
ref|XP_001830848.1|  diphosphomevalonate decarboxylase                  105   1e-23   
ref|XP_006122792.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    105   1e-23   
gb|KDQ27550.1|  hypothetical protein PLEOSDRAFT_1093271                 105   1e-23   
ref|XP_007381587.1|  Diphosphomevalonate decarboxylase                  104   2e-23   
gb|KIK91362.1|  hypothetical protein PAXRUDRAFT_830905                  104   2e-23   
gb|AFR94390.1|  diphosphomevalonate decarboxylase                       104   2e-23   
ref|XP_002028521.1|  GL14496                                            104   2e-23   
dbj|GAA95012.1|  hypothetical protein E5Q_01667                         104   3e-23   
gb|KJA24995.1|  hypothetical protein HYPSUDRAFT_135519                99.4    3e-23   
emb|CCA67606.1|  probable MVD1-mevalonate pyrophosphate decarboxy...    104   3e-23   
ref|XP_445335.1|  hypothetical protein                                  103   3e-23   
ref|XP_002075379.1|  GK17667                                            103   4e-23   
ref|XP_011275729.1|  Diphosphomevalonate decarboxylase                  103   4e-23   
gb|KIO19559.1|  hypothetical protein M407DRAFT_16104                    103   4e-23   
gb|KIM80988.1|  hypothetical protein PILCRDRAFT_9035                  99.8    4e-23   
ref|XP_006686867.1|  hypothetical protein CANTEDRAFT_122822             103   4e-23   
gb|KEZ44709.1|  Diphosphomevalonate decarboxylase                       103   5e-23   
gb|KDO47062.1|  hypothetical protein CISIN_1g014714mg                   103   5e-23   
emb|CDO95793.1|  unnamed protein product                                103   6e-23   
gb|KIM31275.1|  hypothetical protein M408DRAFT_64547                    102   1e-22   
ref|XP_002551773.1|  KLTH0A07238p                                       102   1e-22   
ref|XP_568247.1|  diphosphomevalonate decarboxylase                     102   2e-22   
ref|XP_001386025.1|  hypothetical protein PICST_90752                   102   2e-22   
gb|EMG46004.1|  Diphosphomevalonate decarboxylase                       101   2e-22   
emb|CEP61092.1|  LALA0S02e06546g1_1                                     101   2e-22   
ref|XP_003956599.1|  hypothetical protein KAFR_0C04730                  101   2e-22   
ref|XP_007082922.1|  PREDICTED: diphosphomevalonate decarboxylase...  99.4    2e-22   
gb|KIM69548.1|  hypothetical protein SCLCIDRAFT_1208005                 101   2e-22   
gb|AAA34506.2|  ORF                                                   99.0    3e-22   
gb|ACC62033.1|  mevalonate diphosphate decarboxylase                  95.9    3e-22   
ref|XP_001646609.1|  hypothetical protein Kpol_1028p24                  101   3e-22   
ref|XP_773574.1|  hypothetical protein CNBI1880                         100   4e-22   
gb|EPT04682.1|  hypothetical protein FOMPIDRAFT_1140388                 100   4e-22   
emb|CEJ91790.1|  Putative Diphosphomevalonate decarboxylase             100   4e-22   
gb|EPB83704.1|  diphosphomevalonate decarboxylase                       100   4e-22   
gb|ESA02764.1|  hypothetical protein GLOINDRAFT_337188                  100   5e-22   
dbj|GAN02670.1|  diphosphomevalonate decarboxylase                      100   5e-22   
emb|CCL99644.1|  predicted protein                                      100   5e-22   
ref|XP_009902760.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    100   5e-22   
ref|XP_003800873.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    100   5e-22   
gb|EMD33647.1|  hypothetical protein CERSUDRAFT_117755                  100   6e-22   
gb|AJT16805.1|  Mvd1p                                                   100   7e-22   
ref|XP_007864729.1|  hypothetical protein GLOTRDRAFT_127445             100   7e-22   
gb|KIM72212.1|  hypothetical protein PILCRDRAFT_829911                  100   7e-22   
ref|XP_007767205.1|  Diphosphomevalonate decarboxylase                  100   7e-22   
gb|EMS63646.1|  Diphosphomevalonate decarboxylase                     99.4    8e-22   
gb|EDZ69577.1|  YNR043Wp-like protein                                   100   8e-22   
gb|AEY98585.1|  FAGL232Cp                                               100   9e-22   
ref|XP_002005564.1|  GI19000                                          99.8    1e-21   
ref|NP_986435.2|  AGL232Cp                                            99.8    1e-21   
gb|EHN00406.1|  Mvd1p                                                 99.8    1e-21   
gb|AJT25337.1|  Mvd1p                                                 99.4    1e-21   
ref|XP_003673492.1|  hypothetical protein NCAS_0A05510                99.4    1e-21   
ref|XP_008602812.1|  diphosphomevalonate decarboxylase                99.4    1e-21   
gb|KGQ07524.1|  Diphosphomevalonate decarboxylase                     99.4    1e-21   
ref|XP_001628780.1|  predicted protein                                99.4    1e-21   
ref|XP_006673782.1|  diphosphomevalonate decarboxylase                99.0    2e-21   
gb|EDN62849.1|  mevalonate pyrophosphate decarboxylase                99.0    2e-21   
gb|AJT30847.1|  Mvd1p                                                 99.0    2e-21   
gb|AJT04035.1|  Mvd1p                                                 99.0    2e-21   
gb|KGU33407.1|  diphosphomevalonate decarboxylase                     98.6    2e-21   
gb|AJT02547.1|  Mvd1p                                                 99.0    2e-21   
gb|EEU08298.1|  Mvd1p                                                 99.0    2e-21   
ref|NP_014441.1|  diphosphomevalonate decarboxylase MVD1              99.0    2e-21   
gb|AAF19399.1|AF203779_1  diphosphomevalonate decarboxylase MVD1      98.6    2e-21   
gb|EEQ43122.1|  diphosphomevalonate decarboxylase                     98.6    2e-21   
gb|EDV12224.1|  mevalonate pyrophosphate decarboxylase                99.0    2e-21   
dbj|GAA26136.1|  K7_Mvd1p                                             99.0    2e-21   
gb|KGQ99147.1|  diphosphomevalonate decarboxylase                     98.6    2e-21   
gb|AJT22350.1|  Mvd1p                                                 99.0    2e-21   
gb|AAT93171.1|  YNR043W                                               99.0    2e-21   
gb|AJT04410.1|  Mvd1p                                                 99.0    2e-21   
gb|KGR23081.1|  diphosphomevalonate decarboxylase                     98.6    2e-21   
ref|XP_002616213.1|  hypothetical protein CLUG_03454                  98.6    2e-21   
gb|AJT07024.1|  Mvd1p                                                 98.6    2e-21   
emb|CEP12016.1|  hypothetical protein                                 98.6    3e-21   
ref|XP_456912.2|  DEHA2A13398p                                        98.6    3e-21   
gb|ESW97073.1|  Diphosphomevalonate decarboxylase                     98.2    3e-21   
ref|XP_004535245.1|  PREDICTED: diphosphomevalonate decarboxylase...  98.2    4e-21   
ref|XP_004535244.1|  PREDICTED: diphosphomevalonate decarboxylase...  98.2    4e-21   
pdb|1FI4|A  Chain A, The X-Ray Crystal Structure Of Mevalonate 5-...  98.2    5e-21   
ref|XP_011105331.1|  mvd1p                                            97.8    5e-21   
emb|CCG83278.1|  Diphosphomevalonate decarboxylase                    97.8    5e-21   
gb|KIK39127.1|  hypothetical protein CY34DRAFT_808602                 97.8    5e-21   
gb|KID80423.1|  diphosphomevalonate decarboxylase                     97.8    5e-21   
ref|XP_002837299.1|  hypothetical protein                             97.8    5e-21   
gb|KFG78069.1|  diphosphomevalonate decarboxylase                     97.8    5e-21   
gb|KDQ55805.1|  hypothetical protein JAAARDRAFT_195621                97.8    5e-21   
gb|AJT18309.1|  Mvd1p                                                 97.8    6e-21   
ref|XP_007878778.1|  hypothetical protein PFL1_03071                  97.8    6e-21   
ref|XP_002416688.1|  diphosphomevalonate decarboxylase, putative;...  97.4    6e-21   
emb|CEI98959.1|  Putative Diphosphomevalonate decarboxylase           98.2    6e-21   
gb|KDN71936.1|  putative diphosphomevalonate decarboxylase            97.4    7e-21   
ref|XP_006675737.1|  hypothetical protein BATDEDRAFT_34046            99.8    7e-21   
ref|XP_011388229.1|  putative mevalonate pyrophosphate decarboxylase  97.8    8e-21   
ref|XP_007821634.1|  Diphosphomevalonate decarboxylase                97.1    9e-21   
gb|AJT26802.1|  Mvd1p                                                 97.1    1e-20   
ref|XP_505041.1|  YALI0F05632p                                        96.7    1e-20   
emb|CCI45990.1|  unnamed protein product                              97.4    1e-20   
emb|CDK26220.1|  unnamed protein product                              96.7    1e-20   
ref|XP_007670945.1|  PREDICTED: diphosphomevalonate decarboxylase     97.1    1e-20   
gb|EGI62780.1|  Diphosphomevalonate decarboxylase                     97.1    1e-20   
gb|KIM81484.1|  hypothetical protein PILCRDRAFT_821272                93.6    1e-20   
gb|KIW05370.1|  diphosphomevalonate decarboxylase                     96.7    1e-20   
ref|XP_009495556.1|  hypothetical protein H696_03415                  96.7    1e-20   
emb|CDI52963.1|  probable MVD1-mevalonate pyrophosphate decarboxy...  96.7    2e-20   
ref|XP_008180336.1|  PREDICTED: diphosphomevalonate decarboxylase...  95.9    2e-20   
gb|KID99722.1|  diphosphomevalonate decarboxylase                     96.3    2e-20   
ref|NP_001192100.1|  diphosphomevalonate decarboxylase                96.3    2e-20   
emb|CCK69779.1|  hypothetical protein KNAG_0D00260                    96.3    2e-20   
gb|KIO09474.1|  hypothetical protein M404DRAFT_996320                 95.9    2e-20   
ref|XP_003868196.1|  Mvd mevalonate diphosphate decarboxylase         95.9    2e-20   
gb|KID90538.1|  diphosphomevalonate decarboxylase                     95.9    3e-20   
gb|KIK24803.1|  hypothetical protein PISMIDRAFT_97834                 95.9    3e-20   
ref|XP_003654883.1|  diphosphomevalonate decarboxylase                95.5    3e-20   
ref|XP_004204654.1|  Piso0_000514                                     95.5    3e-20   
ref|XP_007059404.1|  PREDICTED: diphosphomevalonate decarboxylase     95.5    3e-20   
ref|XP_005182349.1|  PREDICTED: diphosphomevalonate decarboxylase     95.5    3e-20   
ref|XP_003848249.1|  MVD1, mevalonate pyrophosphate decarboxylase     95.5    4e-20   
ref|XP_007372031.1|  hypothetical protein SPAPADRAFT_132255           95.1    4e-20   



>ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
 gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
Length=415

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MAE+WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAFD
Sbjct  1    MAERWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFD  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED++KGIKI KKDWE LHVHIAS+NNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKEKGIKIAKKDWEKLHVHIASFNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>gb|KDO47061.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=254

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_011024216.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 1/140 (1%)
 Frame = +3

Query  87   MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  263
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  264  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DQDRMWLNGKE+SLSG RYQNCL+EIRA+ACDVEDE+KGIKI KKDWE LHVH+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRAQACDVEDEEKGIKIAKKDWEKLHVHVASYNNF  120

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAGFACLVFAL
Sbjct  121  PTAAGLASSAAGFACLVFAL  140



>ref|XP_006367129.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=151

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEKKGIKI KKDWENLHVH+ASYNNFPT
Sbjct  65   DRMWLNGKEISLSGDRYQNCLREIRARANDVEDEKKGIKIAKKDWENLHVHVASYNNFPT  124

Query  450  aaglassaagfaCLV  494
            AAGLASSAAGFACLV
Sbjct  125  AAGLASSAAGFACLV  139



>gb|KDO47060.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=344

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_002315441.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEF01612.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   241 bits (615),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 1/140 (1%)
 Frame = +3

Query  87   MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  263
            MA K WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAGKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  264  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DQDRMWLNGKE+SLSG RYQNCL+EIRA+ACD EDE+KGIKITKKDWE LHVH+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRAQACDAEDEEKGIKITKKDWEKLHVHVASYNNF  120

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAGFACLVFAL
Sbjct  121  PTAAGLASSAAGFACLVFAL  140



>gb|KJB78631.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=293

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MAE WV+MVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP HLCTTTTVAVSP+F 
Sbjct  1    MAESWVIMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPVHLCTTTTVAVSPSFA  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED+++GIKI+KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLHVHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MAE WV+MVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTVAVSP+F 
Sbjct  1    MAESWVIMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVAVSPSFA  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED+++GIKI+KKDWE L+VHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLYVHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>gb|KDP35789.1| hypothetical protein JCGZ_10425 [Jatropha curcas]
Length=415

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MAEKWV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP+HLCTTTTVAVSP FD
Sbjct  1    MAEKWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPSHLCTTTTVAVSPTFD  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG R+Q+CL+EIRARACDVED++KGIKI KKDW+ LHVH+ASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRARACDVEDKEKGIKIVKKDWDKLHVHMASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>ref|XP_011032862.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 135/140 (96%), Gaps = 1/140 (1%)
 Frame = +3

Query  87   MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  263
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKTWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  264  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DQDRMWLNGKE+SLSG RYQNCL+EIRARAC+VED++KGIKI KKDWE LH+H+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRARACEVEDKEKGIKIAKKDWEKLHLHVASYNNF  120

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAGFACLVFAL
Sbjct  121  PTAAGLASSAAGFACLVFAL  140



>gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharanthus roseus]
Length=421

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 134/142 (94%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   MAEK---WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSP  257
            MAEK   WVLMVTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDPAHLCTTTTVAVSP
Sbjct  1    MAEKNDSWVLMVTAQTPTNIAVIKYWGKRDENLILPINDSISVTLDPAHLCTTTTVAVSP  60

Query  258  AFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            AF QDRMWLNGKE+SLSG RYQNCL+EIR+RA DVEDEKKGIKITKKDWE LH+HIASYN
Sbjct  61   AFTQDRMWLNGKEISLSGGRYQNCLREIRSRANDVEDEKKGIKITKKDWEKLHLHIASYN  120

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAGFACLVF+L
Sbjct  121  NFPTAAGLASSAAGFACLVFSL  142



>gb|AII99848.1| mevalonate disphosphate decarboxylase [Nicotiana tabacum]
Length=418

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKI KKDWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKIVKKDWENLHVHIASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLV++L
Sbjct  125  AAGLASSAAGFACLVYSL  142



>gb|KJB78632.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=345

 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>gb|KDO47059.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=420

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_009792788.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKI KKDWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKIVKKDWENLHVHIASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLV++L
Sbjct  125  AAGLASSAAGFACLVYSL  142



>ref|XP_002311015.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEE88382.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   239 bits (609),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 134/140 (96%), Gaps = 1/140 (1%)
 Frame = +3

Query  87   MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  263
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKTWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  264  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DQDRMWLNGKE+SLSG RYQNCL+EIRARAC VED++KGIKI KKDWE LH+H+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRARACAVEDKEKGIKIAKKDWEKLHLHVASYNNF  120

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAGFACLVFAL
Sbjct  121  PTAAGLASSAAGFACLVFAL  140



>ref|XP_009619582.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   239 bits (609),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKITK DWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKITKNDWENLHVHIASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLV++L
Sbjct  125  AAGLASSAAGFACLVYSL  142



>gb|KHG20401.1| Mvd [Gossypium arboreum]
Length=423

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKEMSLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEMSLSGGRYQNCLREIRKRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>gb|KHG20400.1| Mvd [Gossypium arboreum]
Length=459

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  37   MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  96

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKEMSLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  97   QDRMWLNGKEMSLSGGRYQNCLREIRKRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  156

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  157  TAAGLASSAAGFACLVFAL  175



>ref|XP_009630346.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            + WVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAFDQD
Sbjct  7    QNWVLMVTAQTPTNIAVIKYWGKRDEDLILAINDSISVTLDPAHLCTTTTVAVSPAFDQD  66

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVH+ASYNNFPTA
Sbjct  67   RMWLNGKEISLSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHVASYNNFPTA  126

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  127  AGLASSAAGFACLVFSL  143



>gb|KJB78629.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
 gb|KJB78630.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=415

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>emb|CDO99902.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 2/141 (1%)
 Frame = +3

Query  87   MAEK--WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            MAEK  WVLMVTAQTPTNIAVIKYWGKRDE+LILPINDSISVTLDP+HLCTTTTVAVSP 
Sbjct  1    MAEKKSWVLMVTAQTPTNIAVIKYWGKRDESLILPINDSISVTLDPSHLCTTTTVAVSPG  60

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F  DRMWLNGKE+SLSG RYQNCL+EIR+RA DVEDEKKGIKI KKDWENLH+HIASYNN
Sbjct  61   FTHDRMWLNGKEISLSGGRYQNCLREIRSRASDVEDEKKGIKIAKKDWENLHLHIASYNN  120

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLV++L
Sbjct  121  FPTAAGLASSAAGFACLVYSL  141



>gb|AID51442.1| mevalonate diphosphate decarboxylase [Astragalus membranaceus]
Length=420

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++ WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSPAF+Q
Sbjct  5    SQNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPNHLCTTTTVAVSPAFNQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVED KKG+KITK+DW  LHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDTKKGVKITKEDWSKLHVHIASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLV+AL
Sbjct  125  AAGLASSAAGFACLVYAL  142



>ref|XP_009795010.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +3

Query  87   MAEK---WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSP  257
            MAE+   WVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP
Sbjct  1    MAEQLQNWVLMVTAQTPTNIAVIKYWGKRDEDLILAINDSISVTLDPAHLCTTTTVAVSP  60

Query  258  AFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            AF+QDRMWLNGKE+SLSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVHI SYN
Sbjct  61   AFNQDRMWLNGKEISLSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIVSYN  120

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAGFACLVF+L
Sbjct  121  NFPTAAGLASSAAGFACLVFSL  142



>ref|XP_007142839.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
 gb|ESW14833.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
Length=420

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
             + ++ WV+MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP 
Sbjct  2    ASESQNWVVMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPT  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F QDRMWLNGKE+SLSG R+QNCL+EIR+RACDVEDEKKGIKI K+DW  LHVHIASYNN
Sbjct  62   FQQDRMWLNGKEISLSGGRFQNCLREIRSRACDVEDEKKGIKIRKEDWSKLHVHIASYNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACL +AL
Sbjct  122  FPTAAGLASSAAGFACLAYAL  142



>ref|XP_006359351.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=429

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWL GKE+SLSG RYQNCL+EIRARA DVEDEKKGIKITKKDWENL VH+ASYNNFPT
Sbjct  65   DRMWLLGKEISLSGGRYQNCLREIRARANDVEDEKKGIKITKKDWENLRVHVASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLV++L
Sbjct  125  AAGLASSAAGFACLVYSL  142



>ref|XP_007010317.1| Mevalonate diphosphate decarboxylase 1 isoform 4 [Theobroma cacao]
 gb|EOY19127.1| Mevalonate diphosphate decarboxylase 1 isoform 4 [Theobroma cacao]
Length=288

 Score =   230 bits (586),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>ref|XP_008232018.1| PREDICTED: diphosphomevalonate decarboxylase-like [Prunus mume]
Length=419

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTV+VSPAFDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVSVSPAFDQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+Q+CL+EIR+RA DV D++KGIKITKKDWE L+VHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRSRATDVHDKEKGIKITKKDWEKLNVHIASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  125  AAGLASSAAGFACLVFAL  142



>ref|XP_007010316.1| GHMP kinase family protein isoform 3 [Theobroma cacao]
 gb|EOY19126.1| GHMP kinase family protein isoform 3 [Theobroma cacao]
Length=315

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>gb|EPS58761.1| hypothetical protein M569_16051, partial [Genlisea aurea]
Length=207

 Score =   226 bits (575),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKW+L VTA+TPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAFD+
Sbjct  3    AEKWILTVTARTPTNIAVIKYWGKRDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+E+R+RA D EDE KGIKI+ +DW+ LHVHI SYNNFPT
Sbjct  63   DRMWLNGKEVSLSGKRYQNCLRELRSRASDYEDENKGIKISSEDWQKLHVHIVSYNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVFAL
Sbjct  123  AAGLASSAAGLACLVFAL  140



>gb|KEH44325.1| mevalonate diphosphate decarboxylase [Medicago truncatula]
Length=418

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTV+VSP+F Q
Sbjct  3    GDSWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVSVSPSFQQ  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVED KKGIKITK+DW  L+VHIASYNNFPT
Sbjct  63   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDNKKGIKITKEDWSKLYVHIASYNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLV++L
Sbjct  123  AAGLASSAAGFACLVYSL  140



>gb|KHN11470.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=421

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP+HLCTTTT AVSPAF Q
Sbjct  6    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPSHLCTTTTAAVSPAFHQ  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDETKGIKITKEDWGKLHVHIASYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACL +AL
Sbjct  126  AAGLASSAAGFACLAYAL  143



>ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
 gb|EMJ12943.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
Length=419

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTV+VSP+FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVSVSPSFDQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+Q+CL+EIR+RA DV D++KGIKITKKDWE L+VHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRSRATDVHDKEKGIKITKKDWEKLNVHIASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  125  AAGLASSAAGFACLVFAL  142



>ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=421

 Score =   231 bits (589),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP+HLCTTTT AVSPAF Q
Sbjct  6    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPSHLCTTTTAAVSPAFHQ  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDETKGIKITKEDWGKLHVHIASYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACL +AL
Sbjct  126  AAGLASSAAGFACLAYAL  143



>ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cicer arietinum]
Length=421

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            G   + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+
Sbjct  3    GDSQQNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPNHLCTTTTVAVSPS  62

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F QDRMWLNGKE+SLSG R+Q+CL+EIRARAC+VED KKGIKITK+DW   H+HIASYNN
Sbjct  63   FQQDRMWLNGKEISLSGGRFQSCLREIRARACEVEDNKKGIKITKEDWGKFHIHIASYNN  122

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLV+AL
Sbjct  123  FPTAAGLASSAAGFACLVYAL  143



>ref|XP_006403598.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45051.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=316

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KGI+I KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGIRIEKKDWEKLHLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_006411092.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
 gb|ESQ52545.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
Length=341

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWVLMVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVLMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED+ KGIKI KKDWE LH+HIASYNNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRCRADDVEDKVKGIKIAKKDWEKLHLHIASYNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVFAL
Sbjct  124  AGLASSAAGFACLVFAL  140



>gb|ABG24207.2| mevalonate disphosphate decarboxylase [Arnebia euchroma]
Length=421

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            G   E W+LMVTAQTPTNIAVIKYWGKRDE+LILPIN SISVTLDP+HLCTTTTV+VSP+
Sbjct  2    GEQGENWILMVTAQTPTNIAVIKYWGKRDESLILPINSSISVTLDPSHLCTTTTVSVSPS  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F QD MWLNGKE+SLSG R+Q CL+EIR+RACDVEDEKKG KI KKDWE LHVHIASYNN
Sbjct  62   FKQDCMWLNGKEISLSGGRFQRCLREIRSRACDVEDEKKGFKIAKKDWEKLHVHIASYNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLVF+L
Sbjct  122  FPTAAGLASSAAGFACLVFSL  142



>ref|XP_007010315.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY19125.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
Length=417

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>ref|XP_007010314.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
 gb|EOY19124.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
Length=418

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  121  TAAGLASSAAGFACLVFAL  139



>gb|AEM42974.1| diphosphomevalonate decarboxylase [Siraitia grosvenorii]
Length=418

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             EKWVLM TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSPAF+Q
Sbjct  3    GEKWVLMATAQTPTNIAVIKYWGKRDEELILPVNDSISVTLDPSHLCTITTVAVSPAFEQ  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  63   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIAKKDWEKLHVYIDSYNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  123  AAGLASSAAGFACLVFAL  140



>ref|XP_006403599.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45052.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=419

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KGI+I KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGIRIEKKDWEKLHLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>gb|KFK36776.1| hypothetical protein AALP_AA4G169000 [Arabis alpina]
Length=414

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = +3

Query  87   MAE--KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            MAE  KWVLMVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+
Sbjct  1    MAEEKKWVLMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPS  60

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            FD+DRMWLNGKE+SLSG RYQNCL+EIR+R  DVEDE KGIKI KKDWE LH+HIASYNN
Sbjct  61   FDRDRMWLNGKEISLSGSRYQNCLREIRSRGDDVEDEVKGIKIEKKDWETLHLHIASYNN  120

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLVF+L
Sbjct  121  FPTAAGLASSAAGFACLVFSL  141



>ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase [Vitis vinifera]
 emb|CBI35263.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KW+LM TAQTPTNIAVIKYWGKRDE LIL +NDSISVTLDP HLCTTTTVAVSP F  
Sbjct  6    SQKWILMTTAQTPTNIAVIKYWGKRDEALILAVNDSISVTLDPQHLCTTTTVAVSPMFQS  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR+RA  +EDEKKGIKITKKDWE LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  126  AAGLASSAAGFACLVFSL  143



>ref|NP_181404.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
 emb|CAA74700.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 emb|CAA76803.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAC67348.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAP68208.1| At2g38700 [Arabidopsis thaliana]
 dbj|BAF00296.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AEC09574.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
Length=412

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVVMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVFAL
Sbjct  124  AGLASSAAGFACLVFAL  140



>emb|CDY65399.1| BnaCnng46900D [Brassica napus]
Length=419

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIEKKDWEKLHLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_011469322.1| PREDICTED: diphosphomevalonate decarboxylase [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            +KWVLMVTAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDP HLCTTTTV+VSP+F  D
Sbjct  7    QKWVLMVTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPDHLCTTTTVSVSPSFSHD  66

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNG E+SLSG R+Q CL+EIR+RACDV DE KGI ITKKDWE LHVHIASYNNFPTA
Sbjct  67   RMWLNGDEISLSGGRFQRCLREIRSRACDVHDESKGIHITKKDWEKLHVHIASYNNFPTA  126

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVFAL
Sbjct  127  AGLASSAAGFACLVFAL  143



>ref|XP_009139253.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brassica rapa]
Length=419

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIDKKDWEKLHLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>emb|CDX76157.1| BnaA04g04210D [Brassica napus]
Length=419

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIDKKDWEKLHLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_010032077.1| PREDICTED: diphosphomevalonate decarboxylase-like [Eucalyptus 
grandis]
 gb|KCW51467.1| hypothetical protein EUGRSUZ_J00991 [Eucalyptus grandis]
Length=418

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MA +W+L +TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDP HLCTTTTVAVSPAF+
Sbjct  1    MAGEWILTLTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPGHLCTTTTVAVSPAFE  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SLSG R+Q+CL+EIRARA DVE+++KGIKI+KKDWE LH+HI+S+NNFP
Sbjct  61   QDRMWLNGKEISLSGDRFQSCLREIRARATDVENKEKGIKISKKDWEKLHLHISSFNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAG ACLVFAL
Sbjct  121  TAAGLASSAAGLACLVFAL  139



>ref|XP_010676219.1| PREDICTED: diphosphomevalonate decarboxylase-like [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            E WV +VTA+TPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTVAVSP F +D
Sbjct  5    EDWVRIVTAKTPTNIAVIKYWGKRDETLILPINDSISVTLDPNHLCTTTTVAVSPTFVED  64

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SL+G RYQNCL+EIR RA DVE+E+KGIKI KKDW+NLHVHIASYNNFPTA
Sbjct  65   RMWLNGKEISLAGERYQNCLREIRKRASDVEEEEKGIKIAKKDWQNLHVHIASYNNFPTA  124

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAG ACLVFAL
Sbjct  125  AGLASSAAGLACLVFAL  141



>ref|XP_006361468.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=421

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KW+LMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP+F Q
Sbjct  5    SKKWILMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPSFQQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLN KE+SL G RYQNCL+EIRARA D EDEKKGIKI+K DW+NLHVHI SYNNFPT
Sbjct  65   DRMWLNKKEISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  125  AAGLASSAAGFACLVFSL  142



>ref|NP_001234815.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
 gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
Length=422

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KW+LMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP+F Q
Sbjct  6    SKKWILMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPSFQQ  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLN KE+SL G RYQNCL+EIRARA D EDEKKGIKI+K DW+NLHVHI SYNNFPT
Sbjct  66   DRMWLNKKEISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  126  AAGLASSAAGFACLVFSL  143



>emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera]
Length=451

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KW+LM TAQTPTNIAVIKYWGKRDE LIL +NDSISVTLDP HLCTTTTVAVSP F  
Sbjct  6    SQKWILMTTAQTPTNIAVIKYWGKRDEGLILAVNDSISVTLDPQHLCTTTTVAVSPMFQS  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR+RA  +EDEKKGIKITKKDWE LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  126  AAGLASSAAGFACLVFSL  143



>ref|XP_011084229.1| PREDICTED: diphosphomevalonate decarboxylase-like [Sesamum indicum]
Length=422

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             + WVL VTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GKSWVLAVTAQTPTNIAVIKYWGKRDEELILPINDSISVTLDPEHLCTTTSVAVSPAFTH  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+E+R+RA DVEDE+KG+KITKKDWE LHVHI SYNNFPT
Sbjct  66   DRMWLNGKEVSLSGGRYQNCLRELRSRASDVEDEQKGVKITKKDWEKLHVHIVSYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVF+L
Sbjct  126  AAGLASSAAGLACLVFSL  143



>ref|XP_010088787.1| Diphosphomevalonate decarboxylase [Morus notabilis]
 gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis]
Length=400

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
             + ++ WVL+VTA+TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HLCTTTTVAVSP+
Sbjct  2    ASESQNWVLVVTARTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPDHLCTTTTVAVSPS  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            FDQDRMWLNGKE+SLSG R+Q+CL+EIR+RA DVED++KGIKI+K+DWE LHVHIASYNN
Sbjct  62   FDQDRMWLNGKEISLSGGRFQSCLREIRSRASDVEDKEKGIKISKEDWEKLHVHIASYNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFAC VF+L
Sbjct  122  FPTAAGLASSAAGFACFVFSL  142



>ref|XP_010515945.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515946.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515947.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   226 bits (576),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KG+KI KKDW+ LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGVKIGKKDWDKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>ref|XP_006391873.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
 gb|ESQ29159.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
Length=419

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AE WV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AENWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGVKIGKKDWEKLHLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_006294305.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
 gb|EOA27203.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
Length=412

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVVMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPEHLCTLTTVAVSPSFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED+ KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDVEDKVKGIKIAKKDWEKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=420

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
             + ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSIS+TLDP+HLCTTTTVAVS A
Sbjct  2    ASESQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISLTLDPSHLCTTTTVAVSSA  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F QDRMWLN KE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LH+HIASYNN
Sbjct  62   FHQDRMWLNAKEISLSGGRFQSCLREIRARACDVEDENKGIKITKEDWAKLHLHIASYNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACL +AL
Sbjct  122  FPTAAGLASSAAGFACLAYAL  142



>ref|XP_010536297.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X3 
[Tarenaya hassleriana]
 ref|XP_010536298.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X4 
[Tarenaya hassleriana]
Length=416

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  90   AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  123  TAAGLASSAAGFACLVFAL  141



>ref|XP_010536296.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Tarenaya hassleriana]
Length=423

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  90   AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  123  TAAGLASSAAGFACLVFAL  141



>gb|ADI80345.1| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=420

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPSFEQD  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SL G R+Q+CL+EIR+RACD+EDEKKGIKI K DWE L +HIASYNNFPTA
Sbjct  66   RMWLNGKEISLLGGRFQSCLREIRSRACDLEDEKKGIKIKKMDWEKLRLHIASYNNFPTA  125

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAG AC VFAL
Sbjct  126  AGLASSAAGLACFVFAL  142



>gb|ACO35355.1| mevalonate pyrophosphate decarboxylase [Elaeis oleifera]
Length=206

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            + WVLM TA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKGI+I K+DWE +H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGIRIKKEDWEKMHLHIASYNNFPTA  125

Query  453  aglassaagfaCLVF  497
            AGLASSAAGFACLVF
Sbjct  126  AGLASSAAGFACLVF  140



>ref|XP_010536295.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Tarenaya hassleriana]
Length=439

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  90   AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLVFAL
Sbjct  123  TAAGLASSAAGFACLVFAL  141



>ref|XP_006445714.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 gb|ESR58954.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=344

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED++KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDKEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>emb|CDX73494.1| BnaC08g25090D [Brassica napus]
Length=419

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KG+KI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRGGDVEDKEKGVKIEKKDWERLNLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|NP_566995.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
 gb|AEE79204.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
Length=419

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>emb|CAB70999.1| DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein [Arabidopsis thaliana]
Length=413

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>ref|XP_009116111.1| PREDICTED: diphosphomevalonate decarboxylase [Brassica rapa]
 emb|CDX78223.1| BnaA09g34180D [Brassica napus]
Length=419

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KG+KI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRGGDVEDKEKGVKIEKKDWERLNLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>gb|AFM77982.1| mevalonate diphosphate decarboxylase [Eleutherococcus senticosus]
Length=420

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTVAVSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVAVSPSFEQD  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNG E+SL G R+Q+CL+EIR+RA D+EDEKKGIKI K DWE LH+HIASYNNFPTA
Sbjct  66   RMWLNGMEISLLGGRFQSCLREIRSRARDLEDEKKGIKIKKMDWEKLHLHIASYNNFPTA  125

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAG AC VFAL
Sbjct  126  AGLASSAAGLACFVFAL  142



>gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus]
Length=417

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            G  +EKW LMVT +TPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+
Sbjct  2    GGESEKWALMVTGRTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPS  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            FDQDRMWLNGKE+SLS   +Q+CL+EIR+RA D ED+KKGIKITK DW+ LH+HIASYNN
Sbjct  62   FDQDRMWLNGKEISLSVGEFQSCLREIRSRATDFEDKKKGIKITKDDWQKLHLHIASYNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAG ACLVF+L
Sbjct  122  FPTAAGLASSAAGLACLVFSL  142



>ref|XP_006445713.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 ref|XP_006485205.1| PREDICTED: diphosphomevalonate decarboxylase-like [Citrus sinensis]
 gb|ESR58953.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=420

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED++KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDKEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>gb|AEZ55675.1| mevalonate diphosphate decarboxylase [Salvia miltiorrhiza]
Length=422

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             EKWVL VTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GEKWVLSVTAQTPTNIAVIKYWGKRDEELILPINDSISVTLDPGHLCTTTSVAVSPAFTH  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNGKE+SLSG R+QNCL+E+R+RA D EDEKKGIKI KKDWE L VHI SYNNFPT
Sbjct  66   DRIWLNGKEVSLSGGRFQNCLRELRSRATDFEDEKKGIKINKKDWEKLRVHIVSYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVF+L
Sbjct  126  AAGLASSAAGLACLVFSL  143



>gb|EYU19776.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=324

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             +KW+L VTAQTPTNIAVIKYWGKR E LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GDKWILTVTAQTPTNIAVIKYWGKRHEELILPINDSISVTLDPDHLCTTTSVAVSPAFTH  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+QNCL+E+R+RA DVEDEKKGIKI+KKDWE L +HI S+NNFPT
Sbjct  66   DRMWLNGKEVSLSGDRFQNCLRELRSRASDVEDEKKGIKISKKDWEKLRLHIVSFNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVF+L
Sbjct  126  AAGLASSAAGLACLVFSL  143



>ref|XP_008446768.1| PREDICTED: diphosphomevalonate decarboxylase [Cucumis melo]
Length=424

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             +KWVL+ TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSP F++
Sbjct  9    GQKWVLLTTAQTPTNIAVIKYWGKRDEDLILPVNDSISVTLDPSHLCTITTVAVSPDFEK  68

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  69   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIAKKDWEKLHVYIDSYNNFPT  128

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVFAL
Sbjct  129  AAGLASSAAGLACLVFAL  146



>gb|AAM65192.1| diphosphomevalonate decarboxylase-like protein [Arabidopsis thaliana]
Length=419

 Score =   221 bits (563),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV MVTAQTPTNIAVIKYWGKR E  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRHEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>ref|XP_010244659.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nelumbo nucifera]
Length=421

 Score =   221 bits (562),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+F+ D
Sbjct  6    QNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVAVSPSFEND  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG R+QNCL+EIR RA  V+DE KGI I K+DW+ LHVHIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRFQNCLREIRCRANSVDDEDKGIHIKKEDWDRLHVHIASYNNFPTA  125

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  126  AGLASSAAGFACLVFSL  142



>gb|AEA72605.1| mevalonate 5-diphosphate decarboxylase [Houttuynia cordata]
Length=421

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++ W+LMVTA++PTNIAVIKYWGKRDE+LILPINDSISVTLDP HLCTTTTVAVSP+F  
Sbjct  6    SKDWILMVTAKSPTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPSFRS  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SL+G RYQNCL+EIR+RA   EDEKKGI I K+DWENLH+HIASYNNFPT
Sbjct  66   DRMWLNGKEISLAGGRYQNCLREIRSRASCFEDEKKGISIRKEDWENLHLHIASYNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  126  AAGLASSAAGFACLVFAL  143



>ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum lycopersicum]
Length=421

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAFDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFDQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVED+KKG+KI KKDWENLHVH+ASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDKKKGVKIAKKDWENLHVHVASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLV++L
Sbjct  125  AAGLASSAAGFACLVYSL  142



>ref|XP_010907122.1| PREDICTED: diphosphomevalonate decarboxylase-like [Elaeis guineensis]
Length=421

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            + WVLM TA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKGI+I K+DWE +H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGIRIKKEDWEKMHLHIASYNNFPTA  125

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF L
Sbjct  126  AGLASSAAGFACLVFTL  142



>gb|EYU19775.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=421

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             +KW+L VTAQTPTNIAVIKYWGKR E LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GDKWILTVTAQTPTNIAVIKYWGKRHEELILPINDSISVTLDPDHLCTTTSVAVSPAFTH  65

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+QNCL+E+R+RA DVEDEKKGIKI+KKDWE L +HI S+NNFPT
Sbjct  66   DRMWLNGKEVSLSGDRFQNCLRELRSRASDVEDEKKGIKISKKDWEKLRLHIVSFNNFPT  125

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVF+L
Sbjct  126  AAGLASSAAGLACLVFSL  143



>gb|AAM64988.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
Length=404

 Score =   218 bits (556),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+DRMWLN
Sbjct  1    MVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLN  60

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTAAGLAS
Sbjct  61   GKEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTAAGLAS  120

Query  468  saagfaCLVFAL  503
            SAAGFACLVFAL
Sbjct  121  SAAGFACLVFAL  132



>gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=406

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  123  TPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMS  302
            TPTNIAVIKYWGKRDE LIL INDSI VTLDPAHLCTTTTVAVSPAF+QDRMWLNGKE+S
Sbjct  1    TPTNIAVIKYWGKRDEDLILAINDSIGVTLDPAHLCTTTTVAVSPAFNQDRMWLNGKEIS  60

Query  303  LSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassaagf  482
            LSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVHIASYNNFPTAAGLASSAAGF
Sbjct  61   LSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIASYNNFPTAAGLASSAAGF  120

Query  483  aCLVFAL  503
            ACLVF+L
Sbjct  121  ACLVFSL  127



>gb|AIK21783.1| mevalonate diphosphate decarboxylase [Panax notoginseng]
Length=420

 Score =   218 bits (556),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPSFEQD  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SL G R+Q+CL+EIR+RA D+ED+KKGI I K DWE LH HIASYNNFPTA
Sbjct  66   RMWLNGKEISLLGGRFQSCLREIRSRARDLEDKKKGIVIKKMDWEKLHFHIASYNNFPTA  125

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAG AC VFAL
Sbjct  126  AGLASSAAGLACFVFAL  142



>gb|EEC72316.1| hypothetical protein OsI_05509 [Oryza sativa Indica Group]
Length=188

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  456  glassaagfaCLVFAL  503
            GLASS AG  C VF L
Sbjct  128  GLASSVAGLVCFVFTL  143



>gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=417

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MAE WV+MVTAQTP NIAVIKYWGKRDETLILPINDSI V+LDP HLCTTTTV+V P+F+
Sbjct  1    MAESWVIMVTAQTPINIAVIKYWGKRDETLILPINDSIRVSLDPDHLCTTTTVSVRPSFE  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            QDRMWLNGKE+SL G R+Q+CL+EIR+RA D+EDEKKGI I K DWE LH HIASYNNFP
Sbjct  61   QDRMWLNGKEISLLGGRFQSCLREIRSRARDLEDEKKGIVIKKMDWEKLHFHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAG AC VFAL
Sbjct  121  TAAGLASSAAGLACFVFAL  139



>gb|KHN37414.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=658

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSIS+TLDP+HLCTTTTVAVS AF Q
Sbjct  5    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISLTLDPSHLCTTTTVAVSSAFHQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLN KE+SLSG R+ +CL+EIRARACDVEDE KGIKITK+DW  LH+HIASYNNFPT
Sbjct  65   DRMWLNAKEISLSGGRFHSCLREIRARACDVEDENKGIKITKEDWAKLHLHIASYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACL +AL
Sbjct  125  AAGLASSAAGFACLAYAL  142



>ref|XP_008788072.1| PREDICTED: diphosphomevalonate decarboxylase-like [Phoenix dactylifera]
Length=421

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            + WVLM TA+ PTNIA+IKYWGKRDE LILP NDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIALIKYWGKRDEALILPTNDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKG++I K+DWE  H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGVRIKKEDWEKFHLHIASYNNFPTA  125

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF L
Sbjct  126  AGLASSAAGFACLVFTL  142



>ref|XP_008345749.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            + KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SRKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++KGIKITKKDWENLHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKEKGIKITKKDWENLHVHISSYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  125  AAGLASSAAGFACLVFAL  142



>ref|NP_001045633.2| Os02g0107200 [Oryza sativa Japonica Group]
 dbj|BAF07547.2| Os02g0107200 [Oryza sativa Japonica Group]
Length=145

 Score =   205 bits (521),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  456  glassaagfaCL  491
            GLASS AG  C 
Sbjct  128  GLASSVAGLVCF  139



>gb|AFW73866.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=173

 Score =   204 bits (518),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  456  glassaagfaCLVFAL  503
            GLASSAAG AC VF L
Sbjct  127  GLASSAAGLACFVFTL  142



>gb|EEC72312.1| hypothetical protein OsI_05503 [Oryza sativa Indica Group]
Length=311

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  456  glassaagfaCLVFAL  503
            GLASS AG  C VF L
Sbjct  128  GLASSVAGLVCFVFTL  143



>ref|XP_008364764.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++ GIKITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKENGIKITKKDWEKLHVHISSYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  125  AAGLASSAAGFACLVFAL  142



>ref|XP_008356850.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++ GIKITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKEXGIKITKKDWEKLHVHISSYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  125  AAGLASSAAGFACLVFAL  142



>ref|XP_010427097.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010427098.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>ref|XP_009356125.1| PREDICTED: diphosphomevalonate decarboxylase [Pyrus x bretschneideri]
Length=418

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA D++D++KGI ITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDIDDKEKGINITKKDWEKLHVHISSYNNFPT  124

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVFAL
Sbjct  125  AAGLASSAAGFACLVFAL  142



>ref|XP_010554524.1| PREDICTED: diphosphomevalonate decarboxylase-like [Tarenaya hassleriana]
Length=412

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = +3

Query  87   MAEK--WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            MAEK  WV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSPA
Sbjct  1    MAEKKQWVVMVTAQTPTNIAVIKYWGKRDEARILPINDSISVTLDPDHLCTVTTVAVSPA  60

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            FD D+MWLNGKE+SLSG RYQNCL+EIR RA DVED++KGIKI KKDWE LH+HIASYNN
Sbjct  61   FDHDQMWLNGKEISLSGSRYQNCLREIRNRAGDVEDKEKGIKIEKKDWEKLHLHIASYNN  120

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLVFAL
Sbjct  121  FPTAAGLASSAAGFACLVFAL  141



>ref|XP_006291202.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
 gb|EOA24100.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
Length=419

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    SEKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR+RA DV+D++KGIKI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRAGDVDDKEKGIKIGKKDWEKLHLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|XP_010505522.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRGDDVEDKEKGIKIEKKDWEKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVFAL
Sbjct  124  AGLASSAAGFACLVFAL  140



>ref|XP_010509167.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRGDDVEDKEKGIKIEKKDWEKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVFAL
Sbjct  124  AGLASSAAGFACLVFAL  140



>ref|XP_002877963.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54222.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV MVTA+TPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAKTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>ref|XP_010504223.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504224.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504225.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SL+G RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLTGSRYQNCLREIRSRADDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVF+L
Sbjct  124  AGLASSAAGFACLVFSL  140



>ref|XP_009404708.1| PREDICTED: diphosphomevalonate decarboxylase-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            E W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP FD+D
Sbjct  6    ESWILMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPTFDRD  65

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+ LSG R+Q+CL+EIR  A DVEDEKKGI+I K DW+ LHVHIASYNNFPTA
Sbjct  66   RMWLNGKEIPLSGDRFQSCLREIRKLADDVEDEKKGIRIRKDDWQKLHVHIASYNNFPTA  125

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAG AC VF L
Sbjct  126  AGLASSAAGLACFVFTL  142



>gb|EMT01953.1| Diphosphomevalonate decarboxylase [Aegilops tauschii]
Length=456

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVL  T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVA SPAF  DR
Sbjct  8    QWVLTATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAASPAFPSDR  67

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE++LSG R+Q+CL+EIR RA DVEDEK+GIKI K+DWE LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEIALSGGRFQSCLREIRKRARDVEDEKRGIKIKKEDWEKLHVHIASYNNFPTAA  127

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFACLVF L
Sbjct  128  GLASSAAGFACLVFTL  143



>dbj|BAD27942.1| putative mevalonate disphosphate decarboxylase [Oryza sativa 
Japonica Group]
 dbj|BAH01424.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56155.1| hypothetical protein OsJ_05052 [Oryza sativa Japonica Group]
Length=421

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIAS+NNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPTAA  127

Query  456  glassaagfaCLVFAL  503
            GLASSAAG AC VF L
Sbjct  128  GLASSAAGLACFVFTL  143



>ref|XP_006836043.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
 gb|ERM98896.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
Length=419

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            ++ + +LMVTA+ PTNIAVIKYWGKRDE+LILPINDSISVTLDP HLCTTTTVAVSP F+
Sbjct  4    VSGEGMLMVTARAPTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPNFE  63

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
             DRMWLNGKE+SLSG RYQ+CLKEIR +A DV DE KGI I  +DW+ LHVHIASYNNFP
Sbjct  64   SDRMWLNGKEISLSGGRYQSCLKEIRQQAGDVIDENKGICIKGEDWQKLHVHIASYNNFP  123

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAGFACLV+AL
Sbjct  124  TAAGLASSAAGFACLVYAL  142



>emb|CDM86983.1| unnamed protein product [Triticum aestivum]
Length=419

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
              +WVL  T ++PTNIAVIKYWGKRD+ LILP+NDSISVTLDP HL  TTTVA SPAF  
Sbjct  4    GAQWVLTATGRSPTNIAVIKYWGKRDDALILPVNDSISVTLDPDHLSATTTVAASPAFPS  63

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE++LSG R+Q+CL+EIR RA DVEDEK+GIKI K+DWE LHVHIASYNNFPT
Sbjct  64   DRMWLNGKEIALSGGRFQSCLREIRKRARDVEDEKRGIKIKKEDWEKLHVHIASYNNFPT  123

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF L
Sbjct  124  AAGLASSAAGFACLVFTL  141



>gb|EAZ21434.1| hypothetical protein OsJ_05037 [Oryza sativa Japonica Group]
Length=493

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = +3

Query  75   FPGTMAE---KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTV  245
            FP   A    +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTV
Sbjct  251  FPSMAAAEEGQWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTV  310

Query  246  AVSPAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHI  425
            AVSP+F  DRMWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHI
Sbjct  311  AVSPSFPSDRMWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHI  370

Query  426  ASYNNFPTaaglassaagfaCLVFAL  503
            ASYNNFPTAAGLASS AG  C VF L
Sbjct  371  ASYNNFPTAAGLASSVAGLVCFVFTL  396



>gb|ACN41090.1| unknown [Picea sitchensis]
Length=422

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            G   ++W+LMVTA+ PTNIAVIKYWGKRDE LILPINDSIS TLDP HL  TTTVAVSP+
Sbjct  2    GEELQRWILMVTARAPTNIAVIKYWGKRDEKLILPINDSISFTLDPDHLSATTTVAVSPS  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F  DRMWLNGKE+SL G RYQNCL+EIR+R  DV DEK GI I K+DW+ LH+HIASYNN
Sbjct  62   FTSDRMWLNGKEVSLGGERYQNCLREIRSRGNDVVDEKNGIVIRKEDWQRLHLHIASYNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLV++L
Sbjct  122  FPTAAGLASSAAGFACLVYSL  142



>ref|XP_002881611.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57870.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTV+VSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVSVSPSFDRD  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            RMWLNGKE+SLSG RYQNCL+EIR+RA D+ED++KGIKI KKDW+ LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDLEDKEKGIKIEKKDWQKLHLHIASHNNFPTA  123

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLVFAL
Sbjct  124  AGLASSAAGFACLVFAL  140



>gb|AFJ93089.1| mevalonate diphosphate decarboxylase, partial [Bacopa monnieri]
Length=254

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +3

Query  132  NIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMSLSG  311
            NIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  DRMWLNGKE+ LSG
Sbjct  1    NIAVIKYWGKRDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFTHDRMWLNGKEVPLSG  60

Query  312  VRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassaagfaCL  491
            VRYQNCLKE+R+ A DVE+E+KGIKI+KKDWE LHVHI SYNNFPTAAGLASSAAG ACL
Sbjct  61   VRYQNCLKELRSLANDVEEEEKGIKISKKDWEKLHVHIVSYNNFPTAAGLASSAAGLACL  120

Query  492  VFAL  503
            VF+L
Sbjct  121  VFSL  124



>ref|XP_006646770.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oryza brachyantha]
Length=419

 Score =   205 bits (521),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNG+E+SLSG R+Q+CL+EIR RA DVEDE KGI+I K+DWE LHVHIASYNNFPTAA
Sbjct  67   MWLNGQEISLSGGRFQSCLREIRKRAQDVEDE-KGIRIKKEDWEKLHVHIASYNNFPTAA  125

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFACLVF L
Sbjct  126  GLASSAAGFACLVFTL  141



>gb|KFK34679.1| hypothetical protein AALP_AA5G177200 [Arabis alpina]
Length=419

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKW+ MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWIFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG RYQNCL+EIR+ A DVED++K IKI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSCAGDVEDKEKNIKIEKKDWEKLNLHIASHNNFPT  122

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAGFACLVF+L
Sbjct  123  AAGLASSAAGFACLVFSL  140



>ref|NP_001149256.1| LOC100282878 [Zea mays]
 ref|XP_008643692.1| PREDICTED: LOC100282878 isoform X1 [Zea mays]
 gb|ACG34742.1| diphosphomevalonate decarboxylase [Zea mays]
 gb|ACR36666.1| unknown [Zea mays]
 gb|AFW73865.1| diphosphomevalonate decarboxylase [Zea mays]
Length=420

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  456  glassaagfaCLVFAL  503
            GLASSAAG AC VF L
Sbjct  127  GLASSAAGLACFVFTL  142



>ref|XP_008665378.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
 gb|ACF86239.1| unknown [Zea mays]
 gb|ACN26377.1| unknown [Zea mays]
 tpg|DAA51251.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=420

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  456  glassaagfaCLVFAL  503
            GLASSAAG AC VF L
Sbjct  127  GLASSAAGLACFVFTL  142



>ref|XP_008668934.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
Length=159

 Score =   196 bits (498),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTT+AVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTIAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SL G R+Q+CLKEIR RA D+ED++K +KI K+DW  LHVHIASYNNFPT+A
Sbjct  67   MWLNGKEISLLGGRFQSCLKEIRKRARDIEDKEKDVKIKKEDWGKLHVHIASYNNFPTSA  126

Query  456  glassaagfaCL  491
            GLASSAA  AC 
Sbjct  127  GLASSAADLACF  138



>ref|XP_008668933.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=161

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTT+AVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTIAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SL G R+Q+CLKEIR RA D+ED++K +KI K+DW  LHVHIASYNNFPT+A
Sbjct  67   MWLNGKEISLLGGRFQSCLKEIRKRARDIEDKEKDVKIKKEDWGKLHVHIASYNNFPTSA  126

Query  456  glassaagfaCL  491
            GLASSAA  AC 
Sbjct  127  GLASSAADLACF  138



>ref|XP_004150845.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 ref|XP_004165172.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 gb|KGN52198.1| hypothetical protein Csa_5G615210 [Cucumis sativus]
Length=424

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             +KWVL+ TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSP F++
Sbjct  9    GQKWVLLTTAQTPTNIAVIKYWGKRDEDLILPVNDSISVTLDPSHLCTITTVAVSPNFEK  68

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  69   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIEKKDWEKLHVYIDSYNNFPT  128

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVFAL
Sbjct  129  AAGLASSAAGLACLVFAL  146



>ref|XP_002452980.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
 gb|EES05956.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
Length=420

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWLLMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SL G R+Q+CL+EIR RA D EDE+KG+KI K+DW  LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDEEKGVKIKKEDWGKLHVHIASYNNFPTAA  126

Query  456  glassaagfaCLVFAL  503
            GLASSAAG AC VF L
Sbjct  127  GLASSAAGLACFVFTL  142



>ref|XP_008665377.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=497

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  78   PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  254
            P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  77   PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  136

Query  255  PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  434
            P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  137  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  196

Query  435  NNFPTaaglassaagfaCLVFAL  503
            NNFPTAAGLASSAAG AC VF L
Sbjct  197  NNFPTAAGLASSAAGLACFVFTL  219



>gb|AAV32433.1| mevalonate disphosphate decarboxylase [Ginkgo biloba]
Length=430

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  99   WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRM  278
            WV MVTA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DRM
Sbjct  11   WVFMVTARAPTNIAVIKYWGKRDEKLILPINDSISVTLDPDHLSATTTVAVSPSFSSDRM  70

Query  279  WLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaag  458
            WLNGKE+SL G RYQNCL+EIR+R  DV DEK G  I K+DW+ LH+HIAS+NNFPTAAG
Sbjct  71   WLNGKEVSLGGERYQNCLREIRSRGRDVVDEKSGTLIKKEDWQTLHLHIASHNNFPTAAG  130

Query  459  lassaagfaCLVFAL  503
            LASSAAGFACLV+AL
Sbjct  131  LASSAAGFACLVYAL  145



>ref|NP_001045642.2| Os02g0109100 [Oryza sativa Japonica Group]
 dbj|BAF07556.2| Os02g0109100, partial [Oryza sativa Japonica Group]
Length=147

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  120  QTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEM  299
            ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DRMWLNGKE+
Sbjct  18   RSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEI  77

Query  300  SLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIAS+NNFPT
Sbjct  78   SLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPT  127



>tpg|DAA51252.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1213

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  78    PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  254
             P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  1040  PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  1099

Query  255   PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  434
             P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  1100  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  1159

Query  435   NNFPTaaglassaagfaCLVFAL  503
             NNFPTAAGLASSAAG AC VF L
Sbjct  1160  NNFPTAAGLASSAAGLACFVFTL  1182



>ref|XP_010067138.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Eucalyptus grandis]
Length=354

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M  +WVLMVTA+ P+NI+VIKYWGKR+E LIL +N+SIS+TLD  HLC TTTVAVSP F+
Sbjct  1    MEGEWVLMVTAKAPSNISVIKYWGKRNEALILAVNESISITLDLDHLCATTTVAVSPKFE  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            +DR+WLNGKEMSLS  RYQN L+EIR+R  + ED++KGIKI K+DW  LH HIAS+NNFP
Sbjct  61   KDRLWLNGKEMSLSSDRYQNTLREIRSRGDNFEDDEKGIKIMKEDWMRLHFHIASHNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            T  GLASSAAGFACLVFAL
Sbjct  121  TGTGLASSAAGFACLVFAL  139



>tpg|DAA51253.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1460

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  78    PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  254
             P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  1040  PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  1099

Query  255   PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  434
             P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  1100  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  1159

Query  435   NNFPTaaglassaagfaCLVFAL  503
             NNFPTAAGLASSAAG AC VF L
Sbjct  1160  NNFPTAAGLASSAAGLACFVFTL  1182



>ref|XP_001773902.1| predicted protein [Physcomitrella patens]
 gb|EDQ61250.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            G   E WV+M TA+ P+NIAVIKYWGKRDE LILPIN SISVTLDP HL  TTTVA SPA
Sbjct  2    GNEEETWVVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPA  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F++DR+WLNGKE+S+ GVRY+NCL+E+RARA DV  E  G  I K+DW +LH+HIAS NN
Sbjct  62   FEKDRLWLNGKEVSVEGVRYKNCLREMRARATDVVIESSGKVIRKEDWNSLHIHIASENN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLV+AL
Sbjct  122  FPTAAGLASSAAGFACLVYAL  142



>ref|XP_010067136.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010067137.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW65201.1| hypothetical protein EUGRSUZ_G02693 [Eucalyptus grandis]
Length=419

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M  +WVLMVTA+ P+NI+VIKYWGKR+E LIL +N+SIS+TLD  HLC TTTVAVSP F+
Sbjct  1    MEGEWVLMVTAKAPSNISVIKYWGKRNEALILAVNESISITLDLDHLCATTTVAVSPKFE  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            +DR+WLNGKEMSLS  RYQN L+EIR+R  + ED++KGIKI K+DW  LH HIAS+NNFP
Sbjct  61   KDRLWLNGKEMSLSSDRYQNTLREIRSRGDNFEDDEKGIKIMKEDWMRLHFHIASHNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            T  GLASSAAGFACLVFAL
Sbjct  121  TGTGLASSAAGFACLVFAL  139



>gb|AGT17596.1| mevalonate diphosphate decarboxylase [Picrorhiza kurrooa]
Length=421

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEKWVL VTAQTPTNIAVIKYWGK DE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  4    AEKWVLTVTAQTPTNIAVIKYWGKGDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFTH  63

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DRMWLNGKE+SLSG R+QNCL+E+R+ A DVEDEK+G+  + K   +LHVH+    +FPT
Sbjct  64   DRMWLNGKEVSLSGGRFQNCLREVRSCANDVEDEKEGVLKSLKGLGDLHVHMCPTIDFPT  123

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG ACLVF+L
Sbjct  124  AAGLASSAAGLACLVFSL  141



>ref|XP_003565147.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brachypodium 
distachyon]
Length=417

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MA +W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F 
Sbjct  1    MAAEWLLMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFP  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
             DRMWLNGKE++LSG R+Q+CL+EIR RA DVEDEKKGIKI K+DWE LHVHIASYNNFP
Sbjct  61   SDRMWLNGKEIALSGGRFQSCLREIRKRARDVEDEKKGIKIKKEDWEKLHVHIASYNNFP  120

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAG ACLVF L
Sbjct  121  TAAGLASSAAGLACLVFTL  139



>ref|XP_004954217.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=420

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SLSG R+Q+CL+EIR RAC+ EDEKKGIKI K+DWE LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLSGGRFQSCLREIRKRACEFEDEKKGIKIKKEDWEKLHVHIASYNNFPTAA  126

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFACLVF L
Sbjct  127  GLASSAAGFACLVFTL  142



>ref|XP_004963234.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=425

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDS+SVTLDP HL  TTTVAVSP+F  DR
Sbjct  10   QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSVSVTLDPDHLSATTTVAVSPSFSSDR  69

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            MWLNGKE+SLSG R+Q+CL+EIR RACD EDEKKGIKI K+DWE LHVHIASY NFPTAA
Sbjct  70   MWLNGKEISLSGGRFQSCLREIRKRACDFEDEKKGIKIKKEDWEKLHVHIASYKNFPTAA  129

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFACLVF L
Sbjct  130  GLASSAAGFACLVFTL  145



>ref|XP_001774493.1| predicted protein [Physcomitrella patens]
 gb|EDQ60717.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            + WV+M TA+ P+NIAVIKYWGKRDE LILPIN SISVTLDP HL  TTTVA SPAF++D
Sbjct  7    DAWVVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFERD  66

Query  273  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  452
            R+WLNGKE+S+ G RY+NCL+E+RARA DV  E  G  ITK+ W  LH+HIAS NNFPTA
Sbjct  67   RLWLNGKEVSVEGERYRNCLREMRARATDVVIESSGKVITKEVWSTLHIHIASENNFPTA  126

Query  453  aglassaagfaCLVFAL  503
            AGLASSAAGFACLV++L
Sbjct  127  AGLASSAAGFACLVYSL  143



>ref|XP_002979347.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
 gb|EFJ19755.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
Length=403

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            GT    W++  TA+ P+NIAVIKYWGKRDE LILP+N SISVTLDP  L  TTTV+ SP 
Sbjct  2    GTDGSAWIVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPD  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            FD DR+WLN KE+SLS  RY +CLKE+R RA DV+DEK GI ITK+DW++L +HI S NN
Sbjct  62   FDADRLWLNDKEVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLVF +
Sbjct  122  FPTAAGLASSAAGFACLVFTV  142



>ref|XP_002992344.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
 gb|EFJ06620.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
Length=403

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            GT    W++  TA+ P+NIAVIKYWGKRDE LILP+N SISVTLDP  L  TTTV+ SP 
Sbjct  2    GTDGSAWIVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPD  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            FD DR+WLN KE+SLS  RY +CLKE+R RA DV+DEK GI ITK+DW++L +HI S NN
Sbjct  62   FDADRLWLNDKEVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNN  121

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAGFACLVF +
Sbjct  122  FPTAAGLASSAAGFACLVFTV  142



>gb|AFW73864.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=390

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 93/136 (68%), Gaps = 30/136 (22%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSIS                        
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSIS------------------------  42

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
                  E+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  43   ------EISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  96

Query  456  glassaagfaCLVFAL  503
            GLASSAAG AC VF L
Sbjct  97   GLASSAAGLACFVFTL  112



>ref|XP_001121619.2| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Apis mellifera]
Length=386

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 91/132 (69%), Gaps = 11/132 (8%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G+E  +  +R QNCL EI+ RA D     +        W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIMNIRLQNCLTEIKKRAGDSNHMDQ--------WK---IHICSENNFPTSAGLAS  111

Query  468  saagfaCLVFAL  503
            SAAG+ACLV AL
Sbjct  112  SAAGYACLVIAL  123



>ref|XP_006623086.1| PREDICTED: diphosphomevalonate decarboxylase-like [Apis dorsata]
Length=386

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 90/132 (68%), Gaps = 11/132 (8%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G+E  +  +R QNCL EI+ RA        G       W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIKNIRLQNCLTEIKKRA--------GNSNHMNQWK---IHICSENNFPTSAGLAS  111

Query  468  saagfaCLVFAL  503
            SAAG+ACLV AL
Sbjct  112  SAAGYACLVIAL  123



>ref|XP_003693647.1| PREDICTED: diphosphomevalonate decarboxylase-like [Apis florea]
Length=386

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 89/132 (67%), Gaps = 11/132 (8%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G+E  +  +R QNCL EIR R         G       W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIKNIRLQNCLTEIRKRT--------GNSNHMDQWK---IHICSENNFPTSAGLAS  111

Query  468  saagfaCLVFAL  503
            SAAG+ACLV AL
Sbjct  112  SAAGYACLVIAL  123



>ref|XP_004356734.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR24834.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
Length=412

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MA    L VTAQ P NIAVIKYWGK DE LILP+N S+S TL    LCTTTTV  S  F 
Sbjct  1    MATTKALCVTAQAPVNIAVIKYWGKTDEKLILPLNSSLSTTLSMTDLCTTTTVMASKEFK  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            +DR+WLNGKE S+S  R QNC+ ++ AR+  +  ++ G  + +      H HI S NNFP
Sbjct  61   EDRLWLNGKEESVSSGRMQNCIGQLVARSGLL--KRLGENVEEGKAREYHFHIVSVNNFP  118

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSA+GFACL + L
Sbjct  119  TAAGLASSASGFACLTYTL  137



>ref|XP_005708031.1| diphosphomevalonate decarboxylase isoform 1 [Galdieria sulphuraria]
 gb|EME31511.1| diphosphomevalonate decarboxylase isoform 1 [Galdieria sulphuraria]
Length=394

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            L VT   P NIA+IKYWGKR+E  ILP+N S+S+TLD A L T TTV  S  FD+DR+WL
Sbjct  8    LTVTCTAPVNIALIKYWGKREEDKILPLNPSLSITLDVADLRTKTTVVASKQFDRDRLWL  67

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NGKE  ++  R Q C++++R  A D+  + K + I K++W+N  +HI S NNFPTAAGLA
Sbjct  68   NGKEHDINNKRMQTCIRKLRQGADDLWRDGK-LMIAKEEWKNYRLHIISENNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSA+G AC V+++
Sbjct  127  SSASGLACFVYSI  139



>ref|XP_004600545.1| PREDICTED: diphosphomevalonate decarboxylase [Sorex araneus]
Length=395

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 94/139 (68%), Gaps = 3/139 (2%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            MA   +L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S AF 
Sbjct  1    MASGQLLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKAFT  60

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            +DR+WLNG+E  ++  R Q CL+EIR  A        G      D++   VH+AS NNFP
Sbjct  61   KDRIWLNGREEDVTQPRLQACLREIRRLAEKRRRSSGGEDPLTHDYK---VHVASVNNFP  117

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAG+ACL +AL
Sbjct  118  TAAGLASSAAGYACLAYAL  136



>gb|ABO27200.1| cytosolic mevalonate-5-diphosphate decarboxylase [Mesostigma 
viride]
Length=93

 Score =   120 bits (302),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMSLSGVRYQNCLKE  338
            KRDE LILPIN SISVT+DP  LC TTTVAVSP+F++DR+WLNGKE+ +  VRYQNCL+ 
Sbjct  1    KRDEELILPINSSISVTIDPTALCATTTVAVSPSFERDRLWLNGKEVPMDNVRYQNCLRI  60

Query  339  IRARACDVEDEKKGI-KITKKDWENLHVHIAS  431
            +R RA DV  + +G   +++ DW+ L VHIAS
Sbjct  61   MRERARDVAADGQGSPAVSRSDWQALKVHIAS  92



>ref|XP_005708030.1| diphosphomevalonate decarboxylase isoform 2 [Galdieria sulphuraria]
 gb|EME31510.1| diphosphomevalonate decarboxylase isoform 2 [Galdieria sulphuraria]
Length=411

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            L VT   P NIA+IKYWGKR+E  ILP+N S+S+TLD A L T TTV  S  FD+DR+WL
Sbjct  8    LTVTCTAPVNIALIKYWGKREEDKILPLNPSLSITLDVADLRTKTTVVASKQFDRDRLWL  67

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NGKE  ++  R Q C++++R  A D+  + K + I K++W+N  +HI S NNFPTAAGLA
Sbjct  68   NGKEHDINNKRMQTCIRKLRQGADDLWRDGK-LMIAKEEWKNYRLHIISENNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSA+G AC V+++
Sbjct  127  SSASGLACFVYSI  139



>ref|XP_003424007.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Nasonia 
vitripennis]
Length=379

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 75/115 (65%), Gaps = 11/115 (10%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            + VT   P NIAVIKYWGKRDE LILPINDS+S TLD  HLC  TTV  SP F ++++WL
Sbjct  3    ITVTCVAPVNIAVIKYWGKRDEDLILPINDSLSATLDTEHLCAKTTVRASPEFKENKIWL  62

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            NG+E S+   R QNCLKEI+ R+              KD E+  +HI S NNFPT
Sbjct  63   NGREESMDNPRLQNCLKEIKKRSQ-----------LSKDMESWKIHICSENNFPT  106



>ref|XP_006097406.1| PREDICTED: diphosphomevalonate decarboxylase [Myotis lucifugus]
Length=400

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR    +DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSDDEEDPLPLSL----NYKVHVASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSA+G+ACL +AL
Sbjct  119  PTAAGLASSASGYACLAYAL  138



>ref|XP_003758532.1| PREDICTED: diphosphomevalonate decarboxylase [Sarcophilus harrisii]
Length=398

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 97/140 (69%), Gaps = 8/140 (6%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEK ++ VT   PTNIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKALVAVTCTAPTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFKE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNGKE  +   R Q+CL+EIR  AR      E   + ++ K      VHIAS N+F
Sbjct  63   DRIWLNGKEEDVGHPRLQSCLREIRRLARKRRSGSEGDSVPLSYK------VHIASVNDF  116

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACLV+ L
Sbjct  117  PTAAGLASSAAGYACLVYTL  136



>gb|ELK31386.1| Diphosphomevalonate decarboxylase [Myotis davidii]
Length=363

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDPLPLSL----NYKVHVASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSA+G+ACL +AL
Sbjct  119  PTAAGLASSASGYACLAYAL  138



>ref|XP_010996754.1| PREDICTED: diphosphomevalonate decarboxylase-like, partial [Camelus 
dromedarius]
Length=239

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPVVAVTCTAPVNIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNG+E  +   R Q CLKEIR  AC          +      +  VHIAS NNFPT
Sbjct  63   DRIWLNGREEDIGQPRLQACLKEIRRLACKRRSGSPEDPLPLS--HSCKVHIASENNFPT  120

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACL + L
Sbjct  121  AAGLASSAAGYACLAYTL  138



>ref|XP_006762259.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Myotis 
davidii]
Length=400

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDPLPLSL----NYKVHVASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSA+G+ACL +AL
Sbjct  119  PTAAGLASSASGYACLAYAL  138



>ref|XP_011497479.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratosolen solmsi 
marchali]
Length=391

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 88/129 (68%), Gaps = 11/129 (9%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRD+ LILP+NDSIS TLD  HLCT TT   S  F +DRMWLN
Sbjct  3    VVTCIAPINIAVIKYWGKRDDDLILPVNDSISTTLDKDHLCTKTTAMASSDFKEDRMWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G E S+   R QNCL+E++ RA   E           + +N  +HI S NNFPTAAGLAS
Sbjct  63   GSEQSMDNPRLQNCLRELKKRAQISE-----------EMQNWKLHICSENNFPTAAGLAS  111

Query  468  saagfaCLV  494
            SAAG+ACLV
Sbjct  112  SAAGYACLV  120



>ref|XP_002735076.1| PREDICTED: diphosphomevalonate decarboxylase-like [Saccoglossus 
kowalevskii]
Length=405

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIAVIKYWGKRDE LILP N S+S +LD  HL +TTT ++S  F +DR+WLNG
Sbjct  15   VTCTAPINIAVIKYWGKRDEQLILPTNSSLSASLDQDHLKSTTTASISKEFKRDRLWLNG  74

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            KE S+   R QNCL EIR RA     ++K    +K +  N  VHI S NNFPTAAGLASS
Sbjct  75   KEESIENPRIQNCLIEIRRRA----RKRKHNDDSKSEMLNWSVHICSENNFPTAAGLASS  130

Query  471  aagfaCLVFAL  503
            AAG+ACLV+ L
Sbjct  131  AAGYACLVYTL  141



>ref|XP_008137975.1| PREDICTED: diphosphomevalonate decarboxylase [Eptesicus fuscus]
Length=400

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 95/140 (68%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPHLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VHIAS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDLLPLSL----NYKVHIASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSA+G+ACL +AL
Sbjct  119  PTAAGLASSASGYACLAYAL  138



>ref|NP_001133968.1| Diphosphomevalonate decarboxylase [Salmo salar]
 gb|ACI34234.1| Diphosphomevalonate decarboxylase [Salmo salar]
Length=402

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 97/143 (68%), Gaps = 10/143 (7%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            ++ K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F 
Sbjct  4    VSGKKLTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRSFQ  63

Query  267  QDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASY  434
            +DR+WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S 
Sbjct  64   EDRIWLNGKEEDITQPRLQSCLREIRCLSRKRRSDGEADVDAAGLSHK------VHICSV  117

Query  435  NNFPTaaglassaagfaCLVFAL  503
            NNFPTAAGLASSAAG+ACLV+ L
Sbjct  118  NNFPTAAGLASSAAGYACLVYTL  140



>ref|NP_001093300.1| diphosphomevalonate decarboxylase [Bombyx mori]
 dbj|BAF62111.1| diphosphomevalonate decarboxylase [Bombyx mori]
Length=390

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 93/132 (70%), Gaps = 7/132 (5%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILP+NDS+S T D + +C  T+V+  P F +D++WLN
Sbjct  4    IVTVIAPVNIAVIKYWGKRDEKLILPLNDSVSATFDTSVMCAKTSVSTHPDFVEDQIWLN  63

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GKE S S  R QNCL+EI++RA          K   +D  +  VH++S NNFPTAAGLAS
Sbjct  64   GKEESFSNPRLQNCLREIKSRAV-------AEKTIAEDVLSWKVHVSSENNFPTAAGLAS  116

Query  468  saagfaCLVFAL  503
            SAAG+ACLV AL
Sbjct  117  SAAGYACLVSAL  128



>emb|CDQ87522.1| unnamed protein product [Oncorhynchus mykiss]
Length=402

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 95/140 (68%), Gaps = 10/140 (7%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR
Sbjct  7    KKLTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRSFQEDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            +WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S NNF
Sbjct  67   IWLNGKEEDITQPRLQSCLREIRRLARKRRSDGEADVDTAGLSHK------VHICSVNNF  120

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACLV+ L
Sbjct  121  PTAAGLASSAAGYACLVYTL  140



>ref|XP_005862569.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Myotis 
brandtii]
Length=400

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK  L +T   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAMTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR    ++E+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSDEEEDPLPLSL----NYKVHVASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSA+G+ACL +AL
Sbjct  119  PTAAGLASSASGYACLAYAL  138



>ref|XP_011315112.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Fopius 
arisanus]
Length=386

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 89/132 (67%), Gaps = 11/132 (8%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILP+NDSIS +LD   LC  TT+  S  FD DR+WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDEQLILPVNDSISASLDTDQLCAKTTIMASADFDADRIWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G+E S++  R QNCL+EI+ RA               + EN  +HI S NNFPTAAGLAS
Sbjct  63   GREESINNPRLQNCLREIKKRA-----------QLSPEMENWKLHICSKNNFPTAAGLAS  111

Query  468  saagfaCLVFAL  503
            SAAG+ACL  AL
Sbjct  112  SAAGYACLSAAL  123



>ref|XP_001200662.2| PREDICTED: diphosphomevalonate decarboxylase-like [Strongylocentrotus 
purpuratus]
Length=410

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT + P NIAVIKYWGKRDE LILP+N S+S TL    LCTTT++A S  F +DR+WLNG
Sbjct  7    VTCKAPINIAVIKYWGKRDEKLILPVNSSLSATLHIDQLCTTTSIAGSKHFPEDRLWLNG  66

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            KE SL   R + CL+EIR RA      K+ I   + + E+  +HI S NNFPTAAGLASS
Sbjct  67   KEESLENPRVKTCLQEIRKRA-----RKRKISDDESNPEDWKLHICSENNFPTAAGLASS  121

Query  471  aagfaCLVFAL  503
            AAG+ACLV  L
Sbjct  122  AAGYACLVATL  132



>ref|XP_010966484.1| PREDICTED: diphosphomevalonate decarboxylase [Camelus bactrianus]
Length=400

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPVVAVTCTAPVNIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNG+E  +   R Q CLKEIR  AC          +      +  VHIAS NNFPT
Sbjct  63   DRIWLNGREEDIGQPRLQACLKEIRRLACKRRSGSPEDPLPLS--HSCKVHIASENNFPT  120

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACL + L
Sbjct  121  AAGLASSAAGYACLAYTL  138



>ref|XP_003228605.1| PREDICTED: diphosphomevalonate decarboxylase [Anolis carolinensis]
Length=406

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 99/149 (66%), Gaps = 16/149 (11%)
 Frame = +3

Query  87   MAEKWVL-MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  263
            MAE   L MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F
Sbjct  1    MAEDHPLSMVTCTAPINIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDF  60

Query  264  DQDRMWLNGKEMSLSGVRYQNCLKEIR-----ARACDVEDEKKG----IKITKKDWENLH  416
             +DR+WLNGKE  +   R Q+CL+EIR      R+ D +  + G    + +T K      
Sbjct  61   TEDRLWLNGKESDIGHPRLQSCLREIRRLARKRRSGDTKGPEGGEPSPLSLTYK------  114

Query  417  VHIASYNNFPTaaglassaagfaCLVFAL  503
            VHIAS NNFPTAAGLASSAAG+ACLV+ L
Sbjct  115  VHIASENNFPTAAGLASSAAGYACLVYTL  143



>ref|XP_006008326.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Latimeria 
chalumnae]
Length=366

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 98/144 (68%), Gaps = 11/144 (8%)
 Frame = +3

Query  87   MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  263
            MAEK  V  VT   P NIAVIKYWGKRD+ LILPIN S+SVTL    L TTTTV  S  F
Sbjct  1    MAEKKTVTRVTCTAPVNIAVIKYWGKRDDDLILPINSSLSVTLHQNQLKTTTTVVASREF  60

Query  264  DQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIAS  431
             +DR+WLNGKE +++  R Q+CL+EI    R R  D E +   + ++ K      +HI S
Sbjct  61   KEDRIWLNGKEDNINQPRLQSCLREIQRLARKRRSDGEGDSSPLNLSYK------IHICS  114

Query  432  YNNFPTaaglassaagfaCLVFAL  503
             NNFPTAAGLASSAAG+ACLV+AL
Sbjct  115  INNFPTAAGLASSAAGYACLVYAL  138



>ref|XP_001376834.1| PREDICTED: diphosphomevalonate decarboxylase [Monodelphis domestica]
Length=398

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 96/140 (69%), Gaps = 8/140 (6%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AEK ++ VT   PTNIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPLVSVTCTAPTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFKE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKG--IKITKKDWENLHVHIASYNNF  443
            DR+WLNGKE  +   R Q+CL+EIR  A        G  + ++ K      VHIAS N+F
Sbjct  63   DRIWLNGKEEDVGHHRLQSCLREIRRLARKRRSGSDGDLVPLSYK------VHIASVNDF  116

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACLV+ L
Sbjct  117  PTAAGLASSAAGYACLVYTL  136



>emb|CDQ81132.1| unnamed protein product [Oncorhynchus mykiss]
Length=402

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 94/140 (67%), Gaps = 10/140 (7%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S  F +DR
Sbjct  7    KELTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRLFQEDR  66

Query  276  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            +WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S NNF
Sbjct  67   IWLNGKEEDITQPRLQSCLREIRRLARKRRSDGEADVDTAGLSHK------VHICSVNNF  120

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACLV+ L
Sbjct  121  PTAAGLASSAAGYACLVYTL  140



>ref|XP_006008325.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Latimeria 
chalumnae]
Length=400

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 98/144 (68%), Gaps = 11/144 (8%)
 Frame = +3

Query  87   MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  263
            MAEK  V  VT   P NIAVIKYWGKRD+ LILPIN S+SVTL    L TTTTV  S  F
Sbjct  1    MAEKKTVTRVTCTAPVNIAVIKYWGKRDDDLILPINSSLSVTLHQNQLKTTTTVVASREF  60

Query  264  DQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIAS  431
             +DR+WLNGKE +++  R Q+CL+EI    R R  D E +   + ++ K      +HI S
Sbjct  61   KEDRIWLNGKEDNINQPRLQSCLREIQRLARKRRSDGEGDSSPLNLSYK------IHICS  114

Query  432  YNNFPTaaglassaagfaCLVFAL  503
             NNFPTAAGLASSAAG+ACLV+AL
Sbjct  115  INNFPTAAGLASSAAGYACLVYAL  138



>ref|XP_004310733.1| PREDICTED: diphosphomevalonate decarboxylase [Tursiops truncatus]
Length=400

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  +E   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEEPLPLSLSYK------VHVASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL +AL
Sbjct  117  NFPTAAGLASSAAGYACLAYAL  138



>ref|XP_008553889.1| PREDICTED: diphosphomevalonate decarboxylase [Microplitis demolitor]
 gb|EZA44851.1| diphosphomevalonate decarboxylase [Microplitis demolitor]
Length=386

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 11/132 (8%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILPINDSIS++LD   LCT TTV  SP F ++++WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDEDLILPINDSISLSLDTKQLCTKTTVMASPNFKENKIWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G+E S++  R QNCL++I+++A               + E   VHI S NNFPTAAGLAS
Sbjct  63   GREESMNNKRLQNCLEKIKSKAT-----------LTNEMEMWKVHICSNNNFPTAAGLAS  111

Query  468  saagfaCLVFAL  503
            SAAG+ACL  AL
Sbjct  112  SAAGYACLTAAL  123



>gb|KDR21975.1| Diphosphomevalonate decarboxylase [Zootermopsis nevadensis]
Length=338

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILP+NDS+S TL    +   T+V  SP F +D++WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDENLILPLNDSVSATLSIKQMNAKTSVMASPNFTEDKIWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEK-KGIKITKKDWENLHVHIASYNNFPTaagla  464
            G+E +    R QNCL+EIR RA    D K  G+     DW    VH+ S NNFPTAAGLA
Sbjct  63   GREETFHSQRLQNCLQEIRRRAKQRADGKDDGV----SDWC---VHVCSENNFPTAAGLA  115

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACLVFAL
Sbjct  116  SSAAGYACLVFAL  128



>gb|ELU01936.1| hypothetical protein CAPTEDRAFT_176844 [Capitella teleta]
Length=398

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = +3

Query  102  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  281
            ++  T   P NIAVIKYWGKRDE LILPIN S+S TLD   L   TTVA S  F +DRMW
Sbjct  5    IISKTCTGPVNIAVIKYWGKRDEKLILPINASLSGTLDQQQLRAKTTVAASAGFTKDRMW  64

Query  282  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  461
            LNG+E SL   R QN LKEIR RA      K G +    D     VHI S NNFPTAAGL
Sbjct  65   LNGQEQSLDNPRLQNVLKEIRRRA---RKRKSGCE-DDLDMLTWRVHICSENNFPTAAGL  120

Query  462  assaagfaCLVFAL  503
            ASSAAG ACLVF+L
Sbjct  121  ASSAAGLACLVFSL  134



>ref|XP_002913420.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Ailuropoda melanoleuca]
Length=400

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK ++ VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKSLVAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR      E+  + ++     +  VHIAS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRSSAGEEXPLPLSL----SYKVHIASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL +AL
Sbjct  119  PTAAGLASSAAGYACLAYAL  138



>ref|XP_003484695.1| PREDICTED: diphosphomevalonate decarboxylase-like [Bombus impatiens]
Length=446

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT  T  NIAVIKYWGKRDETLILP+NDSIS TLD  HL T TTV +SP F +D++WLNG
Sbjct  66   VTCITSVNIAVIKYWGKRDETLILPVNDSISATLDTNHLHTKTTVMISPTFKEDQIWLNG  125

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            ++  +   R QNCL +IR RA +     +        W+   VHI S NNFPTAAGLASS
Sbjct  126  QKEDIKNPRLQNCLTQIRKRARNSNHIDQ--------WK---VHICSENNFPTAAGLASS  174

Query  471  aagfaCLVFAL  503
            AAG+ACLV AL
Sbjct  175  AAGYACLVAAL  185



>ref|XP_007468497.1| PREDICTED: diphosphomevalonate decarboxylase [Lipotes vexillifer]
Length=400

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A++  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAINRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPT AGLASSAAG+ACL +AL
Sbjct  117  NFPTGAGLASSAAGYACLAYAL  138



>ref|NP_001267865.1| diphosphomevalonate decarboxylase [Bombus terrestris]
 gb|AFI55102.1| diphosphomevalonate decarboxylase [Bombus terrestris]
Length=384

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 90/131 (69%), Gaps = 11/131 (8%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT     NIAVIKYWGKRDETLILP+NDSIS TLD  HL T TTV +SP F +D++WLNG
Sbjct  4    VTCIASVNIAVIKYWGKRDETLILPVNDSISATLDTDHLHTKTTVMISPTFKEDQIWLNG  63

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            +E  +   R QNCL +IR RA +     +        W+   VHI S NNFPTAAGLASS
Sbjct  64   QEEDIKNPRLQNCLTQIRKRARNSNHIDQ--------WK---VHICSENNFPTAAGLASS  112

Query  471  aagfaCLVFAL  503
            AAG+ACLV AL
Sbjct  113  AAGYACLVAAL  123



>gb|KJA27615.1| hypothetical protein HYPSUDRAFT_130498 [Hypholoma sublateritium 
FD-334 SS-4]
Length=411

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 93/141 (66%), Gaps = 6/141 (4%)
 Frame = +3

Query  87   MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  266
            M+   +   TA  P NIAVIKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F+
Sbjct  1    MSSAPIYEATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFE  60

Query  267  QDRMWLNGKEMSL-SGVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
             DR+WLNGKE  + +G R + C+KE+ R R   VED    +  +        VHIASYNN
Sbjct  61   ADRLWLNGKEDQITAGSRLETCIKEMKRLRKETVED----VDASAPKLSTYKVHIASYNN  116

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSA+GFA LV +L
Sbjct  117  FPTAAGLASSASGFAALVASL  137



>ref|XP_005805001.1| PREDICTED: diphosphomevalonate decarboxylase-like [Xiphophorus 
maculatus]
Length=403

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSMSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GKE  ++  R Q+CL+EIR  A    ++    + T     +  VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHQRLQSCLREIRRLARKRRNDGDA-RATDSVGLSHKVHICSVNNFPTAAGLAS  129

Query  468  saagfaCLVFAL  503
            SAAGFACLV+ L
Sbjct  130  SAAGFACLVYTL  141



>ref|NP_619597.2| diphosphomevalonate decarboxylase [Mus musculus]
 sp|Q99JF5.2|MVD1_MOUSE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Mus musculus]
 dbj|BAE22291.1| unnamed protein product [Mus musculus]
 gb|EDL11681.1| mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  127  SSAAGYACLAYTL  139



>ref|XP_004280113.1| PREDICTED: diphosphomevalonate decarboxylase [Orcinus orca]
Length=400

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL +AL
Sbjct  117  NFPTAAGLASSAAGYACLAYAL  138



>dbj|BAE42019.1| unnamed protein product [Mus musculus]
Length=401

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  127  SSAAGYACLAYTL  139



>emb|CAC35731.1| diphosphomevalonate decarboxylase [Mus musculus]
Length=401

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  127  SSAAGYACLAYTL  139



>dbj|BAC40852.1| unnamed protein product [Mus musculus]
 dbj|BAE32901.1| unnamed protein product [Mus musculus]
Length=401

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  127  SSAAGYACLAYTL  139



>ref|XP_010739786.1| PREDICTED: diphosphomevalonate decarboxylase [Larimichthys crocea]
Length=397

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  6    IVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQEQLKTTTTVATSRSFQEDRIWLN  65

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENL--HVHIASYNNFPTaagl  461
            GKE  ++  R Q+CL+EIR  A     +++G      D   L   VHI S NNFPTAAGL
Sbjct  66   GKEEDITHPRLQSCLREIRRLA----RKRRGDGDPSVDSTGLSHKVHICSVNNFPTAAGL  121

Query  462  assaagfaCLVFAL  503
            ASSAAGFACLV+ L
Sbjct  122  ASSAAGFACLVYTL  135



>gb|ELR58766.1| Diphosphomevalonate decarboxylase, partial [Bos mutus]
Length=411

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  5    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  64

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  65   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  118

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  119  NFPTAAGLASSAAGYACLAYTL  140



>ref|XP_007244091.1| PREDICTED: diphosphomevalonate decarboxylase [Astyanax mexicanus]
Length=404

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 11/149 (7%)
 Frame = +3

Query  69   FPFPGTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVA  248
             P   + + + + ++T   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA
Sbjct  1    MPENSSSSSQRLTVITCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVA  60

Query  249  VSPAFDQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLH  416
             S +F +DR+WLNGKE  ++  R Q+CL+EI    R R  D +D    I ++ +      
Sbjct  61   CSRSFQEDRIWLNGKEEDINQPRLQSCLREIRRLARKRRSD-DDPSNDISLSHR------  113

Query  417  VHIASYNNFPTaaglassaagfaCLVFAL  503
            VHI S NNFPTAAGLASSAAG+ACLV++L
Sbjct  114  VHICSVNNFPTAAGLASSAAGYACLVYSL  142



>pdb|3F0N|A Chain A, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
 pdb|3F0N|B Chain B, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
Length=414

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  22   LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  81

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  82   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  139

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  140  SSAAGYACLAYTL  152



>ref|XP_006027907.1| PREDICTED: diphosphomevalonate decarboxylase [Alligator sinensis]
Length=409

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 94/142 (66%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
             E+    VT   P NIAVIKYWGKRD  LILPIN S+SVTL+   L TTTT A+S  F +
Sbjct  3    GEQGCCRVTCTAPVNIAVIKYWGKRDSELILPINSSLSVTLNQDQLKTTTTAAISRDFKE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  ++  R QNCL+E+    R R    E +   + +T K      +HIAS N
Sbjct  63   DRLWLNGEEADITHPRLQNCLREMRRLARKRRSGSEGDTAPLNLTHK------LHIASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACLV+ L
Sbjct  117  NFPTAAGLASSAAGYACLVYTL  138



>gb|AAH08526.1| Mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  127  SSAAGYACLAYTL  139



>ref|XP_010842266.1| PREDICTED: diphosphomevalonate decarboxylase [Bison bison bison]
Length=400

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>ref|XP_005892469.1| PREDICTED: diphosphomevalonate decarboxylase [Bos mutus]
Length=400

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>ref|XP_005531982.1| PREDICTED: diphosphomevalonate decarboxylase [Pseudopodoces humilis]
Length=399

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 91/138 (66%), Gaps = 3/138 (2%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AE+ + M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERGLAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNGKE  +   R Q CL+E+R  A      + G + T     +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGCEDTATLSLSYKIHIASENNFPT  119

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACLV AL
Sbjct  120  AAGLASSAAGYACLVSAL  137



>ref|XP_004437181.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratotherium simum 
simum]
Length=400

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFAE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSSGDEDPLPLSVSYK------VHVASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL +AL
Sbjct  117  NFPTAAGLASSAAGYACLAYAL  138



>ref|XP_007125573.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Physeter 
catodon]
Length=400

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E      R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDAGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL +AL
Sbjct  117  NFPTAAGLASSAAGYACLAYAL  138



>ref|NP_001068892.1| diphosphomevalonate decarboxylase [Bos taurus]
 sp|Q0P570.1|MVD1_BOVIN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Bos taurus]
 gb|AAI20433.1| Mevalonate (diphospho) decarboxylase [Bos taurus]
 tpg|DAA20052.1| TPA: diphosphomevalonate decarboxylase [Bos taurus]
Length=400

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>ref|XP_546783.2| PREDICTED: diphosphomevalonate decarboxylase [Canis lupus familiaris]
Length=400

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +L VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT AVS  F +
Sbjct  3    SEKPLLAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAVSKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R    +++   + +T K      VHIAS N
Sbjct  63   DRIWLNGREEDVEQPRLQACLREIRRLARKRRSTGDEDPLPLSLTYK------VHIASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>ref|XP_003702160.1| PREDICTED: diphosphomevalonate decarboxylase-like [Megachile 
rotundata]
Length=387

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 86/131 (66%), Gaps = 11/131 (8%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIAVIKYWGKRD+ LILP+NDSIS TLD   LC  TTV +SP F  D +WLNG
Sbjct  4    VTCIAPINIAVIKYWGKRDDKLILPLNDSISATLDTEQLCAKTTVMISPNFKNDCIWLNG  63

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            KE  +   R QNCL EIR RA        G       W+   +HI S NNFPTAAGLASS
Sbjct  64   KEEDIKNPRLQNCLTEIRKRA--------GHSKHLNQWK---IHICSENNFPTAAGLASS  112

Query  471  aagfaCLVFAL  503
            AAG+ACLV AL
Sbjct  113  AAGYACLVTAL  123



>ref|XP_009029357.1| hypothetical protein HELRODRAFT_185177 [Helobdella robusta]
 gb|ESN93109.1| hypothetical protein HELRODRAFT_185177 [Helobdella robusta]
Length=406

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 93/134 (69%), Gaps = 8/134 (6%)
 Frame = +3

Query  102  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  281
            +L VT + P NIAV+KYWGK+DE LILP+N SIS TLD  H+C TTTVA+S +F +D+ W
Sbjct  3    ILSVTGRAPINIAVVKYWGKKDERLILPLNGSISGTLDLTHMCATTTVAISESFSEDQFW  62

Query  282  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  461
            LNG E SLS  R+   L+ I+ RA     E + I   K  W+   +HI S NNFPTAAGL
Sbjct  63   LNGLECSLSA-RFSIVLEAIKKRAL----ENETIDREKLSWK---IHICSKNNFPTAAGL  114

Query  462  assaagfaCLVFAL  503
            ASSAAG ACLVF L
Sbjct  115  ASSAAGLACLVFCL  128



>ref|XP_010877776.1| PREDICTED: diphosphomevalonate decarboxylase [Esox lucius]
Length=402

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            MVT   P NIAVIKYWGKRDE  ILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   MVTCNAPVNIAVIKYWGKRDEECILPINSSLSVTLHQDQLKTTTTVACSRSFQEDRIWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVE-DEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            GKE  ++  R Q+CL+EIR  A     D + G+ +     +   VHI S NNFPTAAGLA
Sbjct  71   GKEEDINQPRLQSCLREIRRLARKRRSDGEGGVDLAGLSHK---VHICSVNNFPTAAGLA  127

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACLV+ L
Sbjct  128  SSAAGYACLVYTL  140



>ref|XP_006734134.1| PREDICTED: diphosphomevalonate decarboxylase [Leptonychotes weddellii]
Length=400

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPLVAVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VHIAS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHIASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL +AL
Sbjct  119  PTAAGLASSAAGYACLAYAL  138



>ref|XP_007172621.1| PREDICTED: diphosphomevalonate decarboxylase [Balaenoptera acutorostrata 
scammoni]
Length=400

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +E+ V +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEEPVEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  D  +E   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEEPLPLSLSYK------VHVASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>ref|XP_007549941.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia formosa]
Length=404

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 93/134 (69%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENL--HVHIASYNNFPTaagl  461
            GKE  ++  R Q+CL+EIR  A    ++        +D   L   VHI S NNFPTAAGL
Sbjct  71   GKEEDITHQRLQSCLREIRRLARKRRNDGDA---RSEDSVGLSHKVHICSVNNFPTAAGL  127

Query  462  assaagfaCLVFAL  503
            ASSAAGFACLV+ L
Sbjct  128  ASSAAGFACLVYTL  141



>ref|XP_008403677.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia reticulata]
Length=403

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GKE  ++  R Q+CL+EIR R           + T     +  VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHQRLQSCLREIR-RLTRKRRTDGDARSTDSVGLSHKVHICSVNNFPTAAGLAS  129

Query  468  saagfaCLVFAL  503
            SAAGFACLV+ L
Sbjct  130  SAAGFACLVYTL  141



>ref|XP_011370192.1| PREDICTED: diphosphomevalonate decarboxylase [Pteropus vampyrus]
Length=400

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPVVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL F L
Sbjct  119  PTAAGLASSAAGYACLAFTL  138



>ref|XP_004392172.1| PREDICTED: diphosphomevalonate decarboxylase [Odobenus rosmarus 
divergens]
Length=400

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 95/139 (68%), Gaps = 6/139 (4%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +D
Sbjct  4    EKPLVAVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAAISKDFTED  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  446
            R+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VHIAS NNFP
Sbjct  64   RIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHIASVNNFP  119

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAG+ACL +AL
Sbjct  120  TAAGLASSAAGYACLAYAL  138



>ref|XP_005956369.1| PREDICTED: diphosphomevalonate decarboxylase [Pantholops hodgsonii]
Length=403

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 97/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  +  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSNGHEDPLPLSLSYK------VHVASEN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL +AL
Sbjct  117  NFPTAAGLASSAAGYACLAYAL  138



>ref|XP_004067388.1| PREDICTED: diphosphomevalonate decarboxylase [Oryzias latipes]
Length=364

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 95/134 (71%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  6    LVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTVATSRSFKEDRIWLN  65

Query  288  GKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  461
            GKE  ++  R Q+CL+EIR  AR    + +    ++T    +   VHI S NNFPTAAGL
Sbjct  66   GKEEDITHPRLQSCLREIRRLARKRHNDGDATSTELTGLSQK---VHICSVNNFPTAAGL  122

Query  462  assaagfaCLVFAL  503
            ASSAAGFACLV++L
Sbjct  123  ASSAAGFACLVYSL  136



>ref|XP_011163917.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Solenopsis 
invicta]
Length=381

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 88/131 (67%), Gaps = 11/131 (8%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +D +WLNG
Sbjct  4    VTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPDFKEDCIWLNG  63

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            +E  +  +R QNCLKEIR R+         +     DW+   +HI S NNFPTAAGLASS
Sbjct  64   REEDIKNIRLQNCLKEIRKRS--------QLSDYINDWK---IHICSKNNFPTAAGLASS  112

Query  471  aagfaCLVFAL  503
            AAG+ACL  AL
Sbjct  113  AAGYACLTAAL  123



>ref|XP_002111980.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
 gb|EDV25947.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
Length=385

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 85/127 (67%), Gaps = 13/127 (10%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
             T   P NIAV+KYWGKRDE LILPIN S+S TL    +C  TT+A+S +F +DR+W+NG
Sbjct  7    ATCIAPVNIAVVKYWGKRDENLILPINSSLSGTLSTDQMCAKTTIAISKSFQRDRLWING  66

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            KE   +G R QNCL+E+R+R C  E             E  H HI S NNFPTAAGLASS
Sbjct  67   KEQDATGKRLQNCLREVRSR-CGSE------------IEGCHYHICSVNNFPTAAGLASS  113

Query  471  aagfaCL  491
            AAG+ACL
Sbjct  114  AAGYACL  120



>ref|XP_004666010.1| PREDICTED: diphosphomevalonate decarboxylase [Jaculus jaculus]
Length=400

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK  +MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPQVMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNG+E  +   R Q CL+EIR  A        G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVRQPRLQACLREIRRLAQKQRTAGDGDALPLS--LSYKVHVASVNNFPT  120

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACL + L
Sbjct  121  AAGLASSAAGYACLAYTL  138



>ref|XP_011163916.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Solenopsis 
invicta]
Length=387

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 88/131 (67%), Gaps = 11/131 (8%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +D +WLNG
Sbjct  4    VTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPDFKEDCIWLNG  63

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            +E  +  +R QNCLKEIR R+         +     DW+   +HI S NNFPTAAGLASS
Sbjct  64   REEDIKNIRLQNCLKEIRKRS--------QLSDYINDWK---IHICSKNNFPTAAGLASS  112

Query  471  aagfaCLVFAL  503
            AAG+ACL  AL
Sbjct  113  AAGYACLTAAL  123



>gb|ACO09861.1| Diphosphomevalonate decarboxylase [Osmerus mordax]
Length=398

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F++DR+WLN
Sbjct  11   MVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLRTTTTVACSRSFEEDRIWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G+E  ++  R Q+CL+E+R  A     +     ++ K       HI S NNFPTAAGLAS
Sbjct  71   GREEDITLPRLQSCLREVRRLARKRHSDGDPAGLSHK------FHICSVNNFPTAAGLAS  124

Query  468  saagfaCLVFAL  503
            SAAG+ACLV++L
Sbjct  125  SAAGYACLVYSL  136



>ref|XP_008308874.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
 ref|XP_008308875.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
Length=403

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR+WLNG
Sbjct  13   VTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVATSRSFLEDRLWLNG  72

Query  291  KEMSLSGVRYQNCLKEIRARACDVE-DEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            KE  ++  R Q+CL+EIR  A     D   G+ +T        VHI S NNFPTAAGLAS
Sbjct  73   KEEDINHSRLQSCLREIRRLARKRRSDGDAGLNLTGLSQR---VHICSVNNFPTAAGLAS  129

Query  468  saagfaCLVFAL  503
            SAAGFACLV+ L
Sbjct  130  SAAGFACLVYTL  141



>ref|XP_006043222.1| PREDICTED: diphosphomevalonate decarboxylase [Bubalus bubalis]
Length=400

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLTEIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>ref|XP_002592260.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
 gb|EEN48271.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
Length=409

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 90/136 (66%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  281
            +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    LC  TTVA S  F +DR+W
Sbjct  14   ISQVTCTAPVNIAVIKYWGKRDEQLVLPINPSLSVTLSQDQLCARTTVAASADFKRDRVW  73

Query  282  LNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            LNG+E S+   R Q CL EIR  AR    +DE+ G      D     VH+ S NNFPTAA
Sbjct  74   LNGQEQSVDAPRLQKCLGEIRRLARKRKHKDERAG------DLLGSCVHVCSENNFPTAA  127

Query  456  glassaagfaCLVFAL  503
            GLASSAAG+ACLV +L
Sbjct  128  GLASSAAGYACLVQSL  143



>ref|XP_002432413.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus 
corporis]
 gb|EEB19675.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus 
corporis]
Length=401

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT + P NIA IKYWGKRDETLILP+NDSISVT++   +   TT+A SP F  DR+WLN
Sbjct  3    IVTCKAPVNIAAIKYWGKRDETLILPLNDSISVTINTNFMRAKTTIAASPHFKNDRIWLN  62

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            G+E   +  R   C+ E + R        +G  I  +   N  +HIAS NNFPTAAGLAS
Sbjct  63   GREEDFTNPRLMACVNESKYRQHSNIKSMQGNAIIIEKAANWKIHIASENNFPTAAGLAS  122

Query  468  saagfaCLVFAL  503
            SAAG+ACLV+AL
Sbjct  123  SAAGYACLVYAL  134



>ref|XP_004753891.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
 ref|XP_004814744.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
Length=400

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 94/141 (67%), Gaps = 10/141 (7%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EK V+ VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +D
Sbjct  4    EKPVVAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTED  63

Query  273  RMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            R+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS NN
Sbjct  64   RIWLNGREEDVEQPRLQACLREIRRLARKRRSAGDEDPAALGLSYK------VHVASVNN  117

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAG+ACL + L
Sbjct  118  FPTAAGLASSAAGYACLAYTL  138



>gb|KIY47272.1| Diphosphomevalonate decarboxylase [Fistulina hepatica ATCC 64428]
Length=406

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 92/136 (68%), Gaps = 6/136 (4%)
 Frame = +3

Query  102  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  281
            +   TA  P NIAVIKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F++DR+W
Sbjct  4    IFQATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLKSTTTSRADPSFEKDRLW  63

Query  282  LNGKEMSL-SGVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            LNGKE  + +G R   C+KE+ R R  +VED+        K      VHI+SYNNFPTAA
Sbjct  64   LNGKEEEIKAGGRTATCIKEMKRLRKVEVEDKDPSAPTISK----YPVHISSYNNFPTAA  119

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFA LV +L
Sbjct  120  GLASSAAGFAALVSSL  135



>ref|NP_001007423.1| diphosphomevalonate decarboxylase [Danio rerio]
 sp|Q5U403.1|MVD1_DANRE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Danio rerio]
 gb|AAH85325.1| Zgc:100824 [Danio rerio]
Length=400

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            MVT   P NIAVIKYWGKRDE LILP+N S+SVTL   HL TTTT+A S +F +D +WLN
Sbjct  11   MVTCTAPVNIAVIKYWGKRDEDLILPVNASLSVTLHQDHLRTTTTIACSRSFHKDCIWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GKE  +S  R Q+CL EIR  A      +K       D  N  VHI S NNFPTAAGLAS
Sbjct  71   GKEQDISHPRLQSCLLEIRRLA----QRRKNTGDPASDVSN-KVHICSVNNFPTAAGLAS  125

Query  468  saagfaCLVFAL  503
            SAAG+ACLV+ L
Sbjct  126  SAAGYACLVYTL  137



>ref|XP_004913618.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=417

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            G    + +  VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTT+ A S  
Sbjct  17   GNFRGQEMKKVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASRE  76

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F +DR+WLNGKE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NN
Sbjct  77   FTEDRIWLNGKEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNN  134

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAG+ACLV+ L
Sbjct  135  FPTAAGLASSAAGYACLVYTL  155



>ref|XP_004362385.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
 gb|EGG24534.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
Length=415

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 88/131 (67%), Gaps = 12/131 (9%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIA IKYWGKRDE LILP+N S+S TL    L TTTT   S +F++D +WLNG
Sbjct  28   VTCTAPVNIATIKYWGKRDENLILPLNSSLSGTLHQDDLKTTTTAVASESFEEDALWLNG  87

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            K+  ++ VRYQN LK IR+RA  + D+K              VHI S NNFPTAAGLASS
Sbjct  88   KKEDVNSVRYQNVLKTIRSRATKLMDKKH------------FVHICSINNFPTAAGLASS  135

Query  471  aagfaCLVFAL  503
            A+G+ACLV+ L
Sbjct  136  ASGYACLVYVL  146



>gb|ELK00496.1| Diphosphomevalonate decarboxylase [Pteropus alecto]
Length=310

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL F L
Sbjct  119  PTAAGLASSAAGYACLAFTL  138



>gb|AAH81784.1| Mevalonate (diphospho) decarboxylase [Rattus norvegicus]
 gb|EDL92747.1| mevalonate (diphospho) decarboxylase [Rattus norvegicus]
Length=401

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFTEDRIWL  68

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A        G  +         VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLS--LGYKVHVASVNNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  127  SSAAGYACLAYTL  139



>ref|XP_005769632.1| mevalonate-5-diphosphate decarboxylase [Emiliania huxleyi CCMP1516]
 gb|EOD17203.1| mevalonate-5-diphosphate decarboxylase [Emiliania huxleyi CCMP1516]
Length=439

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            ++ V  +T  +PTNIA+IKYWGKRD  + LPIN S+SVTL+   L T TTV+ S +F +D
Sbjct  2    QQPVFSLTISSPTNIALIKYWGKRDAKINLPINSSVSVTLNQRDLRTVTTVSASRSFSRD  61

Query  273  RMWLNGKEMSLSGV-RYQNCLKEIRARACDVEDEKKGIKITKKD-WENLHVHIASYNNFP  446
            R+WLNG+E  ++   R     +E+RARA D+ D K G  + +KD W+ L V + S NNFP
Sbjct  62   RLWLNGEEEDVNASRRVLAVFREVRARAGDLRDPKTGQVLVRKDEWDGLRVWVVSENNFP  121

Query  447  TaaglassaagfaCLVFAL  503
            TAAGLASSAAG+A L FAL
Sbjct  122  TAAGLASSAAGYAALTFAL  140



>ref|XP_002942038.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913619.1| PREDICTED: diphosphomevalonate decarboxylase isoform X3 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913620.1| PREDICTED: diphosphomevalonate decarboxylase isoform X4 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913621.1| PREDICTED: diphosphomevalonate decarboxylase isoform X5 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913622.1| PREDICTED: diphosphomevalonate decarboxylase isoform X6 [Xenopus 
(Silurana) tropicalis]
Length=394

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTT+ A S  F +DR+WLNG
Sbjct  4    VTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWLNG  63

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            KE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NNFPTAAGLASS
Sbjct  64   KEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNNFPTAAGLASS  121

Query  471  aagfaCLVFAL  503
            AAG+ACLV+ L
Sbjct  122  AAGYACLVYTL  132



>ref|XP_008838768.1| PREDICTED: diphosphomevalonate decarboxylase [Nannospalax galili]
Length=406

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK  ++VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  9    SEKLQVVVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLRTTTTAAISKDFTE  68

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E ++   R Q CL+EIR  AR     + +  + ++     +  VH+AS NNF
Sbjct  69   DRIWLNGREEAVGQPRLQACLREIRRLARKRRSMEGEGALPLSL----SYKVHVASVNNF  124

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL + L
Sbjct  125  PTAAGLASSAAGYACLAYTL  144



>ref|XP_006926815.1| PREDICTED: diphosphomevalonate decarboxylase [Pteropus alecto]
Length=400

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL F L
Sbjct  119  PTAAGLASSAAGYACLAFTL  138



>ref|XP_009089159.1| PREDICTED: diphosphomevalonate decarboxylase [Serinus canaria]
Length=399

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AE+ + M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERALAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNGKE  +   R Q CL+E+R  A      + G +       +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGGEDAAALSLSYKIHIASENNFPT  119

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACLV AL
Sbjct  120  AAGLASSAAGYACLVSAL  137



>ref|XP_010792093.1| PREDICTED: diphosphomevalonate decarboxylase [Notothenia coriiceps]
Length=402

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTT+A S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTIATSRSFKEDRIWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GKE  ++  R Q+CL+EIR  A    ++  G         +L VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRND--GDPALDPSVLSLKVHICSVNNFPTAAGLAS  128

Query  468  saagfaCLVFAL  503
            SAAGFACLV+ L
Sbjct  129  SAAGFACLVYTL  140



>ref|NP_112324.1| diphosphomevalonate decarboxylase [Rattus norvegicus]
 sp|Q62967.1|MVD1_RAT RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
 gb|AAB00192.1| mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
Length=401

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = +3

Query  105  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  284
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINPSLSVTLHQDQLKTTTTAAISKDFTEDRIWL  68

Query  285  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  464
            NG+E  +   R Q CL+EIR  A        G  +         VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLS--LGYKVHVASVNNFPTAAGLA  126

Query  465  ssaagfaCLVFAL  503
            SSAAG+ACL + L
Sbjct  127  SSAAGYACLAYTL  139



>ref|XP_007532001.1| PREDICTED: diphosphomevalonate decarboxylase [Erinaceus europaeus]
Length=400

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 10/140 (7%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            K ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR
Sbjct  5    KQLVTVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFTEDR  64

Query  276  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            +WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS NNF
Sbjct  65   IWLNGQEEHVGQPRLQACLREIRRLARKRRSTGDEDPPPLSLSYK------VHVASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL +AL
Sbjct  119  PTAAGLASSAAGYACLAYAL  138



>ref|XP_004377812.1| PREDICTED: diphosphomevalonate decarboxylase [Trichechus manatus 
latirostris]
Length=400

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +E+ +++VT+  P NIAVIKYWGKRDE L+LP+N S+SVTL    L TTTT A+S  F +
Sbjct  3    SEEPLVIVTSTAPVNIAVIKYWGKRDEELVLPLNSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG E+ +   R Q+CL+EIR  AR     D+     ++     +  VHIAS NNF
Sbjct  63   DRIWLNGTEVDVGQPRLQSCLREIRRLARKRRSTDDGDAPPLSL----SYKVHIASENNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL + L
Sbjct  119  PTAAGLASSAAGYACLAYTL  138



>ref|XP_004058175.1| PREDICTED: diphosphomevalonate decarboxylase [Gorilla gorilla 
gorilla]
Length=400

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK    VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPQAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKHFTK  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNG+E  +   R Q CL+EIR  A    D + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRDSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACL + L
Sbjct  121  AAGLASSAAGYACLAYTL  138



>ref|XP_003998380.1| PREDICTED: diphosphomevalonate decarboxylase [Felis catus]
Length=398

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +3

Query  93   EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  272
            EK +++VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +D
Sbjct  5    EKPLVVVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTED  64

Query  273  RMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            R+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VHIAS NN
Sbjct  65   RIWLNGREEDVGQPRLQACLREIRRLARKRRSTGDEDPPPLSLSYK------VHIASVNN  118

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAG+ACL + L
Sbjct  119  FPTAAGLASSAAGYACLAYTL  139



>ref|XP_002413928.1| diphosphomevalonate decarboxylase, putative [Ixodes scapularis]
 gb|EEC17236.1| diphosphomevalonate decarboxylase, putative, partial [Ixodes 
scapularis]
Length=357

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 6/134 (4%)
 Frame = +3

Query  102  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  281
            + M TA+ P NIAV+KYWGK +E LI+P NDS+S+TL   HLC  TTVAV   F +DR+W
Sbjct  11   LFMATARAPVNIAVVKYWGKTNEELIIPANDSLSLTLHIDHLCAKTTVAVGRDFKEDRIW  70

Query  282  LNGKEMSLSGVRYQNCLKEIRARACD-VEDEKKGIKITKKDWENLHVHIASYNNFPTaag  458
            LNGKE  ++  R QNCL EIR R+ + +     G+     D+ + H+HI S NNFPTAAG
Sbjct  71   LNGKEERVT-TRIQNCLLEIRKRSREFMHMHNTGL----PDYSDWHLHICSVNNFPTAAG  125

Query  459  lassaagfaCLVFA  500
            LASSAAG+ACL +A
Sbjct  126  LASSAAGYACLEWA  139



>ref|XP_006888835.1| PREDICTED: diphosphomevalonate decarboxylase [Elephantulus edwardii]
Length=400

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            ++K  +MVT   P NIAVIKYWGKRDE LILP+N S+SVTL    L TTTT  +S  F +
Sbjct  3    SDKSRVMVTCTAPVNIAVIKYWGKRDEELILPLNSSLSVTLHQDQLKTTTTATISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG E+ +   R Q+CL+EI    R R    + +  G+ ++ K      VH+AS N
Sbjct  63   DRVWLNGVEVDVRQPRLQSCLREIHRLARKRRSTEDKDAPGLSLSHK------VHVASEN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>ref|XP_005691918.1| PREDICTED: diphosphomevalonate decarboxylase [Capra hircus]
Length=396

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  437
            DR+WLNG+E  +   R Q CL+EI    R R  +  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSNGHEDPLPLSLSYK------VHVASEN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



>dbj|GAM24015.1| hypothetical protein SAMD00019534_071900 [Acytostelium subglobosum 
LB1]
Length=402

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 88/132 (67%), Gaps = 12/132 (9%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIA IKYWGKRDE LILP+NDS+S TL    L TTTT   S +F +D +WLN
Sbjct  4    LVTCTAPVNIATIKYWGKRDEKLILPLNDSLSGTLHQDDLKTTTTAMASESFTEDALWLN  63

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GK+  ++  RYQN LK IR+RA  + D+K              VHI S NNFPTAAGLAS
Sbjct  64   GKKEDINTTRYQNVLKTIRSRATKLMDKKHC------------VHICSVNNFPTAAGLAS  111

Query  468  saagfaCLVFAL  503
            SA+G+ACLV+ L
Sbjct  112  SASGYACLVYVL  123



>ref|XP_008506971.1| PREDICTED: diphosphomevalonate decarboxylase [Equus przewalskii]
Length=400

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 95/140 (68%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPLVAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  443
            DR+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VH+AS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHVASVNNF  118

Query  444  PTaaglassaagfaCLVFAL  503
            PTAAGLASSAAG+ACL + L
Sbjct  119  PTAAGLASSAAGYACLAYTL  138



>ref|XP_005052358.1| PREDICTED: diphosphomevalonate decarboxylase [Ficedula albicollis]
Length=401

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 89/138 (64%), Gaps = 3/138 (2%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            AE+   M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERGPAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNGKE  +   R Q CL+E+R  A      + G +       +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGGEDAAALSLSYKIHIASENNFPT  119

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACLV AL
Sbjct  120  AAGLASSAAGYACLVSAL  137



>ref|XP_523460.3| PREDICTED: diphosphomevalonate decarboxylase [Pan troglodytes]
Length=400

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNG+E  +   R Q CL+EIR  A    + + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACL + L
Sbjct  121  AAGLASSAAGYACLAYTL  138



>ref|XP_011058925.1| PREDICTED: diphosphomevalonate decarboxylase [Acromyrmex echinatior]
Length=386

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 88/131 (67%), Gaps = 11/131 (8%)
 Frame = +3

Query  111  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  290
            VT   P NIAVIKYWGKR+E+LILP NDSIS TLD A L   TTV +S  F +DR+WLNG
Sbjct  5    VTCIAPVNIAVIKYWGKRNESLILPTNDSISATLDTAQLHAKTTVMLSSDFKEDRIWLNG  64

Query  291  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  470
            KE  ++  R QNCLKEIR R+         +     DW+   + I S NNFPTAAGLASS
Sbjct  65   KEEDINNTRLQNCLKEIRKRS--------QLSGYTNDWK---IRICSKNNFPTAAGLASS  113

Query  471  aagfaCLVFAL  503
            AAG+ACL  AL
Sbjct  114  AAGYACLTAAL  124



>gb|ACO11575.1| Diphosphomevalonate decarboxylase [Caligus rogercresseyi]
Length=390

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 13/132 (10%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE LILPINDS S+TLD   +   TT+  SP F++D++WLN
Sbjct  5    IVTCIAPVNIAVIKYWGKRDEELILPINDSFSLTLDTKEMRAKTTIMTSPEFEKDQIWLN  64

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
             KE S+   R Q CL EIR R+          + + K+W+   + I S NNFPTAAGLAS
Sbjct  65   DKEESMENPRLQRCLGEIRKRS----------QASHKNWK---IRICSENNFPTAAGLAS  111

Query  468  saagfaCLVFAL  503
            SAAG+ACLV+AL
Sbjct  112  SAAGYACLVYAL  123



>ref|XP_005915248.1| PREDICTED: diphosphomevalonate decarboxylase-like [Haplochromis 
burtoni]
Length=402

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  288  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFACLV++L
Sbjct  125  GLASSAAGFACLVYSL  140



>ref|XP_006780089.1| PREDICTED: diphosphomevalonate decarboxylase-like [Neolamprologus 
brichardi]
Length=402

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  288  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFACLV++L
Sbjct  125  GLASSAAGFACLVYSL  140



>ref|XP_006641302.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase-like 
[Lepisosteus oculatus]
Length=365

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTTVA S +  +DR+WLN
Sbjct  11   LVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTVASSRSLKEDRIWLN  70

Query  288  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  467
            GKE +++  R Q+CL+EIR  A   +    G    +       VHI S NNFPTAAGLAS
Sbjct  71   GKEENINLPRLQSCLREIRRLA--RKRRSSGDGGAESSGLAHKVHICSVNNFPTAAGLAS  128

Query  468  saagfaCLVFAL  503
            SAAG+ACLV+AL
Sbjct  129  SAAGYACLVYAL  140



>ref|XP_005753004.1| PREDICTED: diphosphomevalonate decarboxylase-like [Pundamilia 
nyererei]
Length=402

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = +3

Query  108  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  287
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  288  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  456  glassaagfaCLVFAL  503
            GLASSAAGFACLV++L
Sbjct  125  GLASSAAGFACLVYSL  140



>gb|AAP36301.1| Homo sapiens mevalonate (diphospho) decarboxylase [synthetic 
construct]
 gb|AAX43880.1| mevalonate (diphospho) decarboxylase, partial [synthetic construct]
Length=401

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNG+E  +   R Q CL+EIR  A    + + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACL + L
Sbjct  121  AAGLASSAAGYACLAYTL  138



>ref|NP_002452.1| diphosphomevalonate decarboxylase [Homo sapiens]
 sp|P53602.1|MVD1_HUMAN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Homo sapiens]
 pdb|3D4J|A Chain A, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 pdb|3D4J|B Chain B, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 gb|AAC50440.1| mevalonate pyrophosphate decarboxylase [Homo sapiens]
 gb|AAH00011.1| Mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAP35576.1| mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAX32278.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|EAW66792.1| mevalonate (diphospho) decarboxylase, isoform CRA_c [Homo sapiens]
 gb|ABM84650.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|ABM92179.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 dbj|BAI45751.1| mevalonate (diphospho) decarboxylase [synthetic construct]
Length=400

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  449
            DR+WLNG+E  +   R Q CL+EIR  A    + + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  450  aaglassaagfaCLVFAL  503
            AAGLASSAAG+ACL + L
Sbjct  121  AAGLASSAAGYACLAYTL  138



>ref|XP_006212468.1| PREDICTED: diphosphomevalonate decarboxylase [Vicugna pacos]
Length=400

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 88/136 (65%), Gaps = 2/136 (1%)
 Frame = +3

Query  96   KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  275
            K V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR
Sbjct  5    KPVVAVTCTAPVNIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTEDR  64

Query  276  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  455
            +WLNG E  +   R Q CLKEIR  AC          +      +  VHIAS NNFPTAA
Sbjct  65   IWLNGCEEDIRQPRLQACLKEIRRLACKRRSGSPEDPLPLS--HSCKVHIASENNFPTAA  122

Query  456  glassaagfaCLVFAL  503
            GLASSAAG+ACL + L
Sbjct  123  GLASSAAGYACLAYTL  138



>gb|AAH63907.1| mvd-prov protein, partial [Xenopus (Silurana) tropicalis]
Length=402

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  81   GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  260
            G    + +  VT   P NIAVIKYWGK++E LILPIN S+SVTL    L TTT+ A S  
Sbjct  2    GNFRGQEMKKVTCTAPVNIAVIKYWGKQNEELILPINSSLSVTLHQDQLKTTTSAAASRE  61

Query  261  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  440
            F +DR+WLNGKE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NN
Sbjct  62   FTEDRIWLNGKEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNN  119

Query  441  FPTaaglassaagfaCLVFAL  503
            FPTAAGLASSAAG+ACLV+ L
Sbjct  120  FPTAAGLASSAAGYACLVYTL  140



>ref|XP_001488083.1| PREDICTED: diphosphomevalonate decarboxylase [Equus caballus]
Length=400

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  269
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPLVAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  270  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENL----HVHIASYN  437
            DR+WLNG+E  +   R Q CL+EIR  A      +K      +D   L     VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLA------RKRRSAGDEDLLPLSLSYKVHVASVN  116

Query  438  NFPTaaglassaagfaCLVFAL  503
            NFPTAAGLASSAAG+ACL + L
Sbjct  117  NFPTAAGLASSAAGYACLAYTL  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905