BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013D04

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03946.1|  unnamed protein product                                143   9e-40   Coffea canephora [robusta coffee]
ref|XP_009611217.1|  PREDICTED: ras-related protein RABA5b              143   9e-40   Nicotiana tomentosiformis
ref|XP_004247033.1|  PREDICTED: ras-related protein RABA5b-like         142   1e-39   Solanum lycopersicum
ref|XP_009767908.1|  PREDICTED: ras-related protein RABA5b-like         142   1e-39   Nicotiana sylvestris
ref|XP_009762686.1|  PREDICTED: ras-related protein RABA5b-like         142   1e-39   Nicotiana sylvestris
ref|XP_011089627.1|  PREDICTED: ras-related protein RABA5b-like         142   3e-39   Sesamum indicum [beniseed]
gb|EYU39173.1|  hypothetical protein MIMGU_mgv1a013470mg                142   3e-39   Erythranthe guttata [common monkey flower]
gb|EYU40652.1|  hypothetical protein MIMGU_mgv1a013587mg                141   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_011089021.1|  PREDICTED: ras-related protein RABA5b              140   1e-38   
gb|EPS67330.1|  hypothetical protein M569_07446                         137   8e-38   Genlisea aurea
ref|XP_007049622.1|  RAB GTPase A5B                                     137   2e-37   
ref|XP_007140715.1|  hypothetical protein PHAVU_008G135600g             137   2e-37   Phaseolus vulgaris [French bean]
gb|ABC68436.1|  putative small GTP-binding protein                      133   3e-37   Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|ABC68435.1|  putative small GTP-binding protein                      133   3e-37   Tragopogon dubius [yellow salsify]
gb|KJB84096.1|  hypothetical protein B456_N003900                       136   3e-37   Gossypium raimondii
ref|XP_004149322.1|  PREDICTED: ras-related protein RABA5e-like         136   4e-37   Cucumis sativus [cucumbers]
ref|XP_008458081.1|  PREDICTED: ras-related protein RABA5b              136   4e-37   Cucumis melo [Oriental melon]
ref|XP_003622764.1|  Ras-related protein ARA-1                          135   6e-37   Medicago truncatula
ref|XP_004492211.1|  PREDICTED: ras-related protein RABA5b-like         135   7e-37   Cicer arietinum [garbanzo]
ref|XP_002303077.1|  GTP-binding family protein                         135   9e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004290147.1|  PREDICTED: ras-related protein RABA5b              135   9e-37   Fragaria vesca subsp. vesca
ref|XP_010100807.1|  Ras-related protein RABA5c                         135   1e-36   Morus notabilis
ref|NP_001240985.1|  ras-related protein RABA5b-like                    135   1e-36   Glycine max [soybeans]
ref|XP_006484821.1|  PREDICTED: ras-related protein RABA5b-like         135   1e-36   Citrus sinensis [apfelsine]
gb|KJB10858.1|  hypothetical protein B456_001G229200                    136   1e-36   Gossypium raimondii
gb|KDO60895.1|  hypothetical protein CISIN_1g027703mg                   135   2e-36   Citrus sinensis [apfelsine]
ref|XP_006437222.1|  hypothetical protein CICLE_v10032706mg             135   2e-36   Citrus clementina [clementine]
dbj|BAA02108.1|  GTP-binding protein                                    134   2e-36   Pisum sativum [garden pea]
gb|KDP45261.1|  hypothetical protein JCGZ_15126                         134   2e-36   Jatropha curcas
gb|ABK21873.1|  unknown                                                 133   4e-36   Picea sitchensis
ref|XP_009124351.1|  PREDICTED: ras-related protein RABA5b              133   4e-36   Brassica rapa
ref|XP_011024576.1|  PREDICTED: ras-related protein RABA5e-like         133   4e-36   Populus euphratica
ref|XP_010486290.1|  PREDICTED: ras-related protein RABA5b isofor...    133   6e-36   
gb|AFK35472.1|  unknown                                                 133   6e-36   Medicago truncatula
ref|XP_010451632.1|  PREDICTED: ras-related protein RABA5b-like i...    133   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006407840.1|  hypothetical protein EUTSA_v10021494mg             133   7e-36   Eutrema salsugineum [saltwater cress]
gb|KFK38199.1|  hypothetical protein AALP_AA3G082000                    133   8e-36   Arabis alpina [alpine rockcress]
ref|XP_010451591.1|  PREDICTED: ras-related protein RABA5b-like i...    132   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002884647.1|  hypothetical protein ARALYDRAFT_896904             132   8e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_010486288.1|  PREDICTED: ras-related protein RABA5b isofor...    132   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010069602.1|  PREDICTED: ras-related protein RABA5b              132   9e-36   Eucalyptus grandis [rose gum]
ref|NP_187397.1|  RAB GTPase-like protein A5B                           132   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298457.1|  hypothetical protein CARUB_v10014528mg             133   1e-35   
ref|XP_010464360.1|  PREDICTED: ras-related protein RABA5b-like         134   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010666947.1|  PREDICTED: ras-related protein RABA5e              132   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010524651.1|  PREDICTED: ras-related protein RABA5b              132   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_002533058.1|  protein with unknown function                      132   1e-35   Ricinus communis
ref|XP_007033995.1|  RAB GTPase A5E isoform 2                           131   3e-35   
ref|XP_010909337.1|  PREDICTED: ras-related protein RABA5e-like         131   4e-35   Elaeis guineensis
ref|XP_007033994.1|  RAB GTPase A5E isoform 1                           131   4e-35   
ref|XP_001783000.1|  Rab11/RabA-family small GTPase                     130   4e-35   
gb|KDO50521.1|  hypothetical protein CISIN_1g0404812mg                  127   5e-35   Citrus sinensis [apfelsine]
ref|XP_010650400.1|  PREDICTED: ras-related protein RABA5c-like         130   5e-35   
ref|XP_002263362.1|  PREDICTED: ras-related protein RABA5e              130   7e-35   Vitis vinifera
ref|XP_010069409.1|  PREDICTED: ras-related protein RABA5e-like         130   7e-35   Eucalyptus grandis [rose gum]
gb|KJB28020.1|  hypothetical protein B456_005G022300                    130   8e-35   Gossypium raimondii
gb|KJB28019.1|  hypothetical protein B456_005G022300                    130   9e-35   Gossypium raimondii
gb|KHG13174.1|  Ras-related RABA5d -like protein                        130   1e-34   Gossypium arboreum [tree cotton]
ref|XP_001772977.1|  Rab11/RabA-family small GTPase                     130   1e-34   
ref|XP_001780193.1|  Rab11/RabA-family small GTPase                     130   1e-34   
ref|XP_010241769.1|  PREDICTED: ras-related protein RABA5c              130   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009619604.1|  PREDICTED: ras-related protein RABA5c-like         130   1e-34   Nicotiana tomentosiformis
ref|XP_008779666.1|  PREDICTED: ras-related protein RABA5d-like         127   1e-34   Phoenix dactylifera
ref|XP_004248020.1|  PREDICTED: ras-related protein RABA5c-like         129   1e-34   Solanum lycopersicum
gb|AGZ15280.1|  putative RAB11G                                         129   1e-34   Taraxacum brevicorniculatum
ref|XP_006856830.1|  hypothetical protein AMTR_s00055p00167390          129   1e-34   Amborella trichopoda
ref|XP_002301639.2|  hypothetical protein POPTR_0002s23270g             126   1e-34   
ref|XP_006358795.1|  PREDICTED: ras-related protein RABA5b-like         129   1e-34   Solanum tuberosum [potatoes]
ref|XP_008811658.1|  PREDICTED: ras-related protein RABA5e              129   1e-34   Phoenix dactylifera
ref|XP_006478881.1|  PREDICTED: ras-related protein RABA5c-like         129   2e-34   Citrus sinensis [apfelsine]
ref|XP_010999992.1|  PREDICTED: ras-related protein RABA5d-like         129   3e-34   Populus euphratica
emb|CDP10336.1|  unnamed protein product                                129   3e-34   Coffea canephora [robusta coffee]
ref|XP_008453919.1|  PREDICTED: ras-related protein RABA5d              129   3e-34   Cucumis melo [Oriental melon]
ref|XP_006410298.1|  hypothetical protein EUTSA_v10017221mg             129   3e-34   Eutrema salsugineum [saltwater cress]
ref|XP_004152077.1|  PREDICTED: ras-related protein RABA5d-like         129   3e-34   Cucumis sativus [cucumbers]
gb|EYU32725.1|  hypothetical protein MIMGU_mgv1a013434mg                129   3e-34   Erythranthe guttata [common monkey flower]
gb|AAL36203.1|  putative RAS-related protein ARA-1                      128   4e-34   Arabidopsis thaliana [mouse-ear cress]
sp|P19892.1|RAA5E_ARATH  RecName: Full=Ras-related protein RABA5e...    128   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009383827.1|  PREDICTED: ras-related protein RABA5c-like         128   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009339876.1|  PREDICTED: ras-related protein RABA5e              128   4e-34   Pyrus x bretschneideri [bai li]
emb|CDP10276.1|  unnamed protein product                                128   4e-34   Coffea canephora [robusta coffee]
ref|XP_011073833.1|  PREDICTED: ras-related protein RABA5c              128   4e-34   Sesamum indicum [beniseed]
ref|XP_009118574.1|  PREDICTED: ras-related protein RABA5e              128   4e-34   Brassica rapa
ref|XP_008380689.1|  PREDICTED: ras-related protein RABA5e              128   5e-34   Malus domestica [apple tree]
ref|XP_002321111.1|  Ras-related protein ARA-4                          128   5e-34   
emb|CDY06181.1|  BnaA09g50220D                                          129   5e-34   
ref|XP_008222663.1|  PREDICTED: ras-related protein RABA5e              128   5e-34   Prunus mume [ume]
ref|XP_004296709.1|  PREDICTED: ras-related protein RABA5e              128   5e-34   Fragaria vesca subsp. vesca
ref|XP_007223957.1|  hypothetical protein PRUPE_ppa011186mg             128   5e-34   Prunus persica
gb|KFK42915.1|  hypothetical protein AALP_AA1G054800                    128   5e-34   Arabis alpina [alpine rockcress]
gb|ACN40515.1|  unknown                                                 128   5e-34   Picea sitchensis
ref|NP_563750.2|  RAB GTPase homolog A5E                                129   6e-34   
ref|XP_011042789.1|  PREDICTED: ras-related protein RABA5d-like         128   6e-34   Populus euphratica
ref|XP_002527386.1|  protein with unknown function                      128   6e-34   Ricinus communis
gb|KDP42877.1|  hypothetical protein JCGZ_23819                         128   6e-34   Jatropha curcas
gb|ABR17569.1|  unknown                                                 128   6e-34   Picea sitchensis
ref|XP_011095944.1|  PREDICTED: ras-related protein RABA5a              128   6e-34   Sesamum indicum [beniseed]
ref|XP_009348339.1|  PREDICTED: ras-related protein RABA5e              128   7e-34   Pyrus x bretschneideri [bai li]
ref|XP_008792967.1|  PREDICTED: ras-related protein RABA5d-like         127   7e-34   Phoenix dactylifera
gb|AAA74116.1|  putative                                                127   8e-34   Nicotiana tabacum [American tobacco]
ref|XP_003532321.1|  PREDICTED: ras-related protein RABA5d              127   8e-34   
ref|XP_003552753.1|  PREDICTED: ras-related protein RABA5d-like         127   9e-34   
emb|CDY10008.1|  BnaC08g44430D                                          129   9e-34   Brassica napus [oilseed rape]
ref|XP_010553589.1|  PREDICTED: ras-related protein RABA5c-like         127   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_009791655.1|  PREDICTED: ras-related protein RABA5c-like         127   1e-33   Nicotiana sylvestris
ref|XP_009628055.1|  PREDICTED: ras-related protein RABA5c-like         127   1e-33   Nicotiana tomentosiformis
ref|XP_006366713.1|  PREDICTED: ras-related protein RABA5e-like         127   1e-33   Solanum tuberosum [potatoes]
ref|XP_002976591.1|  rab family GTPase                                  127   1e-33   Selaginella moellendorffii
ref|XP_004248001.1|  PREDICTED: ras-related protein RABA5e-like         127   1e-33   Solanum lycopersicum
ref|XP_001753288.1|  Rab11/RabA-family small GTPase                     127   1e-33   
ref|XP_010517866.1|  PREDICTED: ras-related protein RABA5c-like         127   1e-33   Camelina sativa [gold-of-pleasure]
ref|NP_181842.1|  Ras-related protein ARA-4                             127   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054657.1|  PREDICTED: ras-related protein RABA5c              127   1e-33   Eucalyptus grandis [rose gum]
ref|XP_009415105.1|  PREDICTED: ras-related protein RABA5e-like         127   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA98183.1|  RAB11G                                                 127   1e-33   Lotus japonicus
ref|XP_008244729.1|  PREDICTED: ras-related protein RABA5d              126   1e-33   
ref|XP_002881887.1|  hypothetical protein ARALYDRAFT_903694             127   1e-33   
ref|XP_010508467.1|  PREDICTED: ras-related protein RABA5c              127   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007139106.1|  hypothetical protein PHAVU_008G001800g             127   1e-33   Phaseolus vulgaris [French bean]
ref|XP_009133574.1|  PREDICTED: ras-related protein RABA5c              127   1e-33   Brassica rapa
ref|XP_006294977.1|  hypothetical protein CARUB_v10024045mg             127   1e-33   Capsella rubella
gb|KHG11710.1|  Ras-related RABA5d -like protein                        127   1e-33   Gossypium arboreum [tree cotton]
ref|XP_008380791.1|  PREDICTED: ras-related protein RABA5d-like         125   1e-33   
emb|CDX83500.1|  BnaA03g20060D                                          127   1e-33   
gb|KFK37154.1|  hypothetical protein AALP_AA4G220200                    127   2e-33   Arabis alpina [alpine rockcress]
ref|XP_006411588.1|  hypothetical protein EUTSA_v10017231mg             127   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010506172.1|  PREDICTED: ras-related protein RABA5c-like         127   2e-33   Camelina sativa [gold-of-pleasure]
dbj|BAF01351.1|  Ras-related GTP-binding protein                        125   2e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42801.1|  BnaC03g24050D                                          126   2e-33   Brassica napus [oilseed rape]
ref|XP_007034147.1|  RAB GTPase A5E isoform 2                           126   2e-33   
ref|XP_010542762.1|  PREDICTED: ras-related protein RABA5d-like         127   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010673314.1|  PREDICTED: ras-related protein RABA5d-like         126   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003574801.1|  PREDICTED: ras-related protein RABA5c-like         126   2e-33   Brachypodium distachyon [annual false brome]
ref|XP_007034146.1|  RAB GTPase A5E isoform 1                           126   2e-33   Theobroma cacao [chocolate]
ref|XP_010926654.1|  PREDICTED: ras-related protein RABA5e-like i...    126   2e-33   
ref|XP_010497765.1|  PREDICTED: ras-related protein RABA5a-like         123   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004973932.1|  PREDICTED: ras-related protein RABA5d-like         126   2e-33   Setaria italica
ref|XP_004495529.1|  PREDICTED: ras-related protein RABA5a-like i...    127   2e-33   Cicer arietinum [garbanzo]
ref|XP_010522214.1|  PREDICTED: ras-related protein RABA5d              126   2e-33   Tarenaya hassleriana [spider flower]
gb|EMT31969.1|  Ras-related protein ARA-4                               126   2e-33   
gb|KEH21456.1|  RAB GTPase-like protein A1D                             126   2e-33   Medicago truncatula
emb|CDP04500.1|  unnamed protein product                                126   2e-33   Coffea canephora [robusta coffee]
ref|XP_007200458.1|  hypothetical protein PRUPE_ppa011281mg             126   2e-33   Prunus persica
ref|XP_004515580.1|  PREDICTED: ras-related protein RABA5e-like         126   3e-33   Cicer arietinum [garbanzo]
dbj|BAJ85419.1|  predicted protein                                      126   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA82710.1|  guanine nucleotide regulatory protein                  126   3e-33   Vicia faba [broad bean]
ref|XP_008372555.1|  PREDICTED: ras-related protein RABA5b-like         126   3e-33   Malus domestica [apple tree]
ref|XP_010485340.1|  PREDICTED: ras-related protein RABA5e isofor...    125   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004139534.1|  PREDICTED: ras-related protein RABA5a-like         126   3e-33   Cucumis sativus [cucumbers]
gb|EMS53467.1|  Ras-related protein RABA5c                              126   3e-33   Triticum urartu
ref|XP_010265418.1|  PREDICTED: ras-related protein RABA5a              126   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008382566.1|  PREDICTED: ras-related protein RABA5b-like         126   3e-33   Malus domestica [apple tree]
gb|KEH42936.1|  RAB GTPase-like protein C2B                             126   3e-33   Medicago truncatula
ref|XP_006293514.1|  hypothetical protein CARUB_v10024030mg             126   3e-33   Capsella rubella
ref|NP_180726.1|  RAB GTPase-like protein A5D                           126   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457681.1|  PREDICTED: ras-related protein RABA5e-like         126   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002881188.1|  hypothetical protein ARALYDRAFT_902201             126   3e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_009629633.1|  PREDICTED: ras-related protein RABA5a-like i...    125   3e-33   Nicotiana tomentosiformis
gb|KJB71848.1|  hypothetical protein B456_011G144500                    127   3e-33   Gossypium raimondii
ref|XP_010475301.1|  PREDICTED: ras-related protein RABA5e-like         126   3e-33   Camelina sativa [gold-of-pleasure]
gb|KFK31198.1|  hypothetical protein AALP_AA6G080900                    126   3e-33   Arabis alpina [alpine rockcress]
ref|XP_009372186.1|  PREDICTED: ras-related protein RABA5c-like         126   3e-33   
ref|XP_010485339.1|  PREDICTED: ras-related protein RABA5e isofor...    126   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010688595.1|  PREDICTED: ras-related protein RABA5a              126   3e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006305597.1|  hypothetical protein CARUB_v10010263mg             126   3e-33   Capsella rubella
ref|XP_002889568.1|  hypothetical protein ARALYDRAFT_887774             126   4e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_009385993.1|  PREDICTED: ras-related protein RABA5c-like         125   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008345798.1|  PREDICTED: ras-related protein RABA5a-like i...    125   4e-33   Malus domestica [apple tree]
gb|KHF97840.1|  Ras-related protein RABA5a                              126   4e-33   Gossypium arboreum [tree cotton]
ref|XP_009334262.1|  PREDICTED: ras-related protein RABA5c-like         125   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_006417985.1|  hypothetical protein EUTSA_v10008743mg             125   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_008463615.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    125   4e-33   Cucumis melo [Oriental melon]
ref|XP_010926653.1|  PREDICTED: ras-related protein RABA5e-like i...    126   4e-33   
gb|EPS70637.1|  hypothetical protein M569_04122                         125   4e-33   Genlisea aurea
ref|XP_008345797.1|  PREDICTED: ras-related protein RABA5a-like i...    125   5e-33   Malus domestica [apple tree]
ref|XP_009350510.1|  PREDICTED: ras-related protein RABA5a-like         125   5e-33   
ref|XP_010927595.1|  PREDICTED: ras-related protein RABA5c-like         125   5e-33   Elaeis guineensis
gb|EYU27682.1|  hypothetical protein MIMGU_mgv1a013213mg                125   5e-33   Erythranthe guttata [common monkey flower]
ref|XP_009629631.1|  PREDICTED: ras-related protein RABA5a-like i...    125   5e-33   Nicotiana tomentosiformis
ref|XP_002444720.1|  hypothetical protein SORBIDRAFT_07g026600          125   5e-33   Sorghum bicolor [broomcorn]
ref|XP_008384163.1|  PREDICTED: ras-related protein RABA5a isofor...    125   6e-33   
ref|XP_009144057.1|  PREDICTED: ras-related protein RABA5d              125   6e-33   Brassica rapa
ref|XP_009114272.1|  PREDICTED: ras-related protein RABA5a              125   6e-33   
gb|KJB27937.1|  hypothetical protein B456_005G017600                    125   6e-33   Gossypium raimondii
emb|CDY25963.1|  BnaC09g20240D                                          125   6e-33   Brassica napus [oilseed rape]
ref|XP_010057822.1|  PREDICTED: ras-related protein RABA5a-like         125   6e-33   Eucalyptus grandis [rose gum]
ref|XP_006449885.1|  hypothetical protein CICLE_v10017675mg             125   6e-33   Citrus clementina [clementine]
ref|XP_008384161.1|  PREDICTED: ras-related protein RABA5a isofor...    125   6e-33   
gb|ABD64936.1|  Ras-related GTP-binding protein, putative               125   7e-33   Brassica oleracea
gb|KHG12252.1|  Ras-related RABA5e -like protein                        125   7e-33   Gossypium arboreum [tree cotton]
gb|KJB69168.1|  hypothetical protein B456_011G009000                    125   7e-33   Gossypium raimondii
gb|ADE77345.1|  unknown                                                 125   7e-33   Picea sitchensis
emb|CAA98186.1|  RAB11J                                                 125   8e-33   Lotus japonicus
gb|KDP36442.1|  hypothetical protein JCGZ_09512                         125   8e-33   Jatropha curcas
ref|XP_004250277.1|  PREDICTED: ras-related protein RABA5a              125   8e-33   Solanum lycopersicum
ref|XP_009101412.1|  PREDICTED: ras-related protein RABA5a-like         125   8e-33   Brassica rapa
ref|XP_010510172.1|  PREDICTED: ras-related protein RABA5d-like         125   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010414098.1|  PREDICTED: ras-related protein RABA5d-like         125   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010494988.1|  PREDICTED: ras-related protein RABA5a-like         125   9e-33   Camelina sativa [gold-of-pleasure]
emb|CDY17945.1|  BnaC04g02740D                                          125   9e-33   Brassica napus [oilseed rape]
ref|XP_006398449.1|  hypothetical protein EUTSA_v10001017mg             125   9e-33   Eutrema salsugineum [saltwater cress]
ref|XP_007143969.1|  hypothetical protein PHAVU_007G117800g             125   9e-33   Phaseolus vulgaris [French bean]
gb|ACJ84485.1|  unknown                                                 125   9e-33   Medicago truncatula
ref|XP_006659598.1|  PREDICTED: ras-related protein RABA5c-like         125   9e-33   Oryza brachyantha
ref|XP_010469687.1|  PREDICTED: ras-related protein RABA5d              125   9e-33   Camelina sativa [gold-of-pleasure]
gb|ABD64975.1|  Ras family GTP-binding protein                          125   9e-33   Brassica oleracea
ref|XP_006365849.1|  PREDICTED: ras-related protein RABA5a-like i...    125   9e-33   
gb|EYU33848.1|  hypothetical protein MIMGU_mgv1a012931mg                125   9e-33   Erythranthe guttata [common monkey flower]
ref|XP_003536164.1|  PREDICTED: ras-related protein RABA5a-like i...    125   1e-32   Glycine max [soybeans]
ref|XP_009142914.1|  PREDICTED: ras-related protein RABA5c-like         124   1e-32   Brassica rapa
ref|XP_006352344.1|  PREDICTED: ras-related protein RABA5a-like i...    125   1e-32   Solanum tuberosum [potatoes]
ref|XP_004239823.1|  PREDICTED: ras-related protein RABA5a-like         125   1e-32   
ref|XP_006846832.1|  hypothetical protein AMTR_s00148p00100780          124   1e-32   
ref|XP_010441443.1|  PREDICTED: ras-related protein RABA5a              125   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009776623.1|  PREDICTED: ras-related protein RABA5a-like         125   1e-32   Nicotiana sylvestris
emb|CDX84764.1|  BnaA03g14660D                                          125   1e-32   
emb|CDY17729.1|  BnaA06g35480D                                          125   1e-32   Brassica napus [oilseed rape]
ref|NP_001242668.1|  uncharacterized protein LOC100789187               125   1e-32   
ref|XP_011086244.1|  PREDICTED: ras-related protein RABA5a-like i...    125   1e-32   Sesamum indicum [beniseed]
gb|AAA68983.1|  small GTP-binding protein                               125   1e-32   Brassica napus [oilseed rape]
ref|XP_009625286.1|  PREDICTED: ras-related protein RABA5a-like         125   1e-32   Nicotiana tomentosiformis
ref|XP_002528238.1|  protein with unknown function                      125   1e-32   Ricinus communis
ref|XP_002863339.1|  hypothetical protein ARALYDRAFT_494220             125   1e-32   
emb|CDX79430.1|  BnaC03g17660D                                          124   1e-32   
ref|NP_199563.1|  RAB GTPase homolog A5A                                124   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132810.1|  PREDICTED: ras-related protein RABA5d-like         124   1e-32   Brassica rapa
ref|XP_009775501.1|  PREDICTED: ras-related protein RABA5a-like         125   1e-32   Nicotiana sylvestris
ref|XP_006605347.1|  PREDICTED: uncharacterized protein LOC100789...    125   1e-32   Glycine max [soybeans]
ref|XP_002973313.1|  rab family GTPase                                  124   1e-32   Selaginella moellendorffii
ref|XP_010655425.1|  PREDICTED: ras-related protein RABA5a              124   2e-32   Vitis vinifera
ref|XP_002323139.1|  GTP-binding family protein                         124   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007026285.1|  RAB GTPase A5A isoform 1                           124   2e-32   Theobroma cacao [chocolate]
ref|XP_009402895.1|  PREDICTED: ras-related protein RABA5a-like         124   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007211991.1|  hypothetical protein PRUPE_ppa011035mg             124   2e-32   Prunus persica
ref|XP_010530048.1|  PREDICTED: ras-related protein RABA5a              124   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010052941.1|  PREDICTED: ras-related protein RABA5a-like         124   2e-32   Eucalyptus grandis [rose gum]
ref|NP_001152371.1|  ras-related protein ARA-4                          124   2e-32   Zea mays [maize]
ref|XP_009128976.1|  PREDICTED: ras-related protein RABA5a-like         124   2e-32   Brassica rapa
gb|ABD65003.1|  Ras-related GTP-binding protein, putative               124   3e-32   Brassica oleracea
ref|XP_007026286.1|  RAB GTPase A5A isoform 2                           124   3e-32   
ref|NP_001062290.1|  Os08g0525000                                       123   4e-32   
ref|XP_008792135.1|  PREDICTED: ras-related protein RABA5a-like         123   4e-32   Phoenix dactylifera
ref|XP_004293379.1|  PREDICTED: ras-related protein RABA5a              123   6e-32   Fragaria vesca subsp. vesca
gb|KJB67359.1|  hypothetical protein B456_010G188100                    123   7e-32   Gossypium raimondii
gb|AAD48018.1|  Rab GTP-binding protein Rab11a                          122   8e-32   Gossypium hirsutum [American cotton]
emb|CDY28925.1|  BnaA02g25510D                                          122   1e-31   Brassica napus [oilseed rape]
ref|XP_009388661.1|  PREDICTED: ras-related protein RABA5a-like         122   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557057.1|  PREDICTED: ras-related protein RABA5d-like         122   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_009383333.1|  PREDICTED: ras-related protein RABA5c-like         121   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001131951.1|  uncharacterized protein LOC100193344               121   2e-31   Zea mays [maize]
ref|XP_002961452.1|  rab family GTPase                                  121   2e-31   Selaginella moellendorffii
ref|XP_009358989.1|  PREDICTED: ras-related protein RABA5b              121   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_004958435.1|  PREDICTED: ras-related protein RABA5a-like         121   2e-31   Setaria italica
ref|XP_002971361.1|  rab family GTPase                                  121   2e-31   Selaginella moellendorffii
gb|KHN18294.1|  Ras-related protein RABA5d                              121   2e-31   Glycine soja [wild soybean]
ref|XP_010094689.1|  Ras-related protein RABA5a                         121   2e-31   Morus notabilis
gb|EPS57442.1|  hypothetical protein M569_17375                         121   3e-31   Genlisea aurea
gb|EEC83910.1|  hypothetical protein OsI_29960                          124   4e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001060379.1|  Os07g0634200                                       120   4e-31   
ref|XP_006658004.1|  PREDICTED: ras-related protein RABA5a-like         120   4e-31   Oryza brachyantha
ref|XP_002461085.1|  hypothetical protein SORBIDRAFT_02g040430          120   4e-31   Sorghum bicolor [broomcorn]
ref|XP_010914967.1|  PREDICTED: ras-related protein RABA5a-like         120   5e-31   
ref|XP_009399771.1|  PREDICTED: ras-related protein RABA5a-like         120   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ99159.1|  predicted protein                                      120   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002307897.1|  GTP-binding family protein                         120   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011004494.1|  PREDICTED: ras-related protein RABA5a-like         120   6e-31   Populus euphratica
gb|EAZ40784.1|  hypothetical protein OsJ_25262                          120   6e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAM62720.1|  putative RAS superfamily GTP-binding protein            120   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008785540.1|  PREDICTED: ras-related protein RABA5a-like         120   6e-31   Phoenix dactylifera
ref|XP_010925279.1|  PREDICTED: ras-related protein RABA5a-like         120   7e-31   Elaeis guineensis
ref|XP_003562615.1|  PREDICTED: ras-related protein RABA5a              120   7e-31   Brachypodium distachyon [annual false brome]
gb|EPS70121.1|  hypothetical protein M569_04642                         120   9e-31   Genlisea aurea
gb|EEE69027.1|  hypothetical protein OsJ_28001                          122   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ACY66377.1|  RAB11a member RAS oncogene family                       115   1e-30   Scylla paramamosain
gb|EMT24020.1|  Ras-related protein ARA-4                               121   2e-30   
gb|EPS61230.1|  hypothetical protein M569_13568                         119   2e-30   Genlisea aurea
gb|ESW96476.1|  GTP-binding protein YPT31/YPT8                          119   2e-30   Ogataea parapolymorpha DL-1
gb|EMS66232.1|  Ras-related protein RABA5a                              120   4e-30   Triticum urartu
ref|XP_011166964.1|  PREDICTED: ras-related protein Rab-11A             114   4e-30   
ref|XP_003644271.1|  hypothetical protein Ecym_1207                     118   4e-30   
ref|XP_004319903.1|  PREDICTED: ras-related protein Rab-11A             115   4e-30   
ref|NP_985289.2|  AER434Cp                                              118   4e-30   
gb|AAH78572.1|  Rab11b protein                                          114   4e-30   
ref|XP_002985624.1|  rab family GTPase                                  118   5e-30   
ref|XP_002974254.1|  rab family GTPase                                  118   5e-30   
ref|XP_006685076.1|  ras-domain-containing protein                      117   7e-30   
gb|AJC97118.1|  Rab11A                                                  117   7e-30   
ref|XP_007264419.1|  ras-domain-containing protein                      117   8e-30   
ref|XP_007764993.1|  GTPase                                             117   9e-30   
emb|CCO32670.1|  Ras-related protein Rab-11A                            113   9e-30   
ref|XP_002548852.1|  GTP-binding protein YPT32/YPT11                    117   9e-30   
ref|XP_006676182.1|  hypothetical protein BATDEDRAFT_85182              117   1e-29   
ref|XP_003869190.1|  Ypt31 protein                                      117   1e-29   
emb|CDK28119.1|  unnamed protein product                                117   1e-29   
ref|XP_002619207.1|  hypothetical protein CLUG_00366                    117   1e-29   
emb|CCE42558.1|  hypothetical protein CPAR2_202010                      117   1e-29   
ref|XP_004204534.1|  Piso0_000385                                       117   1e-29   
gb|KHN78062.1|  Ras-related protein Rab-11A                             117   1e-29   
ref|XP_002424012.1|  GTP-binding nuclear protein RAN1, putative         114   1e-29   
ref|XP_002422260.1|  GTP-binding protein, putative; Rab GTPase, p...    117   1e-29   
ref|XP_010232115.1|  PREDICTED: ras-related protein RABA1f-like         117   1e-29   
ref|XP_457123.1|  DEHA2B03696p                                          117   1e-29   
ref|XP_011277523.1|  GTP-binding protein YPT31/YPT8                     116   1e-29   
ref|XP_001385567.1|  hypothetical protein PICST_68134                   116   1e-29   
gb|EJU05816.1|  ras-domain-containing protein                           116   1e-29   
ref|XP_710395.1|  likely rab family GTP-binding protein                 116   2e-29   
gb|KIJ63275.1|  hypothetical protein HYDPIDRAFT_134345                  116   2e-29   
gb|KIY48279.1|  GTPase                                                  115   2e-29   
ref|XP_007373614.1|  GTP-binding protein YPT32/YPT11                    116   2e-29   
gb|ADT91500.1|  small monomeric GTPase                                  115   2e-29   
ref|XP_002102629.1|  GD19397                                            116   2e-29   
ref|XP_001525401.1|  GTP-binding protein YPT32/YPT11                    116   2e-29   
ref|XP_001238828.3|  AGAP004559-PA                                      116   2e-29   
ref|XP_011210245.1|  PREDICTED: ras-related protein Rab-11A isofo...    116   2e-29   
gb|ACL68712.1|  FI09227p                                                116   2e-29   
ref|XP_001845712.1|  conserved hypothetical protein                     116   2e-29   
ref|XP_001659918.1|  AAEL009317-PA                                      116   2e-29   
ref|XP_004535602.1|  PREDICTED: ras-related protein Rab-11A-like ...    116   2e-29   
ref|NP_477170.1|  Rab11, isoform B                                      116   2e-29   
emb|CDQ75634.1|  unnamed protein product                                112   2e-29   
gb|KDQ18553.1|  hypothetical protein BOTBODRAFT_28943                   116   2e-29   
ref|XP_005178336.1|  PREDICTED: ras-related protein Rab-11A             116   2e-29   
gb|EDL10205.1|  mCG22989, isoform CRA_a                                 114   2e-29   
gb|AAD48019.1|  Rab GTP-binding protein Rab11b                          116   2e-29   
ref|XP_002073567.1|  GK14185                                            116   2e-29   
ref|XP_004276262.1|  PREDICTED: ras-related protein Rab-11A isofo...    114   2e-29   
ref|XP_010793484.1|  PREDICTED: ras-related protein Rab-11A             115   2e-29   
ref|NP_001193765.1|  ras-related protein Rab-11A isoform 2              114   2e-29   
gb|EIF47306.1|  gtp-binding protein ypt32 ypt11                         116   3e-29   
ref|XP_003035463.1|  GTPase                                             115   3e-29   
ref|XP_004651650.1|  PREDICTED: ras-related protein Rab-11B-like ...    114   3e-29   
gb|EYC40167.1|  hypothetical protein Y032_0626g825                      115   3e-29   
ref|XP_004086096.1|  PREDICTED: ras-related protein Rab-11A             115   3e-29   
ref|XP_010641615.1|  PREDICTED: ras-related protein Rab-11A             115   3e-29   
ref|XP_010896300.1|  PREDICTED: ras-related protein Rab-11A             115   3e-29   
ref|XP_004056410.1|  PREDICTED: ras-related protein Rab-11A isofo...    115   3e-29   
ref|XP_004969476.1|  PREDICTED: ras-related protein RABA1f-like         115   3e-29   
ref|XP_011448390.1|  PREDICTED: ras-related protein Rab-11B             114   3e-29   
ref|XP_007873896.1|  hypothetical protein PNEG_01920                    115   3e-29   
gb|KIM87425.1|  hypothetical protein PILCRDRAFT_814947                  115   3e-29   
pdb|1YZK|A  Chain A, Gppnhp Bound Rab11 Gtpase                          115   3e-29   
ref|XP_008584176.1|  PREDICTED: ras-related protein Rab-11A isofo...    115   3e-29   
gb|EMT13816.1|  Ras-related protein Rab11B                              115   3e-29   
pdb|4C4P|A  Chain A, Crystal Structure Of Wild-type Rab11 Complex...    114   3e-29   
ref|XP_003458518.1|  PREDICTED: ras-related protein Rab-11A-like        115   3e-29   
pdb|4LWZ|A  Chain A, Crystal Structure Of Myo5b Globular Tail Dom...    114   3e-29   
ref|XP_010865296.1|  PREDICTED: ras-related protein Rab-11A             115   3e-29   
ref|NP_001007360.1|  ras-related protein Rab-11A                        115   3e-29   
ref|XP_005989918.1|  PREDICTED: ras-related protein Rab-11B             114   3e-29   
ref|XP_008308552.1|  PREDICTED: ras-related protein Rab-11A             115   3e-29   
ref|XP_005531421.1|  PREDICTED: ras-related protein Rab-11B isofo...    114   3e-29   
ref|XP_001839906.1|  GTPase                                             115   3e-29   
gb|KIK03969.1|  hypothetical protein K443DRAFT_676291                   115   3e-29   
ref|XP_001878474.1|  predicted protein                                  115   3e-29   
ref|XP_007385105.1|  ras-domain-containing protein                      115   4e-29   
ref|XP_005990165.1|  PREDICTED: ras-related protein Rab-11A             115   4e-29   
gb|EDK40024.2|  hypothetical protein PGUG_04122                         115   4e-29   
gb|KIK54472.1|  hypothetical protein GYMLUDRAFT_48615                   115   4e-29   
ref|XP_008985390.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    114   4e-29   
ref|XP_006458621.1|  hypothetical protein AGABI2DRAFT_134329            115   4e-29   
gb|ADD24151.1|  Ras-related protein Rab-11A                             115   4e-29   
ref|NP_001016481.1|  RAB11A, member RAS oncogene family                 115   4e-29   
ref|XP_005305427.1|  PREDICTED: ras-related protein Rab-11A             115   4e-29   
ref|NP_001005827.1|  ras-related protein Rab-11A                        115   4e-29   
pdb|1OIV|A  Chain A, X-Ray Structure Of The Small G Protein Rab11...    114   4e-29   
gb|ABX10878.1|  RAB11B                                                  115   4e-29   
gb|KIK37006.1|  hypothetical protein CY34DRAFT_810782                   115   4e-29   
ref|XP_007112158.1|  PREDICTED: ras-related protein Rab-11A-like        115   4e-29   
ref|XP_004886673.1|  PREDICTED: ras-related protein Rab-11B isofo...    116   4e-29   
ref|NP_004654.1|  ras-related protein Rab-11A isoform 1                 115   4e-29   
ref|XP_008119051.1|  PREDICTED: ras-related protein Rab-11A             115   4e-29   
ref|XP_010570389.1|  PREDICTED: ras-related protein Rab-11A isofo...    114   4e-29   
gb|KDR81965.1|  hypothetical protein GALMADRAFT_240321                  115   5e-29   
gb|KII89317.1|  hypothetical protein PLICRDRAFT_40975                   115   5e-29   
gb|AAP36283.1|  Homo sapiens RAB11A, member RAS oncogene family         115   5e-29   
gb|EFX80521.1|  hypothetical protein DAPPUDRAFT_304112                  115   5e-29   
pdb|4OJK|A  Chain A, Structure Of The Cgmp Dependent Protein Kina...    115   5e-29   
ref|XP_007337581.1|  ras-domain-containing protein                      115   5e-29   
ref|XP_004711990.1|  PREDICTED: ras-related protein Rab-11A             115   5e-29   
gb|ACO12107.1|  Ras-related protein Rab-11B                             115   5e-29   
ref|XP_007489530.1|  PREDICTED: ras-related protein Rab-11B isofo...    114   5e-29   
gb|EMD34366.1|  hypothetical protein CERSUDRAFT_117145                  115   5e-29   
gb|ELU17603.1|  hypothetical protein CAPTEDRAFT_226009                  115   5e-29   
ref|XP_010570388.1|  PREDICTED: ras-related protein Rab-11A isofo...    114   5e-29   
ref|NP_001033251.1|  ras-related protein Rab-11A                        115   5e-29   
gb|KIM49681.1|  hypothetical protein M413DRAFT_114111                   115   5e-29   
gb|AAF36458.1|AF127669_1  small GTPase                                  115   5e-29   
ref|XP_004348926.1|  Ras-like protein Rab-11B                           115   5e-29   
ref|XP_007843868.1|  gtp-binding protein ypt3                           115   5e-29   
gb|AAP48704.1|  rab11-2                                                 115   5e-29   
dbj|BAG59912.1|  unnamed protein product                                114   5e-29   
ref|XP_008291589.1|  PREDICTED: ras-related protein Rab-11A             115   5e-29   
ref|XP_002108851.1|  conserved hypothetical protein                     115   5e-29   
ref|XP_002605587.1|  hypothetical protein BRAFLDRAFT_266781             115   5e-29   
gb|AFR95462.1|  GTP-binding protein ypt3                                115   6e-29   
dbj|BAG59943.1|  unnamed protein product                                116   6e-29   
ref|XP_007906492.1|  PREDICTED: ras-related protein Rab-11B             115   6e-29   
sp|P22129.1|RB11B_DIPOM  RecName: Full=Ras-related protein Rab-11...    115   6e-29   
ref|XP_010754800.1|  PREDICTED: ras-related protein Rab-11B-like        115   6e-29   
ref|XP_001607057.1|  PREDICTED: ras-related protein Rab-11A             115   6e-29   
ref|XP_002490661.1|  GTPase of the Ypt/Rab family, very similar t...    115   6e-29   
ref|XP_003702539.1|  PREDICTED: ras-related protein Rab-11A-like        115   6e-29   
gb|EJT45277.1|  hypothetical protein A1Q1_06346                         115   6e-29   
ref|NP_001011048.1|  RAB11B, member RAS oncogene family, gene 1         115   6e-29   
ref|XP_005959054.1|  PREDICTED: ras-related protein Rab-11B             114   6e-29   
ref|NP_001004880.1|  RAB11B, member RAS oncogene family, gene 2         115   6e-29   
ref|XP_007537298.1|  PREDICTED: ras-related protein Rab-11B             115   6e-29   
ref|XP_005081376.1|  PREDICTED: ras-related protein Rab-11B             115   6e-29   
ref|XP_004443827.1|  PREDICTED: ras-related protein Rab-11B             115   6e-29   
emb|CAG46492.1|  RAB11B                                                 115   6e-29   
ref|XP_007002577.1|  hypothetical protein TREMEDRAFT_42942              115   6e-29   
ref|NP_001088852.1|  RAB11B, member RAS oncogene family, gene 2         115   6e-29   
ref|XP_003439919.1|  PREDICTED: ras-related protein Rab-11B-like        115   6e-29   
gb|ABQ59034.1|  RAB11B protein                                          115   6e-29   
gb|ACL98126.1|  RAB11B protein                                          115   6e-29   
gb|ABX10876.1|  RAB11B                                                  115   6e-29   
emb|CDQ81937.1|  unnamed protein product                                115   6e-29   
emb|CAG04850.1|  unnamed protein product                                115   6e-29   
ref|XP_004689470.1|  PREDICTED: ras-related protein Rab-11B             115   6e-29   
ref|NP_116006.1|  ras-related protein Rab-11B                           115   6e-29   
ref|XP_003981831.1|  PREDICTED: ras-related protein Rab-11B             115   6e-29   
ref|XP_004886674.1|  PREDICTED: ras-related protein Rab-11B isofo...    115   6e-29   
gb|EQB78349.1|  ras-related protein Rab-11B                             115   6e-29   
gb|ABB45709.1|  Ras-related protein RAB11A                              114   6e-29   
ref|XP_003403153.1|  PREDICTED: ras-related protein Rab-11A-like        115   6e-29   
ref|XP_775464.1|  hypothetical protein CNBE1790                         114   7e-29   
ref|XP_006628795.1|  PREDICTED: ras-related protein Rab-11A-like        115   7e-29   
ref|XP_007576797.1|  PREDICTED: ras-related protein Rab-11B-like        115   7e-29   
ref|XP_004554927.1|  PREDICTED: ras-related protein Rab-11B-like        115   7e-29   
ref|XP_004068250.1|  PREDICTED: ras-related protein Rab-11B             115   7e-29   
emb|CAG38733.1|  RAB11B                                                 115   7e-29   
ref|XP_003974065.1|  PREDICTED: ras-related protein Rab-11B-like        115   7e-29   
ref|NP_001012569.1|  ras-related protein Rab-11B                        115   7e-29   
emb|CCA71622.1|  probable GTP-binding protein Rab11                     116   7e-29   
ref|XP_003692576.1|  PREDICTED: ras-related protein Rab-11A-like        115   7e-29   
ref|XP_010869861.1|  PREDICTED: ras-related protein Rab-11B-like        115   7e-29   
ref|NP_033023.1|  ras-related protein Rab-11B                           115   7e-29   
dbj|BAA22522.1|  GTP binding protein                                    115   7e-29   
ref|XP_004595766.1|  PREDICTED: ras-related protein Rab-11B             115   7e-29   
ref|NP_001080132.1|  RAB11B, member RAS oncogene family, gene 1         115   7e-29   
gb|AAP51289.1|  Rab11-1c                                                115   7e-29   
gb|ACO14203.1|  Ras-related protein YPTC6                               112   7e-29   
ref|XP_011135199.1|  PREDICTED: ras-related protein Rab-11A isofo...    115   7e-29   
gb|AAP51290.1|  Rab11-1a                                                115   7e-29   
ref|XP_011352649.1|  PREDICTED: ras-related protein Rab-11A             114   7e-29   
ref|XP_006809455.1|  PREDICTED: ras-related protein Rab-11B-like        115   7e-29   
gb|ELR60022.1|  Ras-related protein Rab-11B                             115   7e-29   
ref|XP_008548181.1|  PREDICTED: ras-related protein Rab-11A             114   7e-29   
ref|XP_008298255.1|  PREDICTED: ras-related protein Rab-11B-like        115   7e-29   
ref|XP_001625271.1|  predicted protein                                  115   7e-29   
ref|XP_004997338.1|  tubulovesicle-associated protein                   114   7e-29   
gb|EMG50091.1|  GTP-binding protein YPT32/YPT11                         115   7e-29   
gb|KDE05872.1|  Ras-like protein Rab-11B                                114   7e-29   
gb|AAX37062.1|  RAB11B member RAS oncogene family                       115   7e-29   
gb|EDL33304.1|  mCG14915, isoform CRA_b                                 114   7e-29   
ref|XP_011252001.1|  PREDICTED: ras-related protein Rab-11A             114   7e-29   
gb|AAV38342.1|  RAB11B, member RAS oncogene family                      114   7e-29   
gb|AAT01087.1|  putative rab11                                          114   8e-29   
ref|XP_007252710.1|  PREDICTED: ras-related protein Rab-11B             114   8e-29   
gb|ADO28731.1|  ras-related protein rab-11b                             114   8e-29   
gb|ABA41006.1|  Rab11 protein                                           114   8e-29   
ref|XP_008305490.1|  PREDICTED: ras-related protein Rab-11B-like        114   8e-29   
ref|XP_005843019.1|  hypothetical protein CHLNCDRAFT_33302              114   8e-29   
gb|KJB48191.1|  hypothetical protein B456_008G056300                    112   8e-29   
ref|XP_005612031.1|  PREDICTED: ras-related protein Rab-11B             114   8e-29   
ref|XP_011050340.1|  PREDICTED: ras-related protein Rab-11A             114   8e-29   
gb|KDR19906.1|  Ras-related protein Rab-11A                             114   8e-29   
ref|NP_001133884.1|  Ras-related protein Rab-11B                        114   8e-29   
gb|KJA21071.1|  hypothetical protein HYPSUDRAFT_42448                   114   8e-29   
ref|XP_005795637.1|  PREDICTED: ras-related protein Rab-11B-like        114   9e-29   
gb|AGM32466.1|  Ras-related protein Rab-11A                             114   9e-29   
gb|EZA60274.1|  Ras-related protein Rab-11A                             115   9e-29   
ref|XP_010148156.1|  PREDICTED: ras-related protein Rab-11A-like        112   9e-29   
ref|XP_005830706.1|  hypothetical protein GUITHDRAFT_159767             114   1e-28   
ref|XP_010555372.1|  PREDICTED: ras-related protein RABA4b              114   1e-28   
emb|CDJ89109.1|  unnamed protein product                                115   1e-28   
ref|XP_003324018.2|  GTP-binding protein ypt3                           114   1e-28   
gb|KIK94401.1|  hypothetical protein PAXRUDRAFT_828033                  114   1e-28   
ref|XP_004172276.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    114   1e-28   
emb|CAX70140.1|  Rab-protein 11                                         114   1e-28   
gb|KIO07819.1|  hypothetical protein M404DRAFT_997960                   114   1e-28   
ref|XP_004149604.1|  PREDICTED: ras-related protein RABA4c-like         114   1e-28   
ref|XP_001643080.1|  hypothetical protein Kpol_423p12                   114   1e-28   
ref|XP_006660497.1|  PREDICTED: ras-related protein RGP1-like           114   1e-28   
gb|EZA45322.1|  ras-related protein Rab-11A-like protein                115   1e-28   
emb|CCD60260.1|  rab11, putative                                        114   1e-28   
ref|XP_009394820.1|  PREDICTED: ras-related protein Rab11B-like         114   1e-28   
gb|AFK11003.1|  ras-related protein Rab-11A isoform 1                   114   1e-28   
emb|CAX70139.1|  Rab-protein 11                                         114   1e-28   
emb|CDS03371.1|  Putative Ras-like protein Rab-11A                      114   1e-28   
gb|AAN71540.1|  RH21315p                                                114   1e-28   
ref|XP_008924281.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    113   1e-28   
ref|XP_445283.1|  hypothetical protein                                  114   1e-28   
ref|XP_008461787.1|  PREDICTED: ras-related protein RABA4c              114   1e-28   
gb|EMT23732.1|  Ras-related protein RGP1                                114   1e-28   
ref|XP_010745629.1|  PREDICTED: ras-related protein Rab-11A-like        114   1e-28   
gb|KDQ59668.1|  hypothetical protein JAAARDRAFT_33237                   114   1e-28   
emb|CEL54495.1|  Ras-related protein Rab-11A OS=Sus scrofa GN=RAB...    114   1e-28   
emb|CDH57481.1|  gtp-binding protein ypt3                               114   1e-28   
ref|XP_008286906.1|  PREDICTED: ras-related protein Rab-11A-like        114   1e-28   



>emb|CDP03946.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   143 bits (360),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKE+KAQVWDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEIKAQVWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_009611217.1| PREDICTED: ras-related protein RABA5b [Nicotiana tomentosiformis]
Length=213

 Score =   143 bits (360),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEIKAQVWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_004247033.1| PREDICTED: ras-related protein RABA5b-like [Solanum lycopersicum]
Length=210

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKE+KAQVWDTAG
Sbjct  7    YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEIKAQVWDTAG  66

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  67   QERFRAVTSA  76



>ref|XP_009767908.1| PREDICTED: ras-related protein RABA5b-like [Nicotiana sylvestris]
Length=213

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEIDGKEIKAQVWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_009762686.1| PREDICTED: ras-related protein RABA5b-like [Nicotiana sylvestris]
Length=213

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEIDGKEIKAQVWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_011089627.1| PREDICTED: ras-related protein RABA5b-like [Sesamum indicum]
Length=214

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKEVKAQVWDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVELDGKEVKAQVWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>gb|EYU39173.1| hypothetical protein MIMGU_mgv1a013470mg [Erythranthe guttata]
Length=219

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKEVKAQVWDTAG
Sbjct  13   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVELDGKEVKAQVWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|EYU40652.1| hypothetical protein MIMGU_mgv1a013587mg [Erythranthe guttata]
Length=216

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQV+E+DGKEVKAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVLELDGKEVKAQVWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_011089021.1| PREDICTED: ras-related protein RABA5b [Sesamum indicum]
Length=216

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVV++DGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVDLDGKEIKAQVWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>gb|EPS67330.1| hypothetical protein M569_07446, partial [Genlisea aurea]
Length=201

 Score =   137 bits (346),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFDH+SKATIGVEFQTQVV+VDG+EVKAQVWDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRFARDEFDHHSKATIGVEFQTQVVQVDGREVKAQVWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_007049622.1| RAB GTPase A5B [Theobroma cacao]
 gb|EOX93779.1| RAB GTPase A5B [Theobroma cacao]
Length=217

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007140715.1| hypothetical protein PHAVU_008G135600g [Phaseolus vulgaris]
 gb|ESW12709.1| hypothetical protein PHAVU_008G135600g [Phaseolus vulgaris]
Length=213

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|ABC68436.1| putative small GTP-binding protein [Tragopogon pratensis]
 gb|ADD64893.1| Rab GTPase-like protein [Tragopogon porrifolius]
 gb|ADE06482.1| putative small GTP-binding protein [Tragopogon porrifolius]
Length=105

 Score =   133 bits (335),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFD +SKATIGVEFQTQVV++DGKEVKAQVWDTAG
Sbjct  19   YLFKIVVIGDSAVGKSNLLSRFARDEFDLHSKATIGVEFQTQVVDIDGKEVKAQVWDTAG  78

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  79   QERFRAVTSA  88



>gb|ABC68435.1| putative small GTP-binding protein [Tragopogon dubius]
Length=104

 Score =   133 bits (334),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFARDEFD +SKATIGVEFQTQVV++DGKEVKAQVWDTAG
Sbjct  18   YLFKIVVIGDSAVGKSNLLSRFARDEFDLHSKATIGVEFQTQVVDIDGKEVKAQVWDTAG  77

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  78   QERFRAVTSA  87



>gb|KJB84096.1| hypothetical protein B456_N003900 [Gossypium raimondii]
Length=217

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_004149322.1| PREDICTED: ras-related protein RABA5e-like [Cucumis sativus]
 ref|XP_004163075.1| PREDICTED: ras-related protein RABA5e-like [Cucumis sativus]
 gb|KGN44658.1| RAB11G [Cucumis sativus]
Length=215

 Score =   136 bits (342),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_008458081.1| PREDICTED: ras-related protein RABA5b [Cucumis melo]
Length=216

 Score =   136 bits (342),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_003622764.1| Ras-related protein ARA-1 [Medicago truncatula]
 gb|AES78982.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=215

 Score =   135 bits (341),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ+VE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQMVEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_004492211.1| PREDICTED: ras-related protein RABA5b-like [Cicer arietinum]
Length=215

 Score =   135 bits (340),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ+VE+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQMVEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_002303077.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEE82350.1| GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   135 bits (340),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKE+KAQ+WDTAG
Sbjct  14   YLFKIVVIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEIKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>ref|XP_004290147.1| PREDICTED: ras-related protein RABA5b [Fragaria vesca subsp. 
vesca]
Length=213

 Score =   135 bits (340),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVLIGDSAVGKSNLLSRFARNEFDQNSKATIGVEFQTQAVEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_010100807.1| Ras-related protein RABA5c [Morus notabilis]
 gb|EXB84505.1| Ras-related protein RABA5c [Morus notabilis]
Length=212

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVLIGDSAVGKSNLLSRFARNEFDQNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|NP_001240985.1| ras-related protein RABA5b-like [Glycine max]
 gb|AEO14876.1| rfls8 protein [Glycine max]
 gb|KHN10937.1| Ras-related protein RABA5b [Glycine soja]
Length=213

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ+VE+DGKE+KAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQLVEIDGKEIKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_006484821.1| PREDICTED: ras-related protein RABA5b-like [Citrus sinensis]
Length=220

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KJB10858.1| hypothetical protein B456_001G229200, partial [Gossypium raimondii]
 gb|KJB10859.1| hypothetical protein B456_001G229200, partial [Gossypium raimondii]
Length=285

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  81   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQCVEIDGKEVKAQIWDTAG  140

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  141  QERFRAVTSA  150



>gb|KDO60895.1| hypothetical protein CISIN_1g027703mg [Citrus sinensis]
Length=220

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_006437222.1| hypothetical protein CICLE_v10032706mg [Citrus clementina]
 gb|ESR50462.1| hypothetical protein CICLE_v10032706mg [Citrus clementina]
Length=220

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>dbj|BAA02108.1| GTP-binding protein [Pisum sativum]
 prf||2001457A GTP-binding protein
Length=215

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQTVEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|KDP45261.1| hypothetical protein JCGZ_15126 [Jatropha curcas]
Length=215

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|ABK21873.1| unknown [Picea sitchensis]
Length=210

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQV+E+DGKEVKAQ+WDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQVMEIDGKEVKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_009124351.1| PREDICTED: ras-related protein RABA5b [Brassica rapa]
Length=213

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_011024576.1| PREDICTED: ras-related protein RABA5e-like [Populus euphratica]
Length=218

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV+++GKE+KAQ+WDTAG
Sbjct  14   YLFKIVVIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIEGKEIKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>ref|XP_010486290.1| PREDICTED: ras-related protein RABA5b isoform X3 [Camelina sativa]
Length=210

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|AFK35472.1| unknown [Medicago truncatula]
Length=215

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVE QTQ+VE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVELQTQMVEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_010451632.1| PREDICTED: ras-related protein RABA5b-like isoform X2 [Camelina 
sativa]
Length=210

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_006407840.1| hypothetical protein EUTSA_v10021494mg [Eutrema salsugineum]
 gb|ESQ49293.1| hypothetical protein EUTSA_v10021494mg [Eutrema salsugineum]
Length=217

 Score =   133 bits (334),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|KFK38199.1| hypothetical protein AALP_AA3G082000 [Arabis alpina]
Length=217

 Score =   133 bits (334),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010451591.1| PREDICTED: ras-related protein RABA5b-like isoform X1 [Camelina 
sativa]
Length=217

 Score =   132 bits (333),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_002884647.1| hypothetical protein ARALYDRAFT_896904 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60906.1| hypothetical protein ARALYDRAFT_896904 [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   132 bits (333),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010486288.1| PREDICTED: ras-related protein RABA5b isoform X1 [Camelina sativa]
 ref|XP_010486289.1| PREDICTED: ras-related protein RABA5b isoform X2 [Camelina sativa]
Length=217

 Score =   132 bits (333),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010069602.1| PREDICTED: ras-related protein RABA5b [Eucalyptus grandis]
 gb|KCW58002.1| hypothetical protein EUGRSUZ_H00732 [Eucalyptus grandis]
Length=215

 Score =   132 bits (333),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFA DEFD N+KATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVLIGDSAVGKSNLLSRFALDEFDINTKATIGVEFQTQVVEIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|NP_187397.1| RAB GTPase-like protein A5B [Arabidopsis thaliana]
 sp|Q9SRS5.1|RAA5B_ARATH RecName: Full=Ras-related protein RABA5b; Short=AtRABA5b [Arabidopsis 
thaliana]
 gb|AAF02165.1|AC009853_25 putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAL62436.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAN72184.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AEE74539.1| RAB GTPase-like protein A5B [Arabidopsis thaliana]
Length=217

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_006298457.1| hypothetical protein CARUB_v10014528mg, partial [Capsella rubella]
 gb|EOA31355.1| hypothetical protein CARUB_v10014528mg, partial [Capsella rubella]
Length=235

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  29   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  88

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  89   QERFRAVTSA  98



>ref|XP_010464360.1| PREDICTED: ras-related protein RABA5b-like [Camelina sativa]
Length=261

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  55   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  114

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  115  QERFRAVTSA  124



>ref|XP_010666947.1| PREDICTED: ras-related protein RABA5e [Beta vulgaris subsp. vulgaris]
Length=216

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSRFAR+EFDHN+KATIGVEFQT  VE++GKE+K+Q+WDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARNEFDHNTKATIGVEFQTVCVEINGKEIKSQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_010524651.1| PREDICTED: ras-related protein RABA5b [Tarenaya hassleriana]
Length=215

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  14   YLFKIVLIGDSAVGKSNLLTRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>ref|XP_002533058.1| protein with unknown function [Ricinus communis]
 gb|EEF29328.1| protein with unknown function [Ricinus communis]
Length=218

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFAR+EFD NSKATIGVEFQTQVV+++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARNEFDSNSKATIGVEFQTQVVDIEGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007033995.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
 gb|EOY04921.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
Length=211

 Score =   131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010909337.1| PREDICTED: ras-related protein RABA5e-like [Elaeis guineensis]
Length=215

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ NSKATIGVEFQTQ V++DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARDEFNINSKATIGVEFQTQSVDIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_007033994.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
 gb|EOY04920.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
Length=217

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_001783000.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ52199.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=215

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNSNSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|KDO50521.1| hypothetical protein CISIN_1g0404812mg, partial [Citrus sinensis]
Length=115

 Score =   127 bits (320),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  15   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  74

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  75   QERFRAVTSA  84



>ref|XP_010650400.1| PREDICTED: ras-related protein RABA5c-like [Vitis vinifera]
 emb|CAN66526.1| hypothetical protein VITISV_043978 [Vitis vinifera]
Length=215

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYARNEFNINSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_002263362.1| PREDICTED: ras-related protein RABA5e [Vitis vinifera]
 emb|CAN69655.1| hypothetical protein VITISV_000615 [Vitis vinifera]
 emb|CBI18743.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EFD +SKATIGVEFQTQ V++DGKEVKAQ+WDTAG
Sbjct  8    YLFKIVIIGDSAVGKSNLLSRYARNEFDLHSKATIGVEFQTQCVDIDGKEVKAQIWDTAG  67

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  68   QERFRAVTSA  77



>ref|XP_010069409.1| PREDICTED: ras-related protein RABA5e-like [Eucalyptus grandis]
 gb|KCW57748.1| hypothetical protein EUGRSUZ_H00498 [Eucalyptus grandis]
Length=220

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V++GDSAVGKSNLLSR+AR EFDH SKAT+GVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  15   YLFKIVIVGDSAVGKSNLLSRYARGEFDHASKATVGVEFQTQCLEIDGKEVKAQIWDTAG  74

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  75   QERFRAVTSA  84



>gb|KJB28020.1| hypothetical protein B456_005G022300 [Gossypium raimondii]
Length=209

 Score =   130 bits (326),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EF+ +SKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRFARNEFNAHSKATIGVEFQTQSVEIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>gb|KJB28019.1| hypothetical protein B456_005G022300 [Gossypium raimondii]
Length=215

 Score =   130 bits (326),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EF+ +SKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRFARNEFNAHSKATIGVEFQTQSVEIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>gb|KHG13174.1| Ras-related RABA5d -like protein [Gossypium arboreum]
Length=215

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFAR+EF+ +SKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRFARNEFNAHSKATIGVEFQTQSVEIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_001772977.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ62202.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=215

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKE+KAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNSNSKATIGVEFQTQSMEIDGKELKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_001780193.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ54952.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=216

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKE+KAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNLNSKATIGVEFQTQSMEIDGKEIKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010241769.1| PREDICTED: ras-related protein RABA5c [Nelumbo nucifera]
Length=216

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYARNEFNMNSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_009619604.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana tomentosiformis]
 ref|XP_009765591.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana sylvestris]
Length=216

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQV+E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARDEFNLHSKATIGVEFQTQVLEINGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_008779666.1| PREDICTED: ras-related protein RABA5d-like [Phoenix dactylifera]
Length=132

 Score =   127 bits (319),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQTLDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_004248020.1| PREDICTED: ras-related protein RABA5c-like [Solanum lycopersicum]
Length=216

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQV+E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARDEFNLHSKATIGVEFQTQVLEINGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|AGZ15280.1| putative RAB11G, partial [Taraxacum brevicorniculatum]
Length=217

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKVVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQTMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_006856830.1| hypothetical protein AMTR_s00055p00167390 [Amborella trichopoda]
 gb|ERN18297.1| hypothetical protein AMTR_s00055p00167390 [Amborella trichopoda]
Length=214

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQSMEINGKEVKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_002301639.2| hypothetical protein POPTR_0002s23270g, partial [Populus trichocarpa]
 gb|EEE80912.2| hypothetical protein POPTR_0002s23270g, partial [Populus trichocarpa]
Length=111

 Score =   126 bits (317),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_006358795.1| PREDICTED: ras-related protein RABA5b-like [Solanum tuberosum]
Length=216

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQV+E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARDEFNLHSKATIGVEFQTQVLEINGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_008811658.1| PREDICTED: ras-related protein RABA5e [Phoenix dactylifera]
Length=215

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ V++DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARNEFNINSKATIGVEFQTQSVDIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_006478881.1| PREDICTED: ras-related protein RABA5c-like [Citrus sinensis]
Length=222

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  15   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  74

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  75   QERFRAVTSA  84



>ref|XP_010999992.1| PREDICTED: ras-related protein RABA5d-like [Populus euphratica]
Length=217

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQTMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>emb|CDP10336.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSLEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_008453919.1| PREDICTED: ras-related protein RABA5d [Cucumis melo]
Length=217

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQV+++DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQVMDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_006410298.1| hypothetical protein EUTSA_v10017221mg [Eutrema salsugineum]
 gb|ESQ51751.1| hypothetical protein EUTSA_v10017221mg [Eutrema salsugineum]
Length=219

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSIEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_004152077.1| PREDICTED: ras-related protein RABA5d-like [Cucumis sativus]
 ref|XP_004161590.1| PREDICTED: ras-related protein RABA5d-like [Cucumis sativus]
 gb|KGN53130.1| hypothetical protein Csa_4G017180 [Cucumis sativus]
Length=217

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQV+++DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQVMDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>gb|EYU32725.1| hypothetical protein MIMGU_mgv1a013434mg [Erythranthe guttata]
Length=220

 Score =   129 bits (323),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFSMHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>gb|AAL36203.1| putative RAS-related protein ARA-1 [Arabidopsis thaliana]
Length=218

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>sp|P19892.1|RAA5E_ARATH RecName: Full=Ras-related protein RABA5e; Short=AtRABA5e; AltName: 
Full=Ras-related protein Ara-1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF29387.1|AC009999_7 Strong similarity to a RAS-related protein ARA-1 from Arabidopsis 
thaliana gi|114085, and is a member of the RAS PF|00071 
family. EST gb|D01026 comes from this gene [Arabidopsis thaliana]
 gb|AAG48820.1|AF332457_1 putative RAS-related protein ARA-1 [Arabidopsis thaliana]
 gb|AAC13655.1| ras-related protein [Arabidopsis thaliana]
Length=218

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009383827.1| PREDICTED: ras-related protein RABA5c-like [Musa acuminata subsp. 
malaccensis]
Length=216

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ V+VDGKEVKAQ+WDTAG
Sbjct  11   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSVDVDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009339876.1| PREDICTED: ras-related protein RABA5e [Pyrus x bretschneideri]
Length=220

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>emb|CDP10276.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSIEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_011073833.1| PREDICTED: ras-related protein RABA5c [Sesamum indicum]
Length=219

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQSLEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_009118574.1| PREDICTED: ras-related protein RABA5e [Brassica rapa]
Length=218

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_008380689.1| PREDICTED: ras-related protein RABA5e [Malus domestica]
Length=220

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_002321111.1| Ras-related protein ARA-4 [Populus trichocarpa]
 gb|EEE99426.1| Ras-related protein ARA-4 [Populus trichocarpa]
Length=217

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>emb|CDY06181.1| BnaA09g50220D [Brassica napus]
Length=243

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  36   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  95

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  96   QERFRAVTSA  105



>ref|XP_008222663.1| PREDICTED: ras-related protein RABA5e [Prunus mume]
Length=220

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_004296709.1| PREDICTED: ras-related protein RABA5e [Fragaria vesca subsp. 
vesca]
Length=220

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007223957.1| hypothetical protein PRUPE_ppa011186mg [Prunus persica]
 gb|EMJ25156.1| hypothetical protein PRUPE_ppa011186mg [Prunus persica]
Length=220

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KFK42915.1| hypothetical protein AALP_AA1G054800 [Arabis alpina]
Length=219

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|ACN40515.1| unknown [Picea sitchensis]
Length=217

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E DGKE+KAQ+WDTAG
Sbjct  9    YLFKVVLIGDSAVGKSNLLSRYARNEFHMNSKATIGVEFQTQSMEFDGKEIKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|NP_563750.2| RAB GTPase homolog A5E [Arabidopsis thaliana]
 gb|AAP06819.1| putative RAS-related protein ARA-1 [Arabidopsis thaliana]
 gb|AEE27897.1| RAB GTPase homolog A5E [Arabidopsis thaliana]
Length=261

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  54   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  113

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  114  QERFRAVTSA  123



>ref|XP_011042789.1| PREDICTED: ras-related protein RABA5d-like [Populus euphratica]
Length=217

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_002527386.1| protein with unknown function [Ricinus communis]
 gb|EEF34993.1| protein with unknown function [Ricinus communis]
Length=218

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|KDP42877.1| hypothetical protein JCGZ_23819 [Jatropha curcas]
Length=219

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|ABR17569.1| unknown [Picea sitchensis]
Length=217

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E DGKE+KAQ+WDTAG
Sbjct  9    YLFKVVLIGDSAVGKSNLLSRYARNEFHMNSKATIGVEFQTQSMEFDGKEIKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_011095944.1| PREDICTED: ras-related protein RABA5a [Sesamum indicum]
 ref|XP_011095945.1| PREDICTED: ras-related protein RABA5a [Sesamum indicum]
Length=225

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ VE++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVEINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009348339.1| PREDICTED: ras-related protein RABA5e [Pyrus x bretschneideri]
 ref|XP_009348340.1| PREDICTED: ras-related protein RABA5e [Pyrus x bretschneideri]
Length=220

 Score =   128 bits (321),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ  E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSTEIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_008792967.1| PREDICTED: ras-related protein RABA5d-like [Phoenix dactylifera]
Length=214

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IG+SAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGESAVGKSNLLSRYARDEFNLHSKATIGVEFQTQTLDIDGKEVKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>gb|AAA74116.1| putative, partial [Nicotiana tabacum]
Length=209

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  3    YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  62

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  63   QERFRAVTSA  72



>ref|XP_003532321.1| PREDICTED: ras-related protein RABA5d [Glycine max]
 emb|CAA54506.1| GTPase [Glycine max]
 gb|KHN24970.1| Ras-related protein RABA5d [Glycine soja]
Length=219

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_003552753.1| PREDICTED: ras-related protein RABA5d-like [Glycine max]
Length=219

 Score =   127 bits (320),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>emb|CDY10008.1| BnaC08g44430D [Brassica napus]
Length=262

 Score =   129 bits (323),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  55   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  114

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  115  QERFRAVTSA  124



>ref|XP_010553589.1| PREDICTED: ras-related protein RABA5c-like [Tarenaya hassleriana]
Length=216

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+ R+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  10   YLFKVVIIGDSAVGKSNLLSRYTRNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_009791655.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana sylvestris]
Length=218

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_009628055.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana tomentosiformis]
Length=218

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_006366713.1| PREDICTED: ras-related protein RABA5e-like [Solanum tuberosum]
Length=217

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_002976591.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ22260.1| rab family GTPase [Selaginella moellendorffii]
Length=221

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            Y+FKVV+IGDSAVGKSNLL+R+AR+EF+HNSKATIGVEFQTQ + ++GKEVKAQVWDTAG
Sbjct  12   YIFKVVLIGDSAVGKSNLLTRYARNEFNHNSKATIGVEFQTQSMRINGKEVKAQVWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_004248001.1| PREDICTED: ras-related protein RABA5e-like [Solanum lycopersicum]
Length=217

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_001753288.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ81917.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=216

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+ GKE+KAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNLNSKATIGVEFQTQSMEIGGKEIKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010517866.1| PREDICTED: ras-related protein RABA5c-like [Camelina sativa]
Length=214

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|NP_181842.1| Ras-related protein ARA-4 [Arabidopsis thaliana]
 sp|P28187.1|RAA5C_ARATH RecName: Full=Ras-related protein RABA5c; Short=AtRABA5c; AltName: 
Full=Ras-related protein Ara-4; AltName: Full=Ras-related 
protein Rab11F; Short=AtRab11F [Arabidopsis thaliana]
 dbj|BAA00831.1| small GTP-binding protein [Arabidopsis thaliana]
 gb|AAC64302.1| Ras-related GTP-binding protein (ARA-4) [Arabidopsis thaliana]
 gb|ABF83674.1| At2g43130 [Arabidopsis thaliana]
 dbj|BAH19889.1| AT2G43130 [Arabidopsis thaliana]
 gb|AEC10212.1| Ras-related protein ARA-4 [Arabidopsis thaliana]
Length=214

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010054657.1| PREDICTED: ras-related protein RABA5c [Eucalyptus grandis]
 gb|KCW87824.1| hypothetical protein EUGRSUZ_A00215 [Eucalyptus grandis]
 gb|KCW87825.1| hypothetical protein EUGRSUZ_A00215 [Eucalyptus grandis]
Length=218

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_009415105.1| PREDICTED: ras-related protein RABA5e-like [Musa acuminata subsp. 
malaccensis]
Length=212

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVK+Q+WDTAG
Sbjct  7    YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKSQIWDTAG  66

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  67   QERFRAVTSA  76



>emb|CAA98183.1| RAB11G [Lotus japonicus]
Length=219

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQSLEIDSKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_008244729.1| PREDICTED: ras-related protein RABA5d [Prunus mume]
Length=178

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK VKAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_002881887.1| hypothetical protein ARALYDRAFT_903694 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58146.1| hypothetical protein ARALYDRAFT_903694 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_010508467.1| PREDICTED: ras-related protein RABA5c [Camelina sativa]
Length=214

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_007139106.1| hypothetical protein PHAVU_008G001800g [Phaseolus vulgaris]
 gb|ESW11100.1| hypothetical protein PHAVU_008G001800g [Phaseolus vulgaris]
Length=218

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_009133574.1| PREDICTED: ras-related protein RABA5c [Brassica rapa]
Length=213

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_006294977.1| hypothetical protein CARUB_v10024045mg [Capsella rubella]
 gb|EOA27875.1| hypothetical protein CARUB_v10024045mg [Capsella rubella]
Length=214

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|KHG11710.1| Ras-related RABA5d -like protein [Gossypium arboreum]
Length=215

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQTMEINGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_008380791.1| PREDICTED: ras-related protein RABA5d-like [Malus domestica]
 ref|XP_008365691.1| PREDICTED: ras-related protein RABA5d-like [Malus domestica]
Length=158

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR++R+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  14   YLFKIVIIGDSAVGKSNLLSRYSRNEFNAHSKATIGVEFQTQSMQIDGKEVKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>emb|CDX83500.1| BnaA03g20060D [Brassica napus]
Length=213

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMIIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>gb|KFK37154.1| hypothetical protein AALP_AA4G220200 [Arabis alpina]
Length=214

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_006411588.1| hypothetical protein EUTSA_v10017231mg [Eutrema salsugineum]
 gb|ESQ53041.1| hypothetical protein EUTSA_v10017231mg [Eutrema salsugineum]
Length=213

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_010506172.1| PREDICTED: ras-related protein RABA5c-like [Camelina sativa]
Length=215

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>dbj|BAF01351.1| Ras-related GTP-binding protein [Arabidopsis thaliana]
Length=147

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  20   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAG  79

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  80   QERFRAVTSA  89



>emb|CDY42801.1| BnaC03g24050D [Brassica napus]
Length=213

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_007034147.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
 gb|EOY05073.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
Length=208

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ VE+DGK+VKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNAHSKATIGVEFQTQSVEIDGKDVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_010542762.1| PREDICTED: ras-related protein RABA5d-like [Tarenaya hassleriana]
Length=219

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010673314.1| PREDICTED: ras-related protein RABA5d-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_003574801.1| PREDICTED: ras-related protein RABA5c-like [Brachypodium distachyon]
Length=217

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQTMEIDSKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_007034146.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
 gb|EOY05072.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
Length=214

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ VE+DGK+VKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNAHSKATIGVEFQTQSVEIDGKDVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_010926654.1| PREDICTED: ras-related protein RABA5e-like isoform X2 [Elaeis 
guineensis]
Length=214

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+  DEFD +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYTLDEFDLHSKATIGVEFQTQTLDIDGKEVKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>ref|XP_010497765.1| PREDICTED: ras-related protein RABA5a-like, partial [Camelina 
sativa]
Length=113

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_004973932.1| PREDICTED: ras-related protein RABA5d-like [Setaria italica]
Length=217

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_004495529.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Cicer 
arietinum]
 ref|XP_004495530.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Cicer 
arietinum]
 ref|XP_004495531.1| PREDICTED: ras-related protein RABA5a-like isoform X3 [Cicer 
arietinum]
 ref|XP_004495532.1| PREDICTED: ras-related protein RABA5a-like isoform X4 [Cicer 
arietinum]
 ref|XP_004495533.1| PREDICTED: ras-related protein RABA5a-like isoform X5 [Cicer 
arietinum]
Length=225

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_010522214.1| PREDICTED: ras-related protein RABA5d [Tarenaya hassleriana]
Length=217

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|EMT31969.1| Ras-related protein ARA-4 [Aegilops tauschii]
Length=217

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>gb|KEH21456.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=220

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  14   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLEIDSKEVKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>emb|CDP04500.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ VE++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVEINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007200458.1| hypothetical protein PRUPE_ppa011281mg [Prunus persica]
 gb|EMJ01657.1| hypothetical protein PRUPE_ppa011281mg [Prunus persica]
Length=216

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK VKAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_004515580.1| PREDICTED: ras-related protein RABA5e-like [Cicer arietinum]
Length=219

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  13   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLEIDSKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>dbj|BAJ85419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  14   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>emb|CAA82710.1| guanine nucleotide regulatory protein [Vicia faba]
 prf||2115367D small GTP-binding protein
Length=223

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_008372555.1| PREDICTED: ras-related protein RABA5b-like [Malus domestica]
Length=215

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_010485340.1| PREDICTED: ras-related protein RABA5e isoform X2 [Camelina sativa]
Length=196

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_004139534.1| PREDICTED: ras-related protein RABA5a-like [Cucumis sativus]
 ref|XP_004163459.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABA5a-like 
[Cucumis sativus]
 gb|KGN65039.1| hypothetical protein Csa_1G181510 [Cucumis sativus]
Length=224

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIEINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|EMS53467.1| Ras-related protein RABA5c [Triticum urartu]
Length=217

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_010265418.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265419.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265420.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265421.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265422.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265423.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265424.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265425.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
Length=224

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_008382566.1| PREDICTED: ras-related protein RABA5b-like [Malus domestica]
Length=215

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>gb|KEH42936.1| RAB GTPase-like protein C2B [Medicago truncatula]
Length=224

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_006293514.1| hypothetical protein CARUB_v10024030mg [Capsella rubella]
 gb|EOA26412.1| hypothetical protein CARUB_v10024030mg [Capsella rubella]
Length=219

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|NP_180726.1| RAB GTPase-like protein A5D [Arabidopsis thaliana]
 sp|Q9SIP0.1|RAA5D_ARATH RecName: Full=Ras-related protein RABA5d; Short=AtRABA5d [Arabidopsis 
thaliana]
 gb|AAD24853.1| putative RAS superfamily GTP-binding protein [Arabidopsis thaliana]
 gb|AAP88354.1| At2g31680 [Arabidopsis thaliana]
 dbj|BAE99691.1| putative RAS superfamily GTP-binding protein [Arabidopsis thaliana]
 gb|AEC08572.1| RAB GTPase-like protein A5D [Arabidopsis thaliana]
Length=219

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010457681.1| PREDICTED: ras-related protein RABA5e-like [Camelina sativa]
Length=220

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_002881188.1| hypothetical protein ARALYDRAFT_902201 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57447.1| hypothetical protein ARALYDRAFT_902201 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009629633.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Nicotiana 
tomentosiformis]
Length=197

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KJB71848.1| hypothetical protein B456_011G144500 [Gossypium raimondii]
Length=258

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  54   YLFKIVIIGDSAVGKSNLLSRYARNEFSPHSKATIGVEFQTQTMEINGKEVKAQIWDTAG  113

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  114  QERFRAVTSA  123



>ref|XP_010475301.1| PREDICTED: ras-related protein RABA5e-like [Camelina sativa]
Length=220

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>gb|KFK31198.1| hypothetical protein AALP_AA6G080900 [Arabis alpina]
Length=220

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_009372186.1| PREDICTED: ras-related protein RABA5c-like [Pyrus x bretschneideri]
Length=215

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_010485339.1| PREDICTED: ras-related protein RABA5e isoform X1 [Camelina sativa]
Length=220

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_010688595.1| PREDICTED: ras-related protein RABA5a [Beta vulgaris subsp. vulgaris]
Length=226

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  14   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIEINGKEIKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>ref|XP_006305597.1| hypothetical protein CARUB_v10010263mg [Capsella rubella]
 gb|EOA38495.1| hypothetical protein CARUB_v10010263mg [Capsella rubella]
Length=218

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_002889568.1| hypothetical protein ARALYDRAFT_887774 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65827.1| hypothetical protein ARALYDRAFT_887774 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMAIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009385993.1| PREDICTED: ras-related protein RABA5c-like [Musa acuminata subsp. 
malaccensis]
Length=214

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ V +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSVVIDGKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_008345798.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Malus 
domestica]
 ref|XP_008355914.1| PREDICTED: ras-related protein RABA5a isoform X2 [Malus domestica]
Length=218

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V+++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KHF97840.1| Ras-related protein RABA5a [Gossypium arboreum]
Length=224

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVHIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009334262.1| PREDICTED: ras-related protein RABA5c-like [Pyrus x bretschneideri]
 ref|XP_009334263.1| PREDICTED: ras-related protein RABA5c-like [Pyrus x bretschneideri]
Length=215

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_006417985.1| hypothetical protein EUTSA_v10008743mg [Eutrema salsugineum]
 gb|ESQ36338.1| hypothetical protein EUTSA_v10008743mg [Eutrema salsugineum]
Length=218

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_008463615.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABA5a [Cucumis 
melo]
Length=223

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_010926653.1| PREDICTED: ras-related protein RABA5e-like isoform X1 [Elaeis 
guineensis]
Length=232

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+  DEFD +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYTLDEFDLHSKATIGVEFQTQTLDIDGKEVKAQIWDTAG  68

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  69   QERFRAVTSA  78



>gb|EPS70637.1| hypothetical protein M569_04122, partial [Genlisea aurea]
Length=221

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  16   YLFKIVIIGDSAVGKSNLLSRYARNEFSLHSKATIGVEFQTQSLDIDGKEVKAQIWDTAG  75

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  76   QERFRAVTSA  85



>ref|XP_008345797.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Malus 
domestica]
 ref|XP_008355913.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
Length=225

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V+++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009350510.1| PREDICTED: ras-related protein RABA5a-like [Pyrus x bretschneideri]
Length=225

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V+++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_010927595.1| PREDICTED: ras-related protein RABA5c-like [Elaeis guineensis]
Length=217

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQTLDIEGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>gb|EYU27682.1| hypothetical protein MIMGU_mgv1a013213mg [Erythranthe guttata]
Length=227

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIEINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009629631.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009629632.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Nicotiana 
tomentosiformis]
Length=217

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_002444720.1| hypothetical protein SORBIDRAFT_07g026600 [Sorghum bicolor]
 gb|EES14215.1| hypothetical protein SORBIDRAFT_07g026600 [Sorghum bicolor]
Length=216

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFSLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_008384163.1| PREDICTED: ras-related protein RABA5a isoform X2 [Malus domestica]
 ref|XP_008349328.1| PREDICTED: ras-related protein RABA5a isoform X2 [Malus domestica]
 ref|XP_009374879.1| PREDICTED: ras-related protein RABA5a isoform X2 [Pyrus x bretschneideri]
 ref|XP_009344962.1| PREDICTED: ras-related protein RABA5a isoform X2 [Pyrus x bretschneideri]
Length=218

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009144057.1| PREDICTED: ras-related protein RABA5d [Brassica rapa]
 emb|CDY55745.1| BnaA05g35310D [Brassica napus]
Length=219

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEV+AQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKEVRAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009114272.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 ref|XP_009114273.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 ref|XP_009114274.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 ref|XP_009114275.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 emb|CDY41053.1| BnaA09g18320D [Brassica napus]
Length=222

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KJB27937.1| hypothetical protein B456_005G017600 [Gossypium raimondii]
Length=219

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMGIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>emb|CDY25963.1| BnaC09g20240D [Brassica napus]
Length=219

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_010057822.1| PREDICTED: ras-related protein RABA5a-like [Eucalyptus grandis]
 ref|XP_010057823.1| PREDICTED: ras-related protein RABA5a-like [Eucalyptus grandis]
 ref|XP_010057825.1| PREDICTED: ras-related protein RABA5a-like [Eucalyptus grandis]
 gb|KCW75152.1| hypothetical protein EUGRSUZ_E03899 [Eucalyptus grandis]
Length=225

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLNIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_006449885.1| hypothetical protein CICLE_v10017675mg [Citrus clementina]
 ref|XP_006467317.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467318.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467319.1| PREDICTED: ras-related protein RABA5a-like isoform X3 [Citrus 
sinensis]
 ref|XP_006467320.1| PREDICTED: ras-related protein RABA5a-like isoform X4 [Citrus 
sinensis]
 ref|XP_006467321.1| PREDICTED: ras-related protein RABA5a-like isoform X5 [Citrus 
sinensis]
 gb|ESR63125.1| hypothetical protein CICLE_v10017675mg [Citrus clementina]
 gb|KDO78478.1| hypothetical protein CISIN_1g027438mg [Citrus sinensis]
 gb|KDO78479.1| hypothetical protein CISIN_1g027438mg [Citrus sinensis]
 gb|KDO78480.1| hypothetical protein CISIN_1g027438mg [Citrus sinensis]
Length=223

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKVVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_008384161.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
 ref|XP_008384162.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
 ref|XP_008349326.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
 ref|XP_009374877.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374878.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344960.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344961.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
Length=225

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|ABD64936.1| Ras-related GTP-binding protein, putative [Brassica oleracea]
Length=219

 Score =   125 bits (314),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KHG12252.1| Ras-related RABA5e -like protein [Gossypium arboreum]
Length=219

 Score =   125 bits (314),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMGIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KJB69168.1| hypothetical protein B456_011G009000 [Gossypium raimondii]
Length=224

 Score =   125 bits (314),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVHLDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|ADE77345.1| unknown [Picea sitchensis]
Length=223

 Score =   125 bits (314),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARYARNEFYPNSKSTIGVEFQTQTMQIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>emb|CAA98186.1| RAB11J [Lotus japonicus]
Length=223

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KDP36442.1| hypothetical protein JCGZ_09512 [Jatropha curcas]
Length=223

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_004250277.1| PREDICTED: ras-related protein RABA5a [Solanum lycopersicum]
Length=225

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009101412.1| PREDICTED: ras-related protein RABA5a-like [Brassica rapa]
 ref|XP_009101414.1| PREDICTED: ras-related protein RABA5a-like [Brassica rapa]
Length=222

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_010510172.1| PREDICTED: ras-related protein RABA5d-like [Camelina sativa]
Length=221

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMDIDGKDVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_010414098.1| PREDICTED: ras-related protein RABA5d-like [Camelina sativa]
Length=220

 Score =   125 bits (313),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMDIDGKDVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_010494988.1| PREDICTED: ras-related protein RABA5a-like [Camelina sativa]
 ref|XP_010494989.1| PREDICTED: ras-related protein RABA5a-like [Camelina sativa]
Length=221

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>emb|CDY17945.1| BnaC04g02740D [Brassica napus]
Length=213

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +D KEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDNKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_006398449.1| hypothetical protein EUTSA_v10001017mg [Eutrema salsugineum]
 gb|ESQ39902.1| hypothetical protein EUTSA_v10001017mg [Eutrema salsugineum]
Length=221

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007143969.1| hypothetical protein PHAVU_007G117800g [Phaseolus vulgaris]
 gb|ESW15963.1| hypothetical protein PHAVU_007G117800g [Phaseolus vulgaris]
Length=228

 Score =   125 bits (314),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|ACJ84485.1| unknown [Medicago truncatula]
 gb|AFK41722.1| unknown [Medicago truncatula]
Length=220

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDT G
Sbjct  14   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLEIDSKEVKAQIWDTTG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>ref|XP_006659598.1| PREDICTED: ras-related protein RABA5c-like [Oryza brachyantha]
Length=216

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLDIDGKDVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_010469687.1| PREDICTED: ras-related protein RABA5d [Camelina sativa]
Length=220

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMDIDGKDVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>gb|ABD64975.1| Ras family GTP-binding protein [Brassica oleracea]
 emb|CDX77774.1| BnaC07g20280D [Brassica napus]
Length=221

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_006365849.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365850.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Solanum 
tuberosum]
Length=226

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKININGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|EYU33848.1| hypothetical protein MIMGU_mgv1a012931mg [Erythranthe guttata]
Length=235

 Score =   125 bits (314),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSRFARDEF  NSK+TIGVEFQTQ +++ GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARDEFYPNSKSTIGVEFQTQKIKISGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_003536164.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Glycine 
max]
 ref|XP_006589228.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Glycine 
max]
 gb|KHN14769.1| Ras-related protein RABA5a [Glycine soja]
Length=223

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009142914.1| PREDICTED: ras-related protein RABA5c-like [Brassica rapa]
 emb|CDY70114.1| BnaAnng32660D [Brassica napus]
Length=213

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +D KEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDNKEVKAQIWDTAG  69

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  70   QERFRAVTSA  79



>ref|XP_006352344.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352345.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Solanum 
tuberosum]
Length=225

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_004239823.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
 ref|XP_010321395.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
 ref|XP_010321396.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
 ref|XP_010321397.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
Length=226

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKININGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_006846832.1| hypothetical protein AMTR_s00148p00100780 [Amborella trichopoda]
 gb|ERN08413.1| hypothetical protein AMTR_s00148p00100780 [Amborella trichopoda]
Length=196

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  14   YLFKIVLIGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQTIDIEGKEIKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  74   QERFRAVTSA  83



>ref|XP_010441443.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
 ref|XP_010441444.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
 ref|XP_010441445.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
 ref|XP_010481311.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
Length=221

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009776623.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009776624.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009776625.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009776626.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
Length=225

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>emb|CDX84764.1| BnaA03g14660D [Brassica napus]
Length=219

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>emb|CDY17729.1| BnaA06g35480D [Brassica napus]
Length=221

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|NP_001242668.1| uncharacterized protein LOC100789187 [Glycine max]
 gb|ACU21000.1| unknown [Glycine max]
Length=226

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_011086244.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086245.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086246.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086247.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086248.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
Length=222

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGD+AVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E+ GKEVKAQ+WDTAG
Sbjct  13   YLFKIVMIGDAAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEISGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|AAA68983.1| small GTP-binding protein [Brassica napus]
Length=219

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009625286.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana tomentosiformis]
 ref|XP_009625287.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana tomentosiformis]
Length=225

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_002528238.1| protein with unknown function [Ricinus communis]
 gb|EEF34153.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_002863339.1| hypothetical protein ARALYDRAFT_494220 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006281067.1| hypothetical protein CARUB_v10027090mg [Capsella rubella]
 gb|EFH39598.1| hypothetical protein ARALYDRAFT_494220 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA13965.1| hypothetical protein CARUB_v10027090mg [Capsella rubella]
Length=221

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>emb|CDX79430.1| BnaC03g17660D [Brassica napus]
Length=219

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|NP_199563.1| RAB GTPase homolog A5A [Arabidopsis thaliana]
 sp|Q9FGK5.1|RAA5A_ARATH RecName: Full=Ras-related protein RABA5a; Short=AtRABA5a [Arabidopsis 
thaliana]
 dbj|BAB09078.1| GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAO44075.1| At5g47520 [Arabidopsis thaliana]
 dbj|BAD95258.1| GTP-binding protein-like [Arabidopsis thaliana]
 dbj|BAE99754.1| GTP-binding protein-like [Arabidopsis thaliana]
 gb|AED95528.1| RAB GTPase homolog A5A [Arabidopsis thaliana]
Length=221

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009132810.1| PREDICTED: ras-related protein RABA5d-like [Brassica rapa]
Length=218

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009775501.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009775503.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
Length=225

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_006605347.1| PREDICTED: uncharacterized protein LOC100789187 isoform X1 [Glycine 
max]
 gb|KHN04985.1| Ras-related protein RABA5a [Glycine soja]
Length=226

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_002973313.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ25687.1| rab family GTPase [Selaginella moellendorffii]
Length=221

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            Y+FKVV+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + ++GKEVKAQVWDTAG
Sbjct  12   YIFKVVLIGDSAVGKSNLLTRYARNEFNQNSKATIGVEFQTQSMRINGKEVKAQVWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_010655425.1| PREDICTED: ras-related protein RABA5a [Vitis vinifera]
Length=225

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_002323139.1| GTP-binding family protein [Populus trichocarpa]
 ref|XP_011040203.1| PREDICTED: ras-related protein RABA5a [Populus euphratica]
 ref|XP_011040204.1| PREDICTED: ras-related protein RABA5a [Populus euphratica]
 ref|XP_011040205.1| PREDICTED: ras-related protein RABA5a [Populus euphratica]
 ref|XP_011040207.1| PREDICTED: ras-related protein RABA5a [Populus euphratica]
 gb|EEF04900.1| GTP-binding family protein [Populus trichocarpa]
Length=224

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007026285.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
 ref|XP_007026287.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
 gb|EOY28907.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
 gb|EOY28909.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
Length=224

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009402895.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402897.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402898.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402899.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVMIGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKMQIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007211991.1| hypothetical protein PRUPE_ppa011035mg [Prunus persica]
 gb|EMJ13190.1| hypothetical protein PRUPE_ppa011035mg [Prunus persica]
Length=226

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_010530048.1| PREDICTED: ras-related protein RABA5a [Tarenaya hassleriana]
 ref|XP_010530049.1| PREDICTED: ras-related protein RABA5a [Tarenaya hassleriana]
Length=224

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_010052941.1| PREDICTED: ras-related protein RABA5a-like [Eucalyptus grandis]
 gb|KCW77088.1| hypothetical protein EUGRSUZ_D01430 [Eucalyptus grandis]
Length=225

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|NP_001152371.1| ras-related protein ARA-4 [Zea mays]
 gb|ACF83174.1| unknown [Zea mays]
 gb|ACG47295.1| ras-related protein ARA-4 [Zea mays]
 tpg|DAA48143.1| TPA: hypothetical protein ZEAMMB73_561529 [Zea mays]
Length=216

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMAIEGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_009128976.1| PREDICTED: ras-related protein RABA5a-like [Brassica rapa]
Length=221

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIVINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|ABD65003.1| Ras-related GTP-binding protein, putative [Brassica oleracea]
 emb|CDY40561.1| BnaC02g33310D [Brassica napus]
Length=221

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIVINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_007026286.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
 ref|XP_007026288.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
 gb|EOY28908.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
 gb|EOY28910.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
Length=245

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  34   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  93

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  94   QERFRAVTSA  103



>ref|NP_001062290.1| Os08g0525000 [Oryza sativa Japonica Group]
 dbj|BAC75417.1| putative GTP-binding protein(RAB11G) [Oryza sativa Japonica Group]
 dbj|BAF24204.1| Os08g0525000 [Oryza sativa Japonica Group]
 dbj|BAG95960.1| unnamed protein product [Oryza sativa Japonica Group]
Length=216

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ ++++GK+VKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDINGKDVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_008792135.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008792136.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008792137.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
Length=223

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGD+AVGKSNLL+R+AR+EF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  12   YLFKIVLIGDAAVGKSNLLARYARNEFHPNSKSTIGVEFQTQKMDIDGKEIKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  72   QERFRAVTSA  81



>ref|XP_004293379.1| PREDICTED: ras-related protein RABA5a [Fragaria vesca subsp. 
vesca]
Length=226

 Score =   123 bits (308),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARNEFFPNSKSTIGVEFQTQKIVIDGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|KJB67359.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67360.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67361.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67362.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67363.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67364.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67365.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67366.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67367.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67368.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67369.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67370.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67371.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67372.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
Length=224

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V++GDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>gb|AAD48018.1| Rab GTP-binding protein Rab11a [Gossypium hirsutum]
 gb|KHG02326.1| Ras-related protein RABA5a [Gossypium arboreum]
 gb|KHG02327.1| Ras-related protein RABA5a [Gossypium arboreum]
Length=224

 Score =   122 bits (307),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V++GDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>emb|CDY28925.1| BnaA02g25510D [Brassica napus]
Length=221

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQT+ + ++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTKKIVINGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



>ref|XP_009388661.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388662.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  14   YLFKIVMIGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKMNIDGKEIKAQIWDTAG  73

Query  316  QERFRAVTSA  345
            QERF+AVTSA
Sbjct  74   QERFKAVTSA  83



>ref|XP_010557057.1| PREDICTED: ras-related protein RABA5d-like [Tarenaya hassleriana]
Length=217

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQT+ +E++GKEVKAQ+ DTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNANSKATIGVEFQTRSMEIEGKEVKAQIGDTAG  70

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  71   QERFRAVTSA  80



>ref|XP_009383333.1| PREDICTED: ras-related protein RABA5c-like [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFKVV+ GDSAVGKSNLLSR+AR+EF+ +SKATIGVEF TQ V++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVITGDSAVGKSNLLSRYARNEFNLHSKATIGVEFLTQTVDIDGKEVKAQIWDTAG  71

Query  316  QERFRAVTSA  345
            Q+RFRAVTSA
Sbjct  72   QDRFRAVTSA  81



>ref|NP_001131951.1| uncharacterized protein LOC100193344 [Zea mays]
 gb|ACF80587.1| unknown [Zea mays]
 gb|ACG32236.1| ras-related protein ARA-4 [Zea mays]
 tpg|DAA63780.1| TPA: Ras protein ARA-4 isoform 1 [Zea mays]
 tpg|DAA63781.1| TPA: Ras protein ARA-4 isoform 2 [Zea mays]
Length=222

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  136  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  315
            YLFK+V+IGDS+VGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAG  72

Query  316  QERFRAVTSA  345
            QERFRAVTSA
Sbjct  73   QERFRAVTSA  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554595229600