BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013C02

Length=443
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777635.1|  PREDICTED: RNA polymerase I-specific transcr...    194   1e-55   Nicotiana sylvestris
ref|XP_009619798.1|  PREDICTED: RNA polymerase I-specific transcr...    194   1e-55   Nicotiana tomentosiformis
ref|XP_009619796.1|  PREDICTED: RNA polymerase I-specific transcr...    194   2e-55   Nicotiana tomentosiformis
ref|XP_009777634.1|  PREDICTED: RNA polymerase I-specific transcr...    194   2e-55   Nicotiana sylvestris
ref|XP_009618724.1|  PREDICTED: RNA polymerase I-specific transcr...    194   3e-55   
ref|XP_004232589.1|  PREDICTED: RNA polymerase I-specific transcr...    193   4e-55   Solanum lycopersicum
ref|XP_006364840.1|  PREDICTED: RNA polymerase I-specific transcr...    193   5e-55   Solanum tuberosum [potatoes]
ref|XP_009773556.1|  PREDICTED: RNA polymerase I-specific transcr...    193   1e-54   Nicotiana sylvestris
gb|EPS68922.1|  hypothetical protein M569_05845                         182   7e-53   Genlisea aurea
ref|XP_011087416.1|  PREDICTED: RNA polymerase I-specific transcr...    187   9e-53   Sesamum indicum [beniseed]
emb|CDP01757.1|  unnamed protein product                                186   2e-52   Coffea canephora [robusta coffee]
gb|EYU37427.1|  hypothetical protein MIMGU_mgv1a004171mg                182   3e-51   Erythranthe guttata [common monkey flower]
emb|CBI37506.3|  unnamed protein product                                151   7e-40   Vitis vinifera
ref|XP_010649342.1|  PREDICTED: RNA polymerase I-specific transcr...    151   8e-40   Vitis vinifera
ref|XP_008242108.1|  PREDICTED: RNA polymerase I-specific transcr...    149   5e-39   Prunus mume [ume]
ref|XP_010272853.1|  PREDICTED: RNA polymerase I-specific transcr...    147   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007204094.1|  hypothetical protein PRUPE_ppa002914mg             143   5e-37   Prunus persica
ref|XP_010272854.1|  PREDICTED: RNA polymerase I-specific transcr...    141   3e-36   Nelumbo nucifera [Indian lotus]
gb|KHF98889.1|  RNA polymerase I-specific transcription initiatio...    139   8e-36   Gossypium arboreum [tree cotton]
ref|XP_006483467.1|  PREDICTED: RNA polymerase I-specific transcr...    139   8e-36   
ref|XP_006483561.1|  PREDICTED: RNA polymerase I-specific transcr...    139   1e-35   Citrus sinensis [apfelsine]
ref|XP_006483466.1|  PREDICTED: RNA polymerase I-specific transcr...    139   1e-35   Citrus sinensis [apfelsine]
ref|XP_010088711.1|  hypothetical protein L484_016497                   139   1e-35   Morus notabilis
ref|XP_006483560.1|  PREDICTED: RNA polymerase I-specific transcr...    138   2e-35   Citrus sinensis [apfelsine]
ref|XP_002881355.1|  RNA polymerase I specific transcription init...    138   2e-35   
ref|XP_006483559.1|  PREDICTED: RNA polymerase I-specific transcr...    139   2e-35   Citrus sinensis [apfelsine]
ref|XP_009369775.1|  PREDICTED: RNA polymerase I-specific transcr...    138   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_008354575.1|  PREDICTED: RNA polymerase I-specific transcr...    137   7e-35   Malus domestica [apple tree]
gb|KJB18645.1|  hypothetical protein B456_003G064600                    136   1e-34   Gossypium raimondii
gb|KCW53303.1|  hypothetical protein EUGRSUZ_J02557                     135   3e-34   Eucalyptus grandis [rose gum]
gb|KCW53301.1|  hypothetical protein EUGRSUZ_J02557                     135   3e-34   Eucalyptus grandis [rose gum]
ref|XP_010033606.1|  PREDICTED: RNA polymerase I-specific transcr...    135   3e-34   Eucalyptus grandis [rose gum]
dbj|BAF01881.1|  hypothetical protein                                   133   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850236.1|  RNA polymerase I specific transcription initiat...    134   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524432.1|  transcription initiation factor ia, putative       134   1e-33   Ricinus communis
ref|XP_004508346.1|  PREDICTED: RNA polymerase I-specific transcr...    134   1e-33   Cicer arietinum [garbanzo]
gb|KHN38852.1|  RNA polymerase I-specific transcription initiatio...    132   8e-33   Glycine soja [wild soybean]
ref|XP_003534228.1|  PREDICTED: RNA polymerase I-specific transcr...    132   8e-33   Glycine max [soybeans]
ref|XP_010540653.1|  PREDICTED: RNA polymerase I-specific transcr...    131   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_006410626.1|  hypothetical protein EUTSA_v10016395mg             131   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_007046443.1|  Major facilitator superfamily protein isoform 1    131   1e-32   
ref|XP_010516632.1|  PREDICTED: RNA polymerase I-specific transcr...    130   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010913887.1|  PREDICTED: RNA polymerase I-specific transcr...    129   4e-32   
ref|XP_003547884.1|  PREDICTED: RNA polymerase I-specific transcr...    129   6e-32   Glycine max [soybeans]
ref|XP_010913886.1|  PREDICTED: RNA polymerase I-specific transcr...    129   7e-32   
ref|XP_008438040.1|  PREDICTED: RNA polymerase I-specific transcr...    129   9e-32   Cucumis melo [Oriental melon]
ref|XP_007134114.1|  hypothetical protein PHAVU_010G020100g             129   9e-32   Phaseolus vulgaris [French bean]
ref|XP_010913884.1|  PREDICTED: RNA polymerase I-specific transcr...    129   1e-31   
ref|XP_004287706.1|  PREDICTED: RNA polymerase I-specific transcr...    128   1e-31   Fragaria vesca subsp. vesca
ref|XP_006296428.1|  hypothetical protein CARUB_v10025608mg             128   2e-31   
ref|XP_010504951.1|  PREDICTED: RNA polymerase I-specific transcr...    128   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004155826.1|  PREDICTED: RNA polymerase I-specific transcr...    127   3e-31   
ref|XP_004133864.1|  PREDICTED: RNA polymerase I-specific transcr...    127   3e-31   Cucumis sativus [cucumbers]
ref|XP_006415449.1|  hypothetical protein EUTSA_v10007103mg             126   5e-31   Eutrema salsugineum [saltwater cress]
gb|KEH32234.1|  transcription initiation factor ia protein, putative    126   9e-31   Medicago truncatula
gb|KFK44868.1|  hypothetical protein AALP_AA1G312900                    125   1e-30   Arabis alpina [alpine rockcress]
ref|NP_174347.1|  RNA polymerase I specific transcription initiat...    125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509710.1|  PREDICTED: RNA polymerase I-specific transcr...    125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006307098.1|  hypothetical protein CARUB_v10008684mg             124   2e-30   Capsella rubella
ref|XP_008805454.1|  PREDICTED: RNA polymerase I-specific transcr...    124   5e-30   Phoenix dactylifera
ref|XP_010674318.1|  PREDICTED: RNA polymerase I-specific transcr...    124   6e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP41755.1|  hypothetical protein JCGZ_26773                         124   6e-30   Jatropha curcas
ref|XP_010519059.1|  PREDICTED: RNA polymerase I-specific transcr...    123   7e-30   Tarenaya hassleriana [spider flower]
ref|XP_002307198.2|  RNA polymerase 1 specific transcription init...    124   7e-30   Populus trichocarpa [western balsam poplar]
ref|XP_009141397.1|  PREDICTED: RNA polymerase I-specific transcr...    123   9e-30   Brassica rapa
ref|XP_002893635.1|  predicted protein                                  122   2e-29   
emb|CDY43658.1|  BnaA04g20330D                                          122   3e-29   Brassica napus [oilseed rape]
ref|XP_011022128.1|  PREDICTED: RNA polymerase I-specific transcr...    122   3e-29   Populus euphratica
ref|XP_009133000.1|  PREDICTED: RNA polymerase I-specific transcr...    120   1e-28   Brassica rapa
ref|XP_002879723.1|  hypothetical protein ARALYDRAFT_902994             119   1e-28   
gb|AAD25746.1|AC007060_4  EST gb|Z37678 comes from this gene            119   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143744.1|  PREDICTED: RNA polymerase I-specific transcr...    119   4e-28   Brassica rapa
gb|EEC81212.1|  hypothetical protein OsI_24246                          118   8e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_006849976.1|  hypothetical protein AMTR_s00022p00154500          117   8e-28   
emb|CDX79576.1|  BnaC03g19120D                                          117   9e-28   
ref|NP_001058413.2|  Os06g0688100                                       118   9e-28   
ref|XP_002881638.1|  hypothetical protein ARALYDRAFT_321615             117   1e-27   
ref|XP_008782843.1|  PREDICTED: RNA polymerase I-specific transcr...    115   2e-27   
ref|XP_010552506.1|  PREDICTED: RNA polymerase I-specific transcr...    115   2e-27   Tarenaya hassleriana [spider flower]
emb|CDX84629.1|  BnaA03g16010D                                          116   3e-27   
ref|XP_008782841.1|  PREDICTED: RNA polymerase I-specific transcr...    115   4e-27   Phoenix dactylifera
ref|XP_006656405.1|  PREDICTED: RNA polymerase I-specific transcr...    114   2e-26   Oryza brachyantha
ref|XP_006656406.1|  PREDICTED: RNA polymerase I-specific transcr...    114   2e-26   Oryza brachyantha
ref|NP_181457.2|  RNA polymerase I specific transcription initiat...    113   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293892.1|  hypothetical protein CARUB_v10022885mg             113   4e-26   
ref|XP_010928803.1|  PREDICTED: RNA polymerase I-specific transcr...    113   5e-26   Elaeis guineensis
ref|XP_010928802.1|  PREDICTED: RNA polymerase I-specific transcr...    113   5e-26   Elaeis guineensis
ref|XP_010499599.1|  PREDICTED: RNA polymerase I-specific transcr...    112   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010499598.1|  PREDICTED: RNA polymerase I-specific transcr...    112   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010552505.1|  PREDICTED: RNA polymerase I-specific transcr...    112   8e-26   Tarenaya hassleriana [spider flower]
ref|XP_010478481.1|  PREDICTED: RNA polymerase I-specific transcr...    112   1e-25   Camelina sativa [gold-of-pleasure]
emb|CDY71933.1|  BnaCnng75170D                                          109   1e-25   Brassica napus [oilseed rape]
ref|XP_008242159.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...    112   2e-25   
emb|CDX84284.1|  BnaC04g10460D                                          110   3e-25   
gb|EMT22842.1|  hypothetical protein F775_01666                         109   1e-24   
gb|KHN37948.1|  RNA polymerase I-specific transcription initiatio...    107   1e-24   Glycine soja [wild soybean]
ref|XP_010227381.1|  PREDICTED: RNA polymerase I-specific transcr...    108   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_003563455.1|  PREDICTED: RNA polymerase I-specific transcr...    108   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_009411620.1|  PREDICTED: RNA polymerase I-specific transcr...    107   7e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004966190.1|  PREDICTED: RNA polymerase I-specific transcr...    105   2e-23   Setaria italica
ref|XP_010460863.1|  PREDICTED: RNA polymerase I-specific transcr...    105   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010460864.1|  PREDICTED: RNA polymerase I-specific transcr...    105   2e-23   
ref|XP_009391870.1|  PREDICTED: RNA polymerase I-specific transcr...    105   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004966189.1|  PREDICTED: RNA polymerase I-specific transcr...    105   3e-23   
gb|AAC16259.1|  unknown protein                                         103   7e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31637.1|  BnaA05g09100D                                        99.0    5e-21   Brassica napus [oilseed rape]
ref|XP_009359751.1|  PREDICTED: uncharacterized protein LOC103950283  97.4    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_008681385.1|  PREDICTED: uncharacterized protein LOC100272...  97.8    1e-20   
ref|XP_002963952.1|  hypothetical protein SELMODRAFT_405493           92.8    8e-19   Selaginella moellendorffii
ref|XP_002967968.1|  hypothetical protein SELMODRAFT_440149           92.4    1e-18   Selaginella moellendorffii
ref|XP_007204151.1|  hypothetical protein PRUPE_ppa019726mg           92.0    1e-18   
gb|AAC28984.1|  unknown protein                                       89.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001775034.1|  predicted protein                                80.9    1e-14   
ref|XP_001771048.1|  predicted protein                                80.1    2e-14   
ref|XP_002437492.1|  hypothetical protein SORBIDRAFT_10g028030        79.3    4e-14   
gb|AFW69235.1|  hypothetical protein ZEAMMB73_457339                  79.0    5e-14   
ref|XP_002950319.1|  hypothetical protein VOLCADRAFT_120872           79.3    6e-14   Volvox carteri f. nagariensis
gb|KDO67298.1|  hypothetical protein CISIN_1g0416052mg                74.3    3e-13   Citrus sinensis [apfelsine]
gb|KDO67467.1|  hypothetical protein CISIN_1g0074032mg                73.9    3e-13   Citrus sinensis [apfelsine]
gb|KDO67466.1|  hypothetical protein CISIN_1g0074032mg                73.9    5e-13   Citrus sinensis [apfelsine]
gb|KJE92659.1|  hypothetical protein CAOG_003578                      74.3    3e-12   Capsaspora owczarzaki ATCC 30864
ref|XP_004363306.2|  hypothetical protein CAOG_03578                  74.3    3e-12   Capsaspora owczarzaki ATCC 30864
dbj|GAN08251.1|  RNA polymerase I-specific transcription initiati...  70.9    3e-11   Mucor ambiguus
emb|CEP19450.1|  hypothetical protein                                 70.5    4e-11   Parasitella parasitica
ref|XP_006467185.1|  PREDICTED: RNA polymerase I-specific transcr...  70.5    4e-11   
gb|EIE78658.1|  hypothetical protein RO3G_03362                       69.7    5e-11   Rhizopus delemar RA 99-880
gb|EPB87298.1|  hypothetical protein HMPREF1544_05919                 70.1    6e-11   Mucor circinelloides f. circinelloides 1006PhL
emb|CEI99737.1|  hypothetical protein RMCBS344292_13818               69.7    8e-11   Rhizopus microsporus
emb|CEG79886.1|  hypothetical protein RMATCC62417_14298               69.3    9e-11   Rhizopus microsporus
emb|CEG73256.1|  hypothetical protein RMATCC62417_08674               69.3    9e-11   Rhizopus microsporus
ref|XP_008863058.1|  hypothetical protein H310_01652                  68.9    1e-10   Aphanomyces invadans
ref|XP_001870906.1|  RNA polymerase I-specific transcription init...  68.6    1e-10   Culex quinquefasciatus
ref|XP_005844143.1|  hypothetical protein CHLNCDRAFT_54625            68.9    2e-10   Chlorella variabilis
ref|XP_005645323.1|  RRN3-domain-containing protein                   68.6    2e-10   Coccomyxa subellipsoidea C-169
ref|XP_005834186.1|  hypothetical protein GUITHDRAFT_107116           67.8    3e-10   Guillardia theta CCMP2712
gb|EMS63005.1|  hypothetical protein TRIUR3_02342                     67.0    5e-10   Triticum urartu
ref|XP_010108004.1|  hypothetical protein L484_012360                 64.7    2e-09   
emb|CEF99449.1|  RNA polymerase I specific transcription initiati...  65.9    2e-09   Ostreococcus tauri
ref|XP_003081725.1|  RNA polymerase I transcription factor (ISS)      65.5    2e-09   
ref|XP_009523651.1|  hypothetical protein PHYSODRAFT_328981           65.5    2e-09   Phytophthora sojae
gb|ACJ85821.1|  unknown                                               62.4    6e-09   Medicago truncatula
emb|CCA21261.1|  RNA polymerase Ispecific transcription initiatio...  63.9    8e-09   Albugo laibachii Nc14
ref|XP_006960280.1|  RNA polymerase I-specific transcription init...  63.5    8e-09   Wallemia mellicola CBS 633.66
ref|XP_001420013.1|  predicted protein                                63.2    1e-08   Ostreococcus lucimarinus CCE9901
ref|XP_011420908.1|  PREDICTED: RNA polymerase I-specific transcr...  61.2    1e-08   Crassostrea gigas
emb|CCI46668.1|  unnamed protein product                              62.8    2e-08   Albugo candida
ref|XP_007302420.1|  RNA polymerase I-specific transcription init...  62.4    2e-08   Stereum hirsutum FP-91666 SS1
ref|XP_009820935.1|  hypothetical protein H257_00104                  62.0    3e-08   Aphanomyces astaci
emb|CCU97734.1|  unnamed protein product                              61.2    4e-08   Malassezia sympodialis ATCC 42132
gb|KDO33327.1|  hypothetical protein SPRG_02135                       61.6    4e-08   Saprolegnia parasitica CBS 223.65
gb|EKC17834.1|  RNA polymerase I-specific transcription initiatio...  61.2    5e-08   Crassostrea gigas
ref|XP_009269093.1|  RNA polymerase I-specific transcription init...  60.8    7e-08   Wallemia ichthyophaga EXF-994
ref|XP_009037267.1|  hypothetical protein AURANDRAFT_71709            60.1    2e-07   Aureococcus anophagefferens
gb|ETP25265.1|  hypothetical protein F441_01846                       59.7    2e-07   Phytophthora parasitica CJ01A1
gb|ETK95246.1|  hypothetical protein L915_01809                       59.7    2e-07   Phytophthora parasitica
ref|XP_008899287.1|  hypothetical protein PPTG_06982                  59.7    2e-07   Phytophthora parasitica INRA-310
ref|XP_003055684.1|  predicted protein                                58.9    2e-07   Micromonas pusilla CCMP1545
emb|CBK20142.2|  unnamed protein product                              58.2    2e-07   Blastocystis hominis
gb|EMD40585.1|  hypothetical protein CERSUDRAFT_111179                58.9    3e-07   Gelatoporia subvermispora B
gb|ETO84187.1|  hypothetical protein F444_01889                       58.9    3e-07   Phytophthora parasitica P1976
gb|ETL48645.1|  hypothetical protein L916_01774                       58.9    3e-07   Phytophthora parasitica
gb|EPS96015.1|  hypothetical protein FOMPIDRAFT_1151482               58.5    4e-07   Fomitopsis pinicola FP-58527 SS1
ref|XP_002897714.1|  RNA polymerase I-specific transcription init...  58.5    5e-07   Phytophthora infestans T30-4
gb|KIM57353.1|  hypothetical protein SCLCIDRAFT_1219565               58.2    5e-07   Scleroderma citrinum Foug A
ref|XP_002023097.1|  GL21145                                          57.4    9e-07   
gb|KDQ29722.1|  hypothetical protein PLEOSDRAFT_1039246               57.4    9e-07   Pleurotus ostreatus PC15
dbj|BAD45609.1|  RNA polymerase I specific transcription initiati...  56.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CBJ29597.1|  conserved unknown protein                            57.0    1e-06   Ectocarpus siliculosus
ref|XP_007365075.1|  RNA polymerase I-specific transcription init...  56.6    1e-06   Dichomitus squalens LYAD-421 SS1
emb|CDO73785.1|  hypothetical protein BN946_scf185015.g113            56.6    2e-06   Trametes cinnabarina
ref|XP_002179815.1|  predicted protein                                56.6    2e-06   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002845899.1|  RNA polymerase I-specific transcription init...  56.6    2e-06   Microsporum canis CBS 113480
ref|XP_002185107.1|  predicted protein                                56.6    2e-06   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002051281.1|  GJ13145                                          56.2    2e-06   Drosophila virilis
ref|XP_008035540.1|  RNA polymerase I-specific transcription init...  56.6    2e-06   Trametes versicolor FP-101664 SS1
gb|EMS19160.1|  RNA polymerase I specific transcription initiatio...  56.6    2e-06   Rhodotorula toruloides NP11
ref|XP_001729985.1|  hypothetical protein MGL_2971                    56.2    2e-06   Malassezia globosa CBS 7966
ref|XP_003714640.1|  hypothetical protein MGG_01654                   56.2    2e-06   Magnaporthe oryzae 70-15
gb|EGU13471.1|  Pirin domain-containing protein                       56.6    2e-06   Rhodotorula toruloides ATCC 204091
ref|XP_009495733.1|  hypothetical protein H696_03588                  56.2    2e-06   Fonticula alba
ref|XP_001876557.1|  RNA polymerase I-specific transcription init...  56.2    2e-06   Laccaria bicolor S238N-H82
emb|CBI37498.3|  unnamed protein product                              52.0    3e-06   Vitis vinifera
ref|XP_002172987.1|  ribosomal DNA transcription factor Rrn3          55.8    3e-06   Schizosaccharomyces japonicus yFS275
ref|XP_005943145.1|  PREDICTED: RNA polymerase I-specific transcr...  55.8    3e-06   Haplochromis burtoni
gb|KDQ15362.1|  hypothetical protein BOTBODRAFT_54658                 55.8    3e-06   Botryobasidium botryosum FD-172 SS1
ref|XP_005943146.1|  PREDICTED: RNA polymerase I-specific transcr...  55.8    3e-06   
ref|XP_003838675.1|  hypothetical protein LEMA_P023480.1              55.5    3e-06   Leptosphaeria maculans JN3
ref|XP_004576055.1|  PREDICTED: RNA polymerase I-specific transcr...  55.5    3e-06   
ref|XP_004576056.1|  PREDICTED: RNA polymerase I-specific transcr...  55.5    3e-06   
ref|XP_005754251.1|  PREDICTED: RNA polymerase I-specific transcr...  55.5    4e-06   Pundamilia nyererei
ref|XP_005754252.1|  PREDICTED: RNA polymerase I-specific transcr...  55.5    4e-06   
ref|XP_001356293.2|  GA17133                                          55.1    4e-06   Drosophila pseudoobscura pseudoobscura
emb|CDS11486.1|  hypothetical protein LRAMOSA03749                    55.1    5e-06   Lichtheimia ramosa
ref|XP_008557240.1|  PREDICTED: RNA polymerase I-specific transcr...  54.7    5e-06   
ref|XP_005809521.1|  PREDICTED: RNA polymerase I-specific transcr...  54.7    6e-06   Xiphophorus maculatus
gb|KII95045.1|  hypothetical protein PLICRDRAFT_98907                 54.7    7e-06   Plicaturopsis crispa FD-325 SS-3
gb|ELT94357.1|  hypothetical protein CAPTEDRAFT_221291                54.3    8e-06   Capitella teleta
gb|EPQ64152.1|  hypothetical protein BGT96224_76                      54.3    8e-06   Blumeria graminis f. sp. tritici 96224
ref|XP_319773.4|  AGAP009024-PA                                       54.3    9e-06   Anopheles gambiae str. PEST
gb|KIM91228.1|  hypothetical protein PILCRDRAFT_811739                54.3    9e-06   Piloderma croceum F 1598
gb|KIJ57003.1|  hypothetical protein M422DRAFT_198368                 54.3    9e-06   Sphaerobolus stellatus SS14
ref|XP_007382010.1|  RNA polymerase I-specific transcription init...  54.3    9e-06   Punctularia strigosozonata HHB-11173 SS5
ref|XP_007862226.1|  RNA polymerase I-specific transcription init...  54.3    1e-05   Gloeophyllum trabeum ATCC 11539
ref|XP_004998396.1|  hypothetical protein PTSG_00924                  54.3    1e-05   Salpingoeca rosetta
ref|XP_002671366.1|  predicted protein                                54.3    1e-05   Naegleria gruberi strain NEG-M
ref|XP_002002618.1|  GI11780                                          53.9    1e-05   Drosophila mojavensis
gb|EZG08879.1|  hypothetical protein H106_02061                       53.9    1e-05   Trichophyton rubrum CBS 735.88
ref|XP_002484284.1|  RNA polymerase I-specific transcription init...  53.9    1e-05   Talaromyces stipitatus ATCC 10500
gb|EPZ31565.1|  RNA polymerase I transcription initiation factor ...  53.9    1e-05   Rozella allomycis CSF55
ref|XP_007711391.1|  hypothetical protein COCCADRAFT_4303             53.9    1e-05   Bipolaris zeicola 26-R-13
gb|EUN30478.1|  hypothetical protein COCVIDRAFT_23744                 53.9    1e-05   Bipolaris victoriae FI3
ref|XP_007407172.1|  hypothetical protein MELLADRAFT_34470            53.9    1e-05   Melampsora larici-populina 98AG31
gb|KIY46603.1|  RNA polymerase I-specific transcription initiatio...  53.9    1e-05   Fistulina hepatica ATCC 64428
gb|ETN66338.1|  transcription initiation factor RRN3                  53.5    1e-05   Anopheles darlingi [American malaria mosquito]
gb|EZF32850.1|  hypothetical protein H101_03560                       53.9    1e-05   Trichophyton interdigitale H6
gb|EGE01750.1|  hypothetical protein TEQG_00795                       53.9    1e-05   Trichophyton equinum CBS 127.97
gb|EGD97283.1|  hypothetical protein TESG_04694                       53.9    1e-05   Trichophyton tonsurans CBS 112818
gb|EZG08878.1|  hypothetical protein H106_02061                       53.5    1e-05   Trichophyton rubrum CBS 735.88
dbj|GAA94522.1|  hypothetical protein E5Q_01174                       53.9    1e-05   Mixia osmundae IAM 14324
ref|XP_002161101.1|  PREDICTED: RNA polymerase I-specific transcr...  53.5    2e-05   Hydra vulgaris
ref|XP_003459441.2|  PREDICTED: RNA polymerase I-specific transcr...  53.5    2e-05   
gb|KFH71686.1|  hypothetical protein MVEG_01981                       53.5    2e-05   Mortierella verticillata NRRL 6337
gb|KFB38508.1|  hypothetical protein ZHAS_00005915                    53.1    2e-05   Anopheles sinensis
ref|XP_003071560.1|  RNA polymerase I-specific transcription init...  53.5    2e-05   Coccidioides posadasii C735 delta SOWgp
gb|KIJ69765.1|  hypothetical protein HYDPIDRAFT_104386                53.5    2e-05   Hydnomerulius pinastri MD-312
ref|XP_007682485.1|  hypothetical protein COCMIDRAFT_442              53.5    2e-05   Bipolaris oryzae ATCC 44560
gb|KEQ67618.1|  RNA polymerase I-specific transcription initiatio...  53.1    2e-05   Aureobasidium melanogenum CBS 110374
ref|XP_002476428.1|  predicted protein                                53.5    2e-05   
gb|EFW15337.1|  RNA polymerase I specific transcription initiatio...  53.1    2e-05   Coccidioides posadasii str. Silveira
gb|KGO41514.1|  RNA polymerase I specific transcription initiatio...  53.1    2e-05   Penicillium expansum
ref|XP_003175346.1|  RNA polymerase I-specific transcription init...  53.1    2e-05   Nannizzia gypsea CBS 118893
gb|KGO76977.1|  RNA polymerase I specific transcription initiatio...  53.1    2e-05   Penicillium italicum
ref|XP_007315707.1|  hypothetical protein SERLADRAFT_413954           53.1    2e-05   Serpula lacrymans var. lacrymans S7.9
gb|EZF97865.1|  hypothetical protein H113_02202                       52.8    2e-05   Trichophyton rubrum MR1459
gb|ENI07707.1|  hypothetical protein COCC4DRAFT_79726                 53.1    2e-05   Bipolaris maydis ATCC 48331
gb|EMD93991.1|  hypothetical protein COCHEDRAFT_1201821               53.1    2e-05   Bipolaris maydis C5
ref|XP_001794756.1|  hypothetical protein SNOG_04337                  53.1    2e-05   Parastagonospora nodorum SN15
ref|XP_003297038.1|  RNA polymerase I-specific transcription init...  52.8    2e-05   
ref|XP_001602153.1|  PREDICTED: RNA polymerase I-specific transcr...  52.8    3e-05   Nasonia vitripennis
gb|EKV09675.1|  RNA polymerase I specific transcription initiatio...  52.8    3e-05   Penicillium digitatum Pd1
gb|KIO00388.1|  hypothetical protein M404DRAFT_1003841                52.8    3e-05   Pisolithus tinctorius Marx 270
gb|KGY14804.1|  hypothetical protein PABG_12298                       52.0    3e-05   Paracoccidioides brasiliensis Pb03
ref|XP_003232965.1|  RNA polymerase I-specific transcription init...  52.8    3e-05   Trichophyton rubrum CBS 118892
gb|KIO30179.1|  hypothetical protein M407DRAFT_69422                  52.4    3e-05   Tulasnella calospora MUT 4182
gb|KEQ77948.1|  RNA polymerase I-specific transcription initiatio...  52.8    3e-05   Aureobasidium namibiae CBS 147.97
ref|XP_008025939.1|  hypothetical protein SETTUDRAFT_169084           52.4    3e-05   Exserohilum turcica Et28A
ref|XP_009543462.1|  hypothetical protein HETIRDRAFT_380901           52.4    3e-05   Heterobasidion irregulare TC 32-1
ref|XP_001245293.1|  RNA polymerase I-specific transcription init...  52.4    3e-05   
gb|KDQ64421.1|  hypothetical protein JAAARDRAFT_28051                 52.4    3e-05   Jaapia argillacea MUCL 33604
gb|EAS33710.3|  RNA polymerase I-specific transcription initiatio...  52.4    3e-05   Coccidioides immitis RS
ref|XP_009009426.1|  hypothetical protein HELRODRAFT_187961           52.4    4e-05   Helobdella robusta
ref|XP_003375677.1|  putative glutaredoxin-like protein               52.4    4e-05   Trichinella spiralis
ref|XP_002044628.1|  GM18796                                          52.4    4e-05   Drosophila sechellia
ref|XP_001993077.1|  GH13629                                          52.4    4e-05   Drosophila grimshawi
ref|XP_001942278.1|  RNA polymerase I-specific transcription init...  52.4    4e-05   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_011494677.1|  PREDICTED: RNA polymerase I-specific transcr...  52.0    4e-05   Ceratosolen solmsi marchali
ref|XP_750009.1|  RNA polymerase I specific transcription initiat...  52.0    5e-05   Aspergillus fumigatus Af293
ref|XP_002566050.1|  Pc22g21540                                       52.0    5e-05   Penicillium rubens Wisconsin 54-1255
gb|KEY83331.1|  RNA polymerase I specific transcription initiatio...  52.0    5e-05   Aspergillus fumigatus var. RP-2014
ref|XP_001265389.1|  RNA polymerase I-specific transcription init...  52.0    5e-05   Aspergillus fischeri NRRL 181
ref|XP_002090163.1|  Tif-IA                                           52.0    5e-05   Drosophila yakuba
ref|XP_006677699.1|  hypothetical protein BATDEDRAFT_1623             51.6    5e-05   Batrachochytrium dendrobatidis JAM81
gb|KEQ95671.1|  hypothetical protein AUEXF2481DRAFT_4638              52.0    5e-05   Aureobasidium subglaciale EXF-2481
gb|KIK21832.1|  hypothetical protein PISMIDRAFT_680957                51.6    6e-05   Pisolithus microcarpus 441
gb|EFA82787.1|  hypothetical protein PPL_04482                        51.6    6e-05   Heterostelium album PN500
ref|XP_005464989.1|  PREDICTED: RNA polymerase I-specific transcr...  51.6    6e-05   
dbj|GAD92618.1|  RNA polymerase I specific transcription initiati...  51.6    6e-05   Byssochlamys spectabilis No. 5
ref|XP_005762445.1|  hypothetical protein EMIHUDRAFT_452776           51.6    6e-05   Emiliania huxleyi CCMP1516
emb|CDR45614.1|  CYFA0S19e00958g1_1                                   51.6    6e-05   Cyberlindnera fabianii
dbj|GAC96865.1|  ribosomal DNA transcription factor                   51.6    6e-05   Pseudozyma hubeiensis SY62
ref|XP_002792381.1|  RNA polymerase I-specific transcription init...  51.6    6e-05   
emb|CDM27503.1|  RNA polymerase I specific transcription initiati...  51.6    7e-05   Penicillium roqueforti FM164
ref|XP_008327372.1|  PREDICTED: RNA polymerase I-specific transcr...  51.6    7e-05   
gb|EEH34617.2|  hypothetical protein PAAG_05666                       51.6    7e-05   Paracoccidioides lutzii Pb01
ref|XP_002583810.1|  conserved hypothetical protein                   51.2    8e-05   Uncinocarpus reesii 1704
ref|XP_008413443.1|  PREDICTED: RNA polymerase I-specific transcr...  51.2    8e-05   Poecilia reticulata
ref|XP_001973923.1|  GG21453                                          51.2    8e-05   Drosophila erecta
ref|XP_007701025.1|  hypothetical protein COCSADRAFT_37893            51.2    8e-05   Bipolaris sorokiniana ND90Pr
ref|XP_763893.1|  hypothetical protein                                51.6    8e-05   Theileria parva strain Muguga
ref|XP_007568372.1|  PREDICTED: RNA polymerase I-specific transcr...  51.2    8e-05   
ref|XP_002109173.1|  hypothetical protein TRIADDRAFT_52940            51.2    8e-05   
ref|XP_002064674.1|  GK23990                                          51.2    8e-05   
gb|EHA26477.1|  hypothetical protein ASPNIDRAFT_172112                51.2    9e-05   
ref|XP_001966905.1|  GF22755                                          51.2    9e-05   
emb|CCU76130.1|  RNA polymerase I-specific transcription initiati...  51.2    9e-05   
ref|XP_657916.1|  hypothetical protein AN0312.2                       51.2    9e-05   
gb|ERZ99098.1|  hypothetical protein GLOINDRAFT_339284                51.2    9e-05   
gb|KFH47301.1|  RNA polymerase I-specific transcription initiatio...  51.2    9e-05   
ref|XP_010763020.1|  hypothetical protein PADG_07730                  51.2    1e-04   
gb|KDE05738.1|  hypothetical protein MVLG_03830                       51.2    1e-04   
ref|XP_002503445.1|  predicted protein                                51.2    1e-04   
ref|XP_001655975.1|  AAEL012265-PA                                    50.8    1e-04   
dbj|GAA83499.1|  RNA polymerase I specific transcription initiati...  50.8    1e-04   
ref|XP_001388984.2|  RNA polymerase I-specific transcription init...  50.8    1e-04   
emb|CAK43728.1|  unnamed protein product                              50.8    1e-04   
ref|XP_002429695.1|  transcription initiation factor ia, putative     50.8    1e-04   
gb|EDP55602.1|  RNA polymerase I specific transcription initiatio...  50.8    1e-04   
gb|EGC46149.1|  conserved hypothetical protein                        50.8    1e-04   
gb|KEQ81453.1|  RNA polymerase I-specific transcription initiatio...  50.8    1e-04   
ref|XP_011387260.1|  hypothetical protein UMAG_01371                  50.8    1e-04   
gb|KIJ06158.1|  hypothetical protein PAXINDRAFT_103486                50.8    1e-04   
gb|EER43215.1|  RNA polymerase I-specific transcription initiatio...  50.8    1e-04   
ref|XP_003957086.1|  hypothetical protein KAFR_0D03030                50.4    1e-04   
gb|EEH11164.1|  RNA polymerase I-specific transcription initiatio...  50.8    1e-04   
ref|XP_003012308.1|  hypothetical protein ARB_01267                   50.4    1e-04   
gb|KDR09373.1|  hypothetical protein L798_00940                       50.4    1e-04   
ref|XP_003024675.1|  hypothetical protein TRV_01138                   50.4    1e-04   
gb|EAR97543.2|  RNA polymerase I-specific transcription initiatio...  50.4    2e-04   
ref|XP_001017788.1|  hypothetical protein TTHERM_00438910             50.4    2e-04   
gb|AEE63061.1|  unknown                                               50.1    2e-04   
ref|XP_007290346.1|  RNA polymerase I specific transcription init...  50.1    2e-04   
gb|EFO20210.2|  hypothetical protein LOAG_08279                       50.1    2e-04   
ref|XP_952928.1|  hypothetical protein                                50.1    2e-04   
ref|XP_003143859.1|  hypothetical protein LOAG_08279                  50.1    2e-04   
gb|EKG22030.1|  RNA polymerase I specific transcription initiatio...  50.1    2e-04   
emb|CCM00173.1|  predicted protein                                    50.1    2e-04   
ref|XP_007235391.1|  PREDICTED: RNA polymerase I-specific transcr...  50.1    2e-04   
ref|XP_004182315.1|  hypothetical protein TBLA_0I01360                49.7    2e-04   
ref|XP_001214010.1|  RNA polymerase I-specific transcription init...  49.7    2e-04   
emb|CDQ96191.1|  unnamed protein product                              49.7    3e-04   
gb|EST06056.1|  RNA polymerase I transcription factor                 49.7    3e-04   
ref|XP_008392869.1|  PREDICTED: RNA polymerase I-specific transcr...  49.7    3e-04   
ref|XP_001269873.1|  RNA polymerase I-specific transcription init...  49.7    3e-04   
ref|XP_002373003.1|  RNA polymerase I-specific transcription init...  49.7    3e-04   
ref|XP_007391310.1|  hypothetical protein PHACADRAFT_25394            49.7    3e-04   
dbj|BAE55848.1|  unnamed protein product                              49.7    3e-04   
gb|EPS29634.1|  hypothetical protein PDE_04584                        49.3    3e-04   
ref|XP_003322700.1|  hypothetical protein PGTG_04237                  49.3    3e-04   
gb|EYE93649.1|  RNA polymerase I-specific transcription initiatio...  49.3    3e-04   
gb|KIK45936.1|  hypothetical protein CY34DRAFT_800948                 49.3    3e-04   
ref|NP_593674.1|  ribosomal DNA (rDNA) transcription factor Rrn3      49.3    3e-04   
gb|KIN04833.1|  hypothetical protein OIDMADRAFT_101721                49.3    3e-04   
ref|XP_008291505.1|  PREDICTED: RNA polymerase I-specific transcr...  49.3    4e-04   
gb|EWM25090.1|  rna polymerase i-specific transcription initiatio...  49.3    4e-04   
ref|XP_002841823.1|  hypothetical protein                             48.9    4e-04   
ref|NP_788084.1|  Tif-IA                                              48.9    4e-04   
ref|XP_011447139.1|  PREDICTED: RNA polymerase I-specific transcr...  48.9    5e-04   
ref|XP_004335689.1|  RNA polymerase I specific transcription init...  48.9    5e-04   
ref|XP_009217539.1|  hypothetical protein GGTG_01508                  48.9    5e-04   
ref|XP_003964421.1|  PREDICTED: RNA polymerase I-specific transcr...  48.5    6e-04   
ref|XP_007779522.1|  hypothetical protein W97_03435                   48.5    6e-04   
gb|EPX70629.1|  ribosomal DNA transcription factor Rrn3               48.5    6e-04   
ref|XP_002740429.1|  PREDICTED: RNA polymerase I-specific transcr...  48.5    6e-04   
emb|CAG00803.1|  unnamed protein product                              48.5    7e-04   
ref|XP_003038007.1|  RNA polymerase I-specific transcription init...  48.5    7e-04   
ref|XP_010180357.1|  PREDICTED: RNA polymerase I-specific transcr...  48.1    7e-04   
gb|KFQ33308.1|  RNA polymerase I-specific transcription initiatio...  48.1    7e-04   
gb|KIK96058.1|  hypothetical protein PAXRUDRAFT_139331                48.5    7e-04   
gb|KFA66511.1|  hypothetical protein S40285_00775                     48.1    8e-04   
ref|XP_001837476.1|  RNA polymerase I-specific transcription init...  48.1    8e-04   
gb|KEY70648.1|  hypothetical protein S7711_02251                      48.1    8e-04   
emb|CAN73685.1|  hypothetical protein VITISV_019843                   48.5    8e-04   
ref|XP_002149987.1|  RNA polymerase I-specific transcription init...  48.1    9e-04   
gb|ESZ97945.1|  hypothetical protein SBOR_1668                        48.1    9e-04   
gb|KFX42414.1|  RNA polymerase I-specific transcription initiatio...  48.1    9e-04   
ref|XP_972768.1|  PREDICTED: RNA polymerase I-specific transcript...  48.1    9e-04   
emb|CDQ85574.1|  unnamed protein product                              47.8    0.001   
ref|XP_010001593.1|  PREDICTED: RNA polymerase I-specific transcr...  48.1    0.001   
dbj|GAK64919.1|  RNA polymerase I-specific transcription initiati...  48.1    0.001   
gb|KFX42415.1|  RNA polymerase I-specific transcription initiatio...  48.1    0.001   
ref|XP_007583494.1|  putative rna polymerase i specific transcrip...  47.8    0.001   



>ref|XP_009777635.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Nicotiana sylvestris]
 ref|XP_009777636.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X2 [Nicotiana sylvestris]
Length=569

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 5/146 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL+GP+DDGQQ+     I    W++R    +ASAQKLDSLMVL FE+   C ES
Sbjct  201  FDMELEDLDGPVDDGQQDGDQLRIS---WMERL--GNASAQKLDSLMVLTFEHLNFCQES  255

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+TLL SF+ TVLTAYKSKFAQFVMFYAC+LDPENCG+RFA+ L  IF++S++ 
Sbjct  256  GRLSQVFETLLQSFQHTVLTAYKSKFAQFVMFYACTLDPENCGRRFADTLFDIFKSSIYP  315

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            +WRMSAVAYLASYLARA+F+ +  VA
Sbjct  316  QWRMSAVAYLASYLARAKFLSISSVA  341



>ref|XP_009619798.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Nicotiana tomentosiformis]
Length=570

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL+GP+DDGQQ   D +  R  W++R    +ASAQKLDSLMVL FE+   C ES
Sbjct  201  FDMELEDLDGPVDDGQQ---DVDQLRISWMERL--GNASAQKLDSLMVLTFEHLNFCKES  255

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+TLL SF+ TVLTAYKSKFAQFVMFYAC+LDPENCG+RFA+ L  IF++S++ 
Sbjct  256  GRLSQVFETLLQSFQHTVLTAYKSKFAQFVMFYACTLDPENCGRRFADTLFDIFKSSIYP  315

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            +WRMSAVAYLASYLARA+F+ +  VA
Sbjct  316  QWRMSAVAYLASYLARAKFLSISSVA  341



>ref|XP_009619796.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009619797.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Nicotiana tomentosiformis]
Length=620

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL+GP+DDGQQ   D +  R  W++R    +ASAQKLDSLMVL FE+   C ES
Sbjct  251  FDMELEDLDGPVDDGQQ---DVDQLRISWMERL--GNASAQKLDSLMVLTFEHLNFCKES  305

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+TLL SF+ TVLTAYKSKFAQFVMFYAC+LDPENCG+RFA+ L  IF++S++ 
Sbjct  306  GRLSQVFETLLQSFQHTVLTAYKSKFAQFVMFYACTLDPENCGRRFADTLFDIFKSSIYP  365

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            +WRMSAVAYLASYLARA+F+ +  VA
Sbjct  366  QWRMSAVAYLASYLARAKFLSISSVA  391



>ref|XP_009777634.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Nicotiana sylvestris]
Length=619

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 5/146 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL+GP+DDGQQ+     I    W++R    +ASAQKLDSLMVL FE+   C ES
Sbjct  251  FDMELEDLDGPVDDGQQDGDQLRIS---WMERL--GNASAQKLDSLMVLTFEHLNFCQES  305

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+TLL SF+ TVLTAYKSKFAQFVMFYAC+LDPENCG+RFA+ L  IF++S++ 
Sbjct  306  GRLSQVFETLLQSFQHTVLTAYKSKFAQFVMFYACTLDPENCGRRFADTLFDIFKSSIYP  365

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            +WRMSAVAYLASYLARA+F+ +  VA
Sbjct  366  QWRMSAVAYLASYLARAKFLSISSVA  391



>ref|XP_009618724.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nicotiana tomentosiformis]
Length=690

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 5/146 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL+GP+DDGQQ+     I    W++R    +ASAQKLDSLMVL FE+   C ES
Sbjct  320  FDMELEDLDGPVDDGQQDGDQLRIS---WMERL--GNASAQKLDSLMVLTFEHLNFCKES  374

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+TLL SF+ TVLTAYKSKFAQFVMFYAC+LDPENCG+RFA+ L  IF++S++ 
Sbjct  375  GRLSQVFETLLQSFQHTVLTAYKSKFAQFVMFYACTLDPENCGRRFADTLFDIFKSSIYP  434

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            +WRMSAVAYLASYLARA+F+ +  VA
Sbjct  435  QWRMSAVAYLASYLARAKFLSISSVA  460



>ref|XP_004232589.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Solanum lycopersicum]
Length=617

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+EL DLE P+DDGQQ   + +I    W++R+F  + +AQKLDSL+VL FE+   C ES
Sbjct  247  FDMELGDLEWPMDDGQQNGDELQIS---WMERYFSGNLNAQKLDSLIVLTFEHLNICKES  303

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF TLL SF++TVL AYKSKFAQFV+FYACSLDPENCG+RFA+ L H F++S + 
Sbjct  304  GRLSQVFHTLLQSFQQTVLMAYKSKFAQFVLFYACSLDPENCGRRFADTLFHKFKSSKYP  363

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            EWRMSAVAYLASYLARA+F+ + FVA
Sbjct  364  EWRMSAVAYLASYLARAKFLPISFVA  389



>ref|XP_006364840.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Solanum tuberosum]
Length=618

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+EL DLE P+DDGQQ   + +I    W++R+F  + +AQKLDSL+VL FE+   C ES
Sbjct  247  FDMELGDLEWPMDDGQQNGDELQIS---WMERYFSGNLNAQKLDSLIVLTFEHLNFCKES  303

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF TLL SF++TVL AYKSKFAQFV+FYACSLDPENCG+RFA+ L H F++S + 
Sbjct  304  GRLSQVFHTLLQSFQQTVLMAYKSKFAQFVLFYACSLDPENCGRRFADTLFHKFKSSKYP  363

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            EWRMSAVAYLASYLARA+F+ + FVA
Sbjct  364  EWRMSAVAYLASYLARAKFLPISFVA  389



>ref|XP_009773556.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nicotiana sylvestris]
Length=801

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 5/146 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL+GP+DDGQQ+     I    W++R    +ASAQKLDSLMVL FE+   C ES
Sbjct  431  FDMELEDLDGPVDDGQQDGDQLRIS---WMERL--GNASAQKLDSLMVLTFEHLNFCKES  485

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+TLL SF+ TVLTAYKSKFAQFVMFYAC+LDPENCG+RFA+ L  IF++S++ 
Sbjct  486  GRLSQVFETLLQSFQHTVLTAYKSKFAQFVMFYACTLDPENCGRRFADTLFDIFKSSIYP  545

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            +WRMSAVAYLASYLARA+F  +  VA
Sbjct  546  QWRMSAVAYLASYLARAKFFSISSVA  571



>gb|EPS68922.1| hypothetical protein M569_05845, partial [Genlisea aurea]
Length=367

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 115/147 (78%), Gaps = 2/147 (1%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED +G  DD  Q+    E+ R+  + RFF  +  A+KLDSLMVL FE+ ++C + 
Sbjct  216  FDMELEDFDGQADDAMQDGT--ELTREALLQRFFSGNLVAEKLDSLMVLTFEHLLACFKD  273

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+TLL SF+KT+LTAYKSKFAQFV+FYACSLDPE CG+ FAN L+++F +  + 
Sbjct  274  GRLSQVFETLLQSFQKTILTAYKSKFAQFVIFYACSLDPEGCGEAFANTLLNLFMSCANP  333

Query  83   EWRMSAVAYLASYLARARFMDMPFVAA  3
            EWRMSAVAYLASYLARA+F+ + FVA+
Sbjct  334  EWRMSAVAYLASYLARAKFLSVSFVAS  360



>ref|XP_011087416.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Sesamum indicum]
Length=626

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDLEG  D  +Q+    E+ R+  I RFF  +  A+KLDSLMVL FE+  SC ES
Sbjct  245  FDMELEDLEGHADHIEQDCN--ELTREALIQRFFSGNLVAEKLDSLMVLTFEHLRSCAES  302

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+ LL SF+KT+LTAYKSKFAQFVMFYACSLDPENCGK FA++L++IF +S++ 
Sbjct  303  GRLVQVFEILLQSFQKTILTAYKSKFAQFVMFYACSLDPENCGKMFADLLLNIFVSSLNP  362

Query  83   EWRMSAVAYLASYLARARFMDMPFVAA  3
            EWRMSAVAYLASYLARA+F+ +  VAA
Sbjct  363  EWRMSAVAYLASYLARAKFVPVSSVAA  389



>emb|CDP01757.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F +ELE LEGP DD   E     +QR+ WI+RFFG +  A+KLDSL+VL+F +  S  E+
Sbjct  250  FQMELEGLEGPADDDGDE-----LQRNDWIERFFGGNLVAEKLDSLLVLVFGHLKSSYEN  304

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VFDTLL SF KTVLTAYKSKFAQFVMFYACSLDP+NCG  FA  L++IFE S + 
Sbjct  305  GRLEQVFDTLLQSFHKTVLTAYKSKFAQFVMFYACSLDPDNCGTNFAVTLVNIFEGSSYT  364

Query  83   EWRMSAVAYLASYLARARFMDMPFVAA  3
            EWRMSAVAYLASYL+RA+F+   FV +
Sbjct  365  EWRMSAVAYLASYLSRAKFVSASFVIS  391



>gb|EYU37427.1| hypothetical protein MIMGU_mgv1a004171mg [Erythranthe guttata]
Length=541

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDLEG  +D  +E  D ++ RD+ I RFF  +  AQKLDSLMVL FE+F SC+E 
Sbjct  161  FDMELEDLEGHAEDHIEEDSD-KVSRDLIIQRFFSGNLVAQKLDSLMVLTFEHFNSCHER  219

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF T L SF+KT++TAYKSKF QFVMFYACSLDPE CG RF + L+ IF T+ + 
Sbjct  220  GRLDKVFATFLESFKKTIMTAYKSKFTQFVMFYACSLDPEICGTRFTDELLKIFMTNSNP  279

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
            EWRMSAVAYLASYLARARF+ +   A
Sbjct  280  EWRMSAVAYLASYLARARFVPVTVAA  305



>emb|CBI37506.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+E P DD + +    E+ R     +  G +  A+KLDSLMVL FE+  SC   
Sbjct  248  FEMELEDMEEPADDVENDGG--ELHRGSLSRKSLGGNLIAEKLDSLMVLTFEHLESCEAG  305

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+TL+LSF+ TVL A+KSKFAQFVMFYAC+LDPENCG RFA +L   F  S   
Sbjct  306  GRLIEVFETLVLSFQTTVLNAFKSKFAQFVMFYACALDPENCGVRFARVLADFFVCSTFP  365

Query  83   EW-RMSAVAYLASYLARARFMDMPFVA  6
               RMSAVAYLASYL+R +F+   FVA
Sbjct  366  PLNRMSAVAYLASYLSRGKFLTASFVA  392



>ref|XP_010649342.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Vitis vinifera]
Length=627

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+E P DD + +    E+ R     +  G +  A+KLDSLMVL FE+  SC   
Sbjct  248  FEMELEDMEEPADDVENDGG--ELHRGSLSRKSLGGNLIAEKLDSLMVLTFEHLESCEAG  305

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+TL+LSF+ TVL A+KSKFAQFVMFYAC+LDPENCG RFA +L   F  S   
Sbjct  306  GRLIEVFETLVLSFQTTVLNAFKSKFAQFVMFYACALDPENCGVRFARVLADFFVCSTFP  365

Query  83   EW-RMSAVAYLASYLARARFMDMPFVA  6
               RMSAVAYLASYL+R +F+   FVA
Sbjct  366  PLNRMSAVAYLASYLSRGKFLTASFVA  392



>ref|XP_008242108.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Prunus mume]
Length=622

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDM-WIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            F++ELED++   DDG  +  D E+ R + W  +  G ++ A+KLDSLMVLIFE+  SC  
Sbjct  245  FEMELEDVDESRDDGLND--DSELPRKLSW--KTSGGNSFAEKLDSLMVLIFEHLESCQV  300

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            + RL ++FDTLL SF+KTVLTAYKSKFAQFV+FYACSLDP+NCG  FA ML H F  S +
Sbjct  301  ADRLIKIFDTLLESFKKTVLTAYKSKFAQFVIFYACSLDPKNCGVTFALMLEHTFFFSTN  360

Query  86   LE-WRMSAVAYLASYLARARFMDMPFVA  6
                RMSAVAYLASYL+RA+F+ +  VA
Sbjct  361  RPLLRMSAVAYLASYLSRAKFLSVFVVA  388



>ref|XP_010272853.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nelumbo nucifera]
Length=631

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 101/148 (68%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED++  ID  + + F  E  R     +  G +A A KLDSLMVLI E+  SC + 
Sbjct  248  FDMELEDVDDIIDHAEIDGF--EHPRGTAGSQILGTNAVADKLDSLMVLICEHLKSCADG  305

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
             RL +VF+TLL SF  TVL AYKSKF+QFVMFYACSLDPE+CG+RFA  L  IF    H 
Sbjct  306  ERLTKVFETLLQSFWVTVLNAYKSKFSQFVMFYACSLDPEHCGERFAVFLADIFVCRTHP  365

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL+R +F+ +  +A+
Sbjct  366  ALTRMSAVAYLASYLSRGKFLPLSLIAS  393



>ref|XP_007204094.1| hypothetical protein PRUPE_ppa002914mg [Prunus persica]
 gb|EMJ05293.1| hypothetical protein PRUPE_ppa002914mg [Prunus persica]
Length=622

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 105/148 (71%), Gaps = 4/148 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED++   DD   +  D E+ R +   +  G ++ A+KLDSLMVL FE+  SC  +
Sbjct  245  FEMELEDVDESRDDDLND--DSELPRQLS-RKTLGGNSFAEKLDSLMVLTFEHLESCQVA  301

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
             RL  +FDTLL SF+KTVLTAYKSKFAQFV+FYACSLDP+NCG  FA ML H F  S + 
Sbjct  302  DRLIEIFDTLLESFKKTVLTAYKSKFAQFVIFYACSLDPKNCGVTFALMLEHTFFFSTNP  361

Query  83   E-WRMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL+RA+F+ +  VA 
Sbjct  362  PLLRMSAVAYLASYLSRAKFLSVFVVAG  389



>ref|XP_010272854.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nelumbo nucifera]
 ref|XP_010272855.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Nelumbo nucifera]
Length=631

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 98/148 (66%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED++  I  G  E   FE  R     +  G +A A KLDSLMVL  E+  SC + 
Sbjct  248  FDMELEDVDDII--GYAEKDGFEHPRGTLGRQSLGTNAVADKLDSLMVLACEHLKSCADG  305

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
             RL +VF+TLL SF  T+L AYKSKF+QFVMFYACSLDPE+CG+RFA  L  IF    H 
Sbjct  306  ERLTKVFETLLQSFWVTILNAYKSKFSQFVMFYACSLDPEHCGERFAVFLADIFVCRTHP  365

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL+R +F+    +A+
Sbjct  366  ALTRMSAVAYLASYLSRGKFLPPSLIAS  393



>gb|KHF98889.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Gossypium arboreum]
Length=523

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 100/141 (71%), Gaps = 6/141 (4%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED++   +  + +  +F + R     +    ++ A+ LD+L+VL FE+  SC   
Sbjct  247  FEMELEDVDDIEESAEPDVGEFRLSR-----KSLAGNSIAELLDNLLVLTFEHLESCERE  301

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF-ETSVH  87
            GRL +VF+TLL SF+ TVL+AYKSKFAQFVMFYAC+LDPENCG RFA ML  +F + S  
Sbjct  302  GRLAKVFETLLQSFQVTVLSAYKSKFAQFVMFYACALDPENCGMRFATMLADLFVQDSQP  361

Query  86   LEWRMSAVAYLASYLARARFM  24
               RMSAV+YLASYL+RA+F+
Sbjct  362  QPTRMSAVSYLASYLSRAKFL  382



>ref|XP_006483467.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Citrus sinensis]
Length=535

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+E   DD +Q     E+       +    +  A+ LDSLMVL FE+  SC  +
Sbjct  158  FEMELEDVEEAADDAEQ--VGDELPSGSLSRKSLSGNLIAELLDSLMVLTFEHLESCEGT  215

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+ LL SF+ TVL AYKSKFAQFVMFYAC+LDPENCG RFA ML  +F + ++ 
Sbjct  216  GRLIEVFEILLQSFQITVLNAYKSKFAQFVMFYACALDPENCGLRFATMLADVFVSGLYP  275

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAV+YLAS+L+RARF+   F+ +
Sbjct  276  PLTRMSAVSYLASFLSRARFLSPCFIVS  303



>ref|XP_006483561.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X3 [Citrus sinensis]
Length=534

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+E   DD +Q     E+       +    +  A+ LDSL+VL FE+  SC  +
Sbjct  251  FEMELEDVEEAADDAEQ--VGDELPSGSISRKSLSGNLIAELLDSLLVLTFEHLESCEGT  308

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+ LL SF+ TVL AYKSKFAQFVMFYAC+LDPENCG RFA ML  +F + ++ 
Sbjct  309  GRLIEVFEILLQSFQITVLNAYKSKFAQFVMFYACALDPENCGLRFATMLADVFVSGLYP  368

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMS+V+YLASYL+RARF+   F+ +
Sbjct  369  PLTRMSSVSYLASYLSRARFLSPCFIVS  396



>ref|XP_006483466.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Citrus sinensis]
Length=628

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+E   DD +Q     E+       +    +  A+ LDSLMVL FE+  SC  +
Sbjct  251  FEMELEDVEEAADDAEQ--VGDELPSGSLSRKSLSGNLIAELLDSLMVLTFEHLESCEGT  308

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+ LL SF+ TVL AYKSKFAQFVMFYAC+LDPENCG RFA ML  +F + ++ 
Sbjct  309  GRLIEVFEILLQSFQITVLNAYKSKFAQFVMFYACALDPENCGLRFATMLADVFVSGLYP  368

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAV+YLAS+L+RARF+   F+ +
Sbjct  369  PLTRMSAVSYLASFLSRARFLSPCFIVS  396



>ref|XP_010088711.1| hypothetical protein L484_016497 [Morus notabilis]
 gb|EXB36892.1| hypothetical protein L484_016497 [Morus notabilis]
Length=616

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -1

Query  377  EIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAY  198
            E+ R   +   F     A+KLDSLMVLIFE+  SC    RL  VF+TLL  F+KTVLTAY
Sbjct  272  ELSRKSLVGNLF-----ARKLDSLMVLIFEHLESCEVGRRLVEVFETLLQPFQKTVLTAY  326

Query  197  KSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-WRMSAVAYLASYLARARFMD  21
            KSKF+QFVMFYAC+LDPENCG RFANML   F ++ H    RMSAVAYLASYL+R +F+ 
Sbjct  327  KSKFSQFVMFYACALDPENCGVRFANMLGDTFISNSHPPLLRMSAVAYLASYLSRGKFLS  386

Query  20   MPFVA  6
               +A
Sbjct  387  TSLIA  391



>ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X2 [Citrus sinensis]
Length=535

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+E   DD +Q     E+       +    +  A+ LDSL+VL FE+  SC  +
Sbjct  158  FEMELEDVEEAADDAEQ--VGDELPSGSISRKSLSGNLIAELLDSLLVLTFEHLESCEGT  215

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+ LL SF+ TVL AYKSKFAQFVMFYAC+LDPENCG RFA ML  +F + ++ 
Sbjct  216  GRLIEVFEILLQSFQITVLNAYKSKFAQFVMFYACALDPENCGLRFATMLADVFVSGLYP  275

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMS+V+YLASYL+RARF+   F+ +
Sbjct  276  PLTRMSSVSYLASYLSRARFLSPCFIVS  303



>ref|XP_002881355.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57614.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Arabidopsis lyrata subsp. lyrata]
Length=614

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +EG I++G +      +++D         S  ++ LD LMV+ FE+  SC  
Sbjct  254  FDMELEDAVEGTINEGDELPVG-PLKQDTS-----DGSVVSKLLDKLMVVAFEHLESCQN  307

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETS-V  90
             GRL +VFD LL SFE  +L  YKSKF QF+MFYACSLDPENCG +FA+ L+ IF +S  
Sbjct  308  DGRLDQVFDILLESFENFILNTYKSKFTQFLMFYACSLDPENCGVKFASKLVEIFLSSNK  367

Query  89   HLEWRMSAVAYLASYLARARFMDMPFVAA  3
            H   RMSAVAYLAS+LAR +F+ + FVA+
Sbjct  368  HPSTRMSAVAYLASFLARGKFLPVSFVAS  396



>ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X1 [Citrus sinensis]
Length=628

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+E   DD +Q     E+       +    +  A+ LDSL+VL FE+  SC  +
Sbjct  251  FEMELEDVEEAADDAEQ--VGDELPSGSISRKSLSGNLIAELLDSLLVLTFEHLESCEGT  308

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+ LL SF+ TVL AYKSKFAQFVMFYAC+LDPENCG RFA ML  +F + ++ 
Sbjct  309  GRLIEVFEILLQSFQITVLNAYKSKFAQFVMFYACALDPENCGLRFATMLADVFVSGLYP  368

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMS+V+YLASYL+RARF+   F+ +
Sbjct  369  PLTRMSSVSYLASYLSRARFLSPCFIVS  396



>ref|XP_009369775.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Pyrus x bretschneideri]
Length=627

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELE +   +DD   +  D EI R +   +  G ++ A+KLDSL+VL FE+  SC   
Sbjct  253  FEMELEAVHESMDDDLND--DSEIARKLST-KVSGSNSFAEKLDSLLVLTFEHLESCEVG  309

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+TLL SF++TVLTAYKSKFAQFV+FYACSLDP NCG  FA ML + F  S + 
Sbjct  310  GRLIEVFETLLESFKRTVLTAYKSKFAQFVIFYACSLDPGNCGVTFALMLENTFFCSTNP  369

Query  83   E-WRMSAVAYLASYLARARFMDMPFVA  6
               RMSAV+YLASYL+RA+F+    +A
Sbjct  370  PLLRMSAVSYLASYLSRAKFLSASVIA  396



>ref|XP_008354575.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Malus domestica]
Length=627

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELE +    DD   +  D EI R +   +  G ++ A+KLDSL+VL FE+  SC   
Sbjct  253  FEMELEAVHESTDDDLND--DSEIARKLST-KVSGSNSFAEKLDSLLVLTFEHLESCEVG  309

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+TLL SF++TVLTAYKSKFAQFV+FYACSLDP NCG  FA ML + F  S + 
Sbjct  310  GRLIEVFETLLESFKRTVLTAYKSKFAQFVIFYACSLDPGNCGVTFALMLENTFFCSTNP  369

Query  83   E-WRMSAVAYLASYLARARFMDMPFVA  6
               RMSAV+YLASYL+RA+F+    +A
Sbjct  370  PLLRMSAVSYLASYLSRAKFLSASVIA  396



>gb|KJB18645.1| hypothetical protein B456_003G064600 [Gossypium raimondii]
 gb|KJB18646.1| hypothetical protein B456_003G064600 [Gossypium raimondii]
Length=629

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 99/141 (70%), Gaps = 6/141 (4%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED++   +  + +  +F + R     +    ++ A+ LD+L+VL FE+  SC   
Sbjct  247  FEMELEDVDDIEESAEPDVGEFRLSR-----KSLAGNSIAELLDNLLVLTFEHLESCERE  301

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF-ETSVH  87
            GRL +VF+TLL SF  TVL+AYKSKFAQFVMFYAC+LDPENCG RFA +L  +F + S  
Sbjct  302  GRLAKVFETLLQSFRVTVLSAYKSKFAQFVMFYACALDPENCGMRFATVLADLFVQDSQP  361

Query  86   LEWRMSAVAYLASYLARARFM  24
               RMSAV+YLASYL+RA+F+
Sbjct  362  QPTRMSAVSYLASYLSRAKFL  382



>gb|KCW53303.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis]
Length=609

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A+KLDSL+VL FEY  SC   GRL  VF+TLL SF  TVL AYKSKF+QFVMFYAC+LDP
Sbjct  261  AEKLDSLLVLTFEYLESCQGRGRLLEVFETLLHSFRITVLNAYKSKFSQFVMFYACALDP  320

Query  146  ENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARARFMDMPFVAA  3
            ENCG RFA ML+ IF    H    RMSAVAYLASYL+R +F+   ++  
Sbjct  321  ENCGVRFARMLLDIFVCHDHPPNTRMSAVAYLASYLSRGKFLSTSYITT  369



>gb|KCW53301.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis]
Length=634

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A+KLDSL+VL FEY  SC   GRL  VF+TLL SF  TVL AYKSKF+QFVMFYAC+LDP
Sbjct  286  AEKLDSLLVLTFEYLESCQGRGRLLEVFETLLHSFRITVLNAYKSKFSQFVMFYACALDP  345

Query  146  ENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARARFMDMPFVAA  3
            ENCG RFA ML+ IF    H    RMSAVAYLASYL+R +F+   ++  
Sbjct  346  ENCGVRFARMLLDIFVCHDHPPNTRMSAVAYLASYLSRGKFLSTSYITT  394



>ref|XP_010033606.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Eucalyptus grandis]
 gb|KCW53302.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis]
Length=633

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A+KLDSL+VL FEY  SC   GRL  VF+TLL SF  TVL AYKSKF+QFVMFYAC+LDP
Sbjct  285  AEKLDSLLVLTFEYLESCQGRGRLLEVFETLLHSFRITVLNAYKSKFSQFVMFYACALDP  344

Query  146  ENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARARFMDMPFVAA  3
            ENCG RFA ML+ IF    H    RMSAVAYLASYL+R +F+   ++  
Sbjct  345  ENCGVRFARMLLDIFVCHDHPPNTRMSAVAYLASYLSRGKFLSTSYITT  393



>dbj|BAF01881.1| hypothetical protein [Arabidopsis thaliana]
Length=410

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELEDL-EGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED  EG ++DG +      +++D         S  ++ LD LMV+ FE+  SC  
Sbjct  52   FDMELEDAAEGTMNDGDELPVG-PLKQDTS-----DGSIVSKLLDKLMVVAFEHLESCQN  105

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETS-V  90
             GRL +VF++L  SFE  +L  YKSKF QF++FYACSLDPENCG +FA+ L+ IF +S  
Sbjct  106  DGRLDQVFESLFKSFENFILNTYKSKFTQFLIFYACSLDPENCGVKFASKLVEIFLSSNK  165

Query  89   HLEWRMSAVAYLASYLARARFMDMPFVAA  3
            H+  RMSAVAYLAS+LAR +F+ + FVA+
Sbjct  166  HVATRMSAVAYLASFLARGKFLPVSFVAS  194



>ref|NP_850236.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
 gb|AAM20140.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13210.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09018.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
Length=613

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELEDL-EGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED  EG ++DG +      +++D         S  ++ LD LMV+ FE+  SC  
Sbjct  255  FDMELEDAAEGTMNDGDELPVG-PLKQDTS-----DGSIVSKLLDKLMVVAFEHLESCQN  308

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETS-V  90
             GRL +VF++L  SFE  +L  YKSKF QF++FYACSLDPENCG +FA+ L+ IF +S  
Sbjct  309  DGRLDQVFESLFKSFENFILNTYKSKFTQFLIFYACSLDPENCGVKFASKLVEIFLSSNK  368

Query  89   HLEWRMSAVAYLASYLARARFMDMPFVAA  3
            H+  RMSAVAYLAS+LAR +F+ + FVA+
Sbjct  369  HVATRMSAVAYLASFLARGKFLPVSFVAS  397



>ref|XP_002524432.1| transcription initiation factor ia, putative [Ricinus communis]
 gb|EEF37967.1| transcription initiation factor ia, putative [Ricinus communis]
Length=640

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 96/147 (65%), Gaps = 2/147 (1%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F IELED +   DD +   +  E+ R +   +  GE+ +A  LDSLMV IFE+   C  +
Sbjct  263  FAIELEDADEVSDDDEYNDYG-ELPRTLS-HKSLGENVAADLLDSLMVRIFEHLELCANN  320

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
             RL  VF+TLL SF  T+L  YKSKFAQFVMFYAC+LDPENCG  FA  L   F    + 
Sbjct  321  KRLNDVFETLLDSFMLTILNTYKSKFAQFVMFYACALDPENCGVEFAERLRDRFTYGENP  380

Query  83   EWRMSAVAYLASYLARARFMDMPFVAA  3
              RMSAVAYLASYLARA+F+ + FVA+
Sbjct  381  LTRMSAVAYLASYLARAKFLPIAFVAS  407



>ref|XP_004508346.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Cicer arietinum]
 ref|XP_004508347.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Cicer arietinum]
 ref|XP_004508348.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X3 [Cicer arietinum]
Length=620

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 98/148 (66%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELE++     D  +  F+     DM        +  A++LDSL+VLIF +  SC  S
Sbjct  249  FELELEEI-AEFADEDENIFNMSTT-DMLNRNNLQGNKVAEQLDSLIVLIFLHLESCQSS  306

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GR+  VFD LL SFE+TVL AYKSKF QFVMFYAC+LDPE CG +FA +L  +F + V+ 
Sbjct  307  GRIAEVFDILLKSFERTVLNAYKSKFTQFVMFYACALDPEGCGVKFAMVLTEMFGSDVNP  366

Query  83   E-WRMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL+RA+F+    VA+
Sbjct  367  PITRMSAVAYLASYLSRAKFLSSALVAS  394



>gb|KHN38852.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Glycine soja]
Length=628

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 96/148 (65%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+    D  + E+ D  +  ++   +    +   +KLDSLMVL F +  SC  S
Sbjct  247  FEMELEDVTEFTD--EDENCDSMLSSELLNRKNLQGNLVVEKLDSLMVLAFLHLESCQNS  304

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+TLL SF++TVL AYKSKF QFVMFYAC+LDPE CG +FA +L  +F    + 
Sbjct  305  GRLAEVFNTLLASFQRTVLNAYKSKFTQFVMFYACALDPEGCGVKFAMVLADMFGGDANP  364

Query  83   E-WRMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL RA+F+    V +
Sbjct  365  PITRMSAVAYLASYLTRAKFLSAALVTS  392



>ref|XP_003534228.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Glycine max]
Length=628

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 96/148 (65%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+    D  + E+ D  +  ++   +    +   +KLDSLMVL F +  SC  S
Sbjct  247  FEMELEDVTEFTD--EDENCDSMLSSELLNRKNLQGNLVVEKLDSLMVLAFLHLESCQNS  304

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+TLL SF++TVL AYKSKF QFVMFYAC+LDPE CG +FA +L  +F    + 
Sbjct  305  GRLAEVFNTLLASFQRTVLNAYKSKFTQFVMFYACALDPEGCGVKFAMVLADMFGGDANP  364

Query  83   E-WRMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL RA+F+    V +
Sbjct  365  PITRMSAVAYLASYLTRAKFLSAALVTS  392



>ref|XP_010540653.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Tarenaya hassleriana]
Length=614

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 96/148 (65%), Gaps = 4/148 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED +   D     +++ E  R+    +    +  ++ LD LMV+ FE+  SC  +
Sbjct  248  FDMELEDAD---DVEDTVNYEDEFPREFLDKKNIRGNIVSELLDKLMVITFEHLESCQNT  304

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF++L  SFE  +L  YKSKFAQFVMFYACSLDPENCG++FA  L  IF +S   
Sbjct  305  GRLDEVFESLFESFENFILNTYKSKFAQFVMFYACSLDPENCGEKFACKLADIFLSSSKP  364

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL+R +F+   FVA+
Sbjct  365  PLTRMSAVAYLASYLSRGKFLSPSFVAS  392



>ref|XP_006410626.1| hypothetical protein EUTSA_v10016395mg [Eutrema salsugineum]
 gb|ESQ52079.1| hypothetical protein EUTSA_v10016395mg [Eutrema salsugineum]
Length=616

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 100/149 (67%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +EG +++G +      + +D       G    ++ LD LMV+ FE+  SC  
Sbjct  255  FDMELEDAVEGTMNEGDELPVG-SVNQDTS-----GGDIMSECLDKLMVISFEHLESCQN  308

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            +GRL +VF+ L  SFE  +L  YKSK +QF+MFYACSLDPENCG +F++ L+ IF +S  
Sbjct  309  AGRLDQVFENLFASFENFILNTYKSKVSQFLMFYACSLDPENCGAKFSSKLVDIFLSSNK  368

Query  86   LE-WRMSAVAYLASYLARARFMDMPFVAA  3
                RMSAVAYLASYLARA+F+ + FVA+
Sbjct  369  PRPTRMSAVAYLASYLARAKFLPVYFVAS  397



>ref|XP_007046443.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046444.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046445.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90600.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90601.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90602.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=628

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 94/134 (70%), Gaps = 6/134 (4%)
 Frame = -1

Query  401  GQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSF  222
             +Q++ +F + R     +    ++ A+ LD+L+VL FE+  SC  +GRL +VF+TLL SF
Sbjct  261  AEQDTGEFRLSR-----KSLAGNSIAELLDNLLVLTFEHLESCERAGRLAKVFETLLQSF  315

Query  221  EKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-WRMSAVAYLASY  45
            + TV++AYKSKF QFVMFYAC+LDP+ CG RFA ML  +F    H +  RMSAVAYLASY
Sbjct  316  QITVMSAYKSKFTQFVMFYACALDPDYCGMRFATMLADLFVQDSHPQPIRMSAVAYLASY  375

Query  44   LARARFMDMPFVAA  3
            L+RA+F+    +++
Sbjct  376  LSRAKFLSASLISS  389



>ref|XP_010516632.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010516633.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010516634.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010516635.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
Length=615

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 98/149 (66%), Gaps = 7/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +EG ID+G +    F +   +  D   G    ++ LD LMV+ FE+  SC  
Sbjct  254  FDMELEDAVEGTIDEGDE----FPVG-PLSQDTSGGSIVVSELLDKLMVIAFEHLESCQN  308

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
             GRL  VF+ L  SFE  VL  YKSKF+QF+MFYACSLDPENCG +FA+ L+ IF +S  
Sbjct  309  DGRLDEVFELLFQSFENFVLDTYKSKFSQFLMFYACSLDPENCGVKFASKLMDIFLSSRK  368

Query  86   LE-WRMSAVAYLASYLARARFMDMPFVAA  3
                R SAVAYLAS+LAR +F+ + FVA+
Sbjct  369  SPATRRSAVAYLASFLARGKFLPVSFVAS  397



>ref|XP_010913887.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X3 [Elaeis guineensis]
Length=523

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 5/148 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELE+ E   D+  ++S    I+     +R    +  A+KLDSLMV++ EY   C + 
Sbjct  153  FDMELEEWEENTDNIAKDS----IKNLEESNRILNGNVFAEKLDSLMVIVCEYLKLCADG  208

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            G L +VF+ L+  F +TV+ AYKSKFAQFVMFYACSLDPE CG +FA +L  IF + +  
Sbjct  209  GHLLKVFEMLMEIFRRTVMNAYKSKFAQFVMFYACSLDPEICGLKFAVLLTDIFVSKIES  268

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAV+YLASYL+RA+F+    VA+
Sbjct  269  PLSRMSAVSYLASYLSRAKFISSSLVAS  296



>ref|XP_003547884.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Glycine max]
 ref|XP_006599254.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Glycine max]
Length=627

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+    D  + E+ D     ++   +    +   +KLDSLMVL F +  SC  S
Sbjct  247  FEMELEDVTEFAD--EDENCDSMPPSELLNRKNLQGNLVVEKLDSLMVLAFLHLESCQSS  304

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VFDTLL SF++TVL AYKSKF Q+VMFYAC+LDPE CG +FA +L  +F   V+ 
Sbjct  305  GRLTEVFDTLLASFQRTVLNAYKSKFTQYVMFYACALDPEGCGVKFAMVLADMFGCDVNP  364

Query  83   E-WRMSAVAYLASYLARARFMDMPFVA  6
               RMSA AYLASYL RA+F+    V 
Sbjct  365  PITRMSAAAYLASYLTRAKFLSAALVT  391



>ref|XP_010913886.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Elaeis guineensis]
Length=602

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 5/148 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELE+ E   D+  ++S    I+     +R    +  A+KLDSLMV++ EY   C + 
Sbjct  232  FDMELEEWEENTDNIAKDS----IKNLEESNRILNGNVFAEKLDSLMVIVCEYLKLCADG  287

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            G L +VF+ L+  F +TV+ AYKSKFAQFVMFYACSLDPE CG +FA +L  IF + +  
Sbjct  288  GHLLKVFEMLMEIFRRTVMNAYKSKFAQFVMFYACSLDPEICGLKFAVLLTDIFVSKIES  347

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAV+YLASYL+RA+F+    VA+
Sbjct  348  PLSRMSAVSYLASYLSRAKFISSSLVAS  375



>ref|XP_008438040.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
 ref|XP_008438041.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
 ref|XP_008438042.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
 ref|XP_008438044.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Cucumis melo]
Length=625

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = -1

Query  350  RFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVM  171
            R  G +  A+ LDSL+VL FE+  SC   GRL  VFD LLLSF++TVLTAYKSKFAQFV+
Sbjct  276  RSLGGNVIAETLDSLIVLTFEHLESCERDGRLNEVFDILLLSFQRTVLTAYKSKFAQFVI  335

Query  170  FYACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            FYACSLDPE CG RFA  L  +F +       RMSAV+YLAS+L+R +F+    V  
Sbjct  336  FYACSLDPEVCGARFAVSLADMFVSCNDPPLIRMSAVSYLASFLSRGKFLTTSLVTT  392



>ref|XP_007134114.1| hypothetical protein PHAVU_010G020100g [Phaseolus vulgaris]
 gb|ESW06108.1| hypothetical protein PHAVU_010G020100g [Phaseolus vulgaris]
Length=620

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 95/148 (64%), Gaps = 3/148 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED+    D  + ++     Q ++   +    +   +KLDSL+VL   +  SC  S
Sbjct  247  FDMELEDIIKLAD--EDDNCHNMPQSELLNRKNLQGNQVVEKLDSLIVLALLHLESCQSS  304

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VFD LL SF+KTVL AYKSKF QFVMFYAC+LDPE CG +FA +L  +F + ++ 
Sbjct  305  GRLTEVFDVLLPSFQKTVLNAYKSKFTQFVMFYACALDPEGCGVKFAMVLADMFASDLNP  364

Query  83   E-WRMSAVAYLASYLARARFMDMPFVAA  3
               RMSAVAYLASYL+RA+F+    V  
Sbjct  365  PITRMSAVAYLASYLSRAKFLSAALVTT  392



>ref|XP_010913884.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Elaeis guineensis]
 ref|XP_010913885.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Elaeis guineensis]
Length=626

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 98/148 (66%), Gaps = 5/148 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELE+ E   D+  ++S    I+     +R    +  A+KLDSLMV++ EY   C + 
Sbjct  256  FDMELEEWEENTDNIAKDS----IKNLEESNRILNGNVFAEKLDSLMVIVCEYLKLCADG  311

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            G L +VF+ L+  F +TV+ AYKSKFAQFVMFYACSLDPE CG +FA +L  IF + +  
Sbjct  312  GHLLKVFEMLMEIFRRTVMNAYKSKFAQFVMFYACSLDPEICGLKFAVLLTDIFVSKIES  371

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAV+YLASYL+RA+F+    VA+
Sbjct  372  PLSRMSAVSYLASYLSRAKFISSSLVAS  399



>ref|XP_004287706.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Fragaria vesca subsp. vesca]
Length=628

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 97/151 (64%), Gaps = 12/151 (8%)
 Frame = -1

Query  443  FDIELEDL----EGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFIS  276
            F +ELED+    E  ++DG +++      R+  I+    +S SA+KLD+L+VL FE+  S
Sbjct  250  FQMELEDVDDFSEDFLNDGTEQA------REATINGVTLKS-SAEKLDTLIVLTFEHLES  302

Query  275  CNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFET  96
            C  SGRL  VF TLL +F   VLT  KSKF QFVMFYAC+LDP NCG+ FA  L+ IF  
Sbjct  303  CEASGRLSEVFKTLLETFRNKVLTTCKSKFVQFVMFYACALDPVNCGEEFATNLVEIFVY  362

Query  95   SVHL-EWRMSAVAYLASYLARARFMDMPFVA  6
              +L   RM AVAYLASYL+RA FM    VA
Sbjct  363  DANLTSLRMRAVAYLASYLSRAMFMSASVVA  393



>ref|XP_006296428.1| hypothetical protein CARUB_v10025608mg [Capsella rubella]
 gb|EOA29326.1| hypothetical protein CARUB_v10025608mg [Capsella rubella]
Length=608

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 96/147 (65%), Gaps = 12/147 (8%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +EG I++G       E+          G S +++ LD LMV+ FE+  SC  
Sbjct  255  FDMELEDAVEGTINEGD------ELPARPLNQYKSGGSIASELLDKLMVIAFEHLESCQN  308

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
             GRL +VF+ L  SFE  +L  YKSKF+QF+MFYACSLDPENCG +FA+ L+ IF     
Sbjct  309  DGRLDQVFENLFKSFENFILDTYKSKFSQFLMFYACSLDPENCGVKFASKLVDIF-----  363

Query  86   LEWRMSAVAYLASYLARARFMDMPFVA  6
            L  +MSAV YLAS+LAR +F+ + FVA
Sbjct  364  LFNKMSAVDYLASFLARGKFLPVSFVA  390



>ref|XP_010504951.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504952.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504953.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504954.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504955.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504956.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010504957.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
Length=616

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 95/149 (64%), Gaps = 7/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +EG ID+G +       Q     D   G    ++ LD LMV  FE+  SC  
Sbjct  255  FDMELEDAVEGTIDEGDELPVGPLSQ-----DTSGGSIVVSELLDKLMVKAFEHLESCQN  309

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
             GRL  VF+ L  SFE  +L  YKSK +QF+MFYACSLDPENCG +FA+ L+ IF +S  
Sbjct  310  DGRLDEVFELLFQSFENFILDTYKSKISQFLMFYACSLDPENCGVKFASKLMDIFLSSRK  369

Query  86   LE-WRMSAVAYLASYLARARFMDMPFVAA  3
                R SAVAYLAS+LARA+F+ + FVA+
Sbjct  370  SPATRRSAVAYLASFLARAKFLPVSFVAS  398



>ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Cucumis sativus]
Length=625

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = -1

Query  350  RFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVM  171
            R  G +  A+ LDSL+VL FE+  SC   GRL  VFD LLLSF++TVLTAYKSKFAQF++
Sbjct  276  RSLGGNVIAETLDSLIVLTFEHLESCERDGRLNEVFDILLLSFQRTVLTAYKSKFAQFIV  335

Query  170  FYACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            FYACSLDPE CG RFA  L  +F +       RMSAV+YLAS+L+R +F+    V  
Sbjct  336  FYACSLDPEVCGARFAISLADMFVSCNDPPLIRMSAVSYLASFLSRGKFLTTSLVTT  392



>ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Cucumis sativus]
 gb|KGN56512.1| hypothetical protein Csa_3G122360 [Cucumis sativus]
Length=626

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = -1

Query  350  RFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVM  171
            R  G +  A+ LDSL+VL FE+  SC   GRL  VFD LLLSF++TVLTAYKSKFAQF++
Sbjct  276  RSLGGNVIAETLDSLIVLTFEHLESCERDGRLNEVFDILLLSFQRTVLTAYKSKFAQFIV  335

Query  170  FYACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            FYACSLDPE CG RFA  L  +F +       RMSAV+YLAS+L+R +F+    V  
Sbjct  336  FYACSLDPEVCGARFAISLADMFVSCNDPPLIRMSAVSYLASFLSRGKFLTTSLVTT  392



>ref|XP_006415449.1| hypothetical protein EUTSA_v10007103mg [Eutrema salsugineum]
 gb|ESQ33802.1| hypothetical protein EUTSA_v10007103mg [Eutrema salsugineum]
Length=614

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 95/149 (64%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +EG +D+G +   +   Q  ++ +  F      + LD+LMVL F +  SC  
Sbjct  251  FDMELEDAVEGTMDEGDECPVESLNQNTLYGNVDF------EALDNLMVLTFHHLESCKN  304

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            SGRL  VF+ L  SFE  +L  +KSKF+QF+MFYACSLDPENCG +FA  L+ I+ +   
Sbjct  305  SGRLDEVFEILFESFENFILNTHKSKFSQFLMFYACSLDPENCGVKFATKLLDIYLSGNK  364

Query  86   LEW-RMSAVAYLASYLARARFMDMPFVAA  3
                RMSAVAYL SYL+R  F+   FVA+
Sbjct  365  PRLTRMSAVAYLGSYLSRGLFLPSSFVAS  393



>gb|KEH32234.1| transcription initiation factor ia protein, putative [Medicago 
truncatula]
Length=635

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A+KLDSL+VL F +  SC   GRL  VFD LL SF++TVL  YKSKFAQFVMFYAC+LD 
Sbjct  293  AEKLDSLIVLTFLHLESCQSKGRLAEVFDILLTSFKRTVLNTYKSKFAQFVMFYACALDS  352

Query  146  ENCGKRFANMLIHIFETSVHLE-WRMSAVAYLASYLARARFMDMPFVA  6
            E CG  FA +L  +F++ V+    RMSAVAYLASYL+RA+F+    VA
Sbjct  353  EGCGVNFAMVLTEMFDSRVNPPITRMSAVAYLASYLSRAKFLSSELVA  400



>gb|KFK44868.1| hypothetical protein AALP_AA1G312900 [Arabis alpina]
Length=608

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 100/149 (67%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED ++G +++G + +   +             +A ++ LD+LMV  FE+  SC +
Sbjct  248  FDMELEDAVDGTMNEGDEVAVGSQNTNSS------DGNAVSELLDNLMVRSFEHLESCQQ  301

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            +GRL  VF+ L +SFE  +L  +K+KF+QF+MF+ACSLDPENCG +FA  L+ IF +S  
Sbjct  302  AGRLDEVFEILFVSFENLILNTFKAKFSQFLMFFACSLDPENCGVKFARKLLDIFLSSNK  361

Query  86   LEW-RMSAVAYLASYLARARFMDMPFVAA  3
                RMSAVAYLASYL+R +F+ + FVA+
Sbjct  362  PPLTRMSAVAYLASYLSRGKFLPVSFVAS  390



>ref|NP_174347.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
 gb|AEE31247.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
Length=604

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 93/149 (62%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +E  +++G       E           G +  ++ LD LMVL F +  SC  
Sbjct  242  FDMELEDAVESTMNEGD------EFPVGALKQNTSGGNVVSELLDKLMVLFFHHLESCQN  295

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            S RL  VF+ L  SFE  +L  YK+KF+QF+MFYACSLDPENCG RFA+ L+ I+ +S  
Sbjct  296  SDRLDEVFEILFKSFENYILNTYKTKFSQFLMFYACSLDPENCGVRFASKLLDIYLSSNT  355

Query  86   LEW-RMSAVAYLASYLARARFMDMPFVAA  3
                RMSAVAYLASYL+R +F+   FVA+
Sbjct  356  CRLTRMSAVAYLASYLSRGKFLPASFVAS  384



>ref|XP_010509710.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010509711.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
 ref|XP_010509712.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Camelina sativa]
Length=613

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED EG ID+G +       Q     D   G    ++ LD LMV+ FE+  SC   
Sbjct  255  FDMELED-EGTIDEGDELPVGPLSQ-----DISGGSIVVSELLDKLMVIAFEHLESCQND  308

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+ L  SFE  +L  +KSKF+QF+MFYACSLDPE CG +FA+ L+ IF +S   
Sbjct  309  GRLDEVFEILFQSFENFILETHKSKFSQFLMFYACSLDPETCGVKFASKLMDIFLSSRKS  368

Query  83   E-WRMSAVAYLASYLARARFMDMPFVAA  3
               R SAVAYLAS+LAR +F+ + FVA+
Sbjct  369  PATRRSAVAYLASFLARGKFLPISFVAS  396



>ref|XP_006307098.1| hypothetical protein CARUB_v10008684mg [Capsella rubella]
 gb|EOA39996.1| hypothetical protein CARUB_v10008684mg [Capsella rubella]
Length=581

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 94/149 (63%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +E  +++G       E             +  ++ LD LMVL F++  SC  
Sbjct  229  FDMELEDAVESTMNEGD------EFPVGALYQYTSDGNVVSELLDRLMVLSFKHLKSCKN  282

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            SGRL  VF+ L  SFE  VL  YKSKF+QF+MFYACSLDPENCG +FA+ L+ I+ +S  
Sbjct  283  SGRLDEVFEILFESFENYVLNTYKSKFSQFLMFYACSLDPENCGVKFASKLLEIYLSSNK  342

Query  86   LEW-RMSAVAYLASYLARARFMDMPFVAA  3
                RMSAVAYLASYL+R +F+   FVA+
Sbjct  343  PRLTRMSAVAYLASYLSRGKFLPPSFVAS  371



>ref|XP_008805454.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Phoenix dactylifera]
Length=626

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 96/149 (64%), Gaps = 7/149 (5%)
 Frame = -1

Query  443  FDIELEDLEGPIDD-GQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELE+ E   D  G+  + + E       +R    +  A+KLDSLMV++ E+  SC +
Sbjct  256  FDMELEEREENTDSIGKDSTNNLE-----EANRVLNGNVFAEKLDSLMVIMCEHLKSCAD  310

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
             G L +VF+TL   F +TV+ A+KSKF+QFVMFYACSLDPE CG +FA +L  IF +   
Sbjct  311  GGHLLKVFETLTEIFRRTVMNAHKSKFSQFVMFYACSLDPEICGLKFAVLLTDIFVSKTE  370

Query  86   LEW-RMSAVAYLASYLARARFMDMPFVAA  3
                RMSAV+YLASYL+RA+F+    V +
Sbjct  371  SPLSRMSAVSYLASYLSRAKFISSSLVTS  399



>ref|XP_010674318.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 84/123 (68%), Gaps = 4/123 (3%)
 Frame = -1

Query  371  QRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKS  192
            QR +W       S   +KLDSLMV+ FE+   C E+GR   VF++LL SFE TVL AYKS
Sbjct  283  QRRLWKKYV---SDKLEKLDSLMVVTFEHLNFCKENGRFVEVFESLLQSFEITVLNAYKS  339

Query  191  KFAQFVMFYACSLDPENCGKRFANMLIHIF-ETSVHLEWRMSAVAYLASYLARARFMDMP  15
            KFAQFV+FYACSLDPEN G R+A  L+++F  +S     RMSAVAYLAS+++R RF+   
Sbjct  340  KFAQFVIFYACSLDPENSGIRYAEFLVNMFISSSFPPLTRMSAVAYLASFMSRGRFLSTS  399

Query  14   FVA  6
             V 
Sbjct  400  LVV  402



>gb|KDP41755.1| hypothetical protein JCGZ_26773 [Jatropha curcas]
Length=628

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 90/146 (62%), Gaps = 3/146 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F IELE  EG I    +E+   E  R     +  G++  A  LD LMV  FE+   C  +
Sbjct  252  FAIELE--EGDIGSDDEENDIGEFPR-TSTHKSLGKNVVADLLDGLMVQTFEHLELCANN  308

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
             RL  VF+TLL SF  T+L  YKSKF+QFV+FYACSLDPENCG +FA  L   F    + 
Sbjct  309  KRLSEVFETLLDSFMITILNTYKSKFSQFVLFYACSLDPENCGLKFARTLADRFVYGDNP  368

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
              RMS+VAYLASYLARA+F+   FVA
Sbjct  369  LTRMSSVAYLASYLARAKFLSSAFVA  394



>ref|XP_010519059.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Tarenaya hassleriana]
Length=561

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD+LMVL F++  SC+ SG LG VF++L  SFE  +L  YKSKFAQFV+FYACSLDP++C
Sbjct  280  LDNLMVLTFKHLESCHTSGHLGEVFESLFKSFENLILNTYKSKFAQFVIFYACSLDPDHC  339

Query  137  GKRFANMLIHIF-ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
            G RFAN L  IF   S     RMSAVAYLASYL+R +F+    VA 
Sbjct  340  GVRFANNLADIFLSKSKPPLTRMSAVAYLASYLSRGKFLSTSTVAG  385



>ref|XP_002307198.2| RNA polymerase 1 specific transcription initiation factor RRN3 
family protein [Populus trichocarpa]
 gb|EEE94194.2| RNA polymerase 1 specific transcription initiation factor RRN3 
family protein [Populus trichocarpa]
Length=637

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 89/134 (66%), Gaps = 4/134 (3%)
 Frame = -1

Query  407  DDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLL  228
            DDGQ    D E+   + + R  G++ +A  LDSLM+   E+  +C +  RL  VF+TLL 
Sbjct  274  DDGQAN--DGELPSTLTL-RNLGKNVTADLLDSLMIQFLEHLEACADKKRLSEVFETLLS  330

Query  227  SFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-WRMSAVAYLA  51
            SF  T+L  YKSKF+QF +FYAC+LDPENCG +FA  L+ +F ++ +    RMSAVAYL+
Sbjct  331  SFMATILNTYKSKFSQFTIFYACALDPENCGVKFAQTLVDLFISTCNPPVTRMSAVAYLS  390

Query  50   SYLARARFMDMPFV  9
            SYLAR +F+   FV
Sbjct  391  SYLARGKFLSAAFV  404



>ref|XP_009141397.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Brassica rapa]
Length=597

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = -1

Query  407  DDGQQESFDFEIQRDM--WIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTL  234
            DD  +  FD E++  M    +   G +   + LD LMV+ F++  SCN  GRL +VF+ L
Sbjct  242  DDSSRGMFDMELEDAMNEGEENTSGGNVVFESLDKLMVISFDHLESCNLDGRLDQVFEKL  301

Query  233  LLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-WRMSAVAY  57
              +FE  +L  YKSK +QF+MFYACSLDPENCG +FA+ L+ IF +S      RMSAVAY
Sbjct  302  FGAFENFILNTYKSKVSQFLMFYACSLDPENCGVKFASKLMDIFLSSNKPRPTRMSAVAY  361

Query  56   LASYLARARFMDMPFVAA  3
            LASYLAR +F+ + +VA 
Sbjct  362  LASYLARGKFLPVSYVAT  379



>ref|XP_002893635.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69894.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +E  +++G +     +++++       G +  ++ LD LMVL F++  SC  
Sbjct  248  FDMELEDAVESTMNEGDEFPVG-DLKQNTS-----GGNVVSELLDKLMVLFFDHLESCQN  301

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            SGRL  VF+ L  SFE  +L  Y+SKF+QF+MFYACSLDPE CG RFA+ L+ I+ +   
Sbjct  302  SGRLDEVFEILFQSFENYILNTYRSKFSQFLMFYACSLDPEYCGVRFASKLLDIYLSRNK  361

Query  86   LEW-RMSAVAYLASYLARARFMDMPFVAA  3
                RMSAVAYLASYL+R +F+   FVA+
Sbjct  362  PRLTRMSAVAYLASYLSRGKFLPASFVAS  390



>emb|CDY43658.1| BnaA04g20330D [Brassica napus]
Length=605

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 92/147 (63%), Gaps = 13/147 (9%)
 Frame = -1

Query  407  DDGQQESFDFEIQRDM--WIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTL  234
            DD  +  FD E++  M    +   G +   + LD LMV+ F++  SCN  GRL +VF+ L
Sbjct  242  DDSSRGMFDMELEDTMNEGEENTSGGNVVFESLDKLMVISFDHLESCNLDGRLDQVFEKL  301

Query  233  LLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF----------ETSVHL  84
              +FE  +L  YKSK +QF+MFYACSLDPENCG +FA+ L+ IF          + SV  
Sbjct  302  FGAFENFILNTYKSKVSQFLMFYACSLDPENCGLKFASKLMDIFLSSNKPRPTRQVSVSP  361

Query  83   EWRMSAVAYLASYLARARFMDMPFVAA  3
             W MSAVAYLASYLAR +F+ + FVA+
Sbjct  362  LW-MSAVAYLASYLARGKFLPVSFVAS  387



>ref|XP_011022128.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3 [Populus euphratica]
Length=637

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = -1

Query  350  RFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVM  171
            R  G++ +A  LDSLM+   E+  +C E  RL  VF+TLL SF  T+L  YKSKF+QF +
Sbjct  290  RNLGKNVTADLLDSLMIQFLEHLEACAEKKRLSEVFETLLSSFMATILNTYKSKFSQFTI  349

Query  170  FYACSLDPENCGKRFANMLIHIFETSVHLE-WRMSAVAYLASYLARARFMDMPFV  9
            FYAC+LDPENCG +FA  L+ +F ++ +    RMSAVAYL+SYLAR +F+   FV
Sbjct  350  FYACALDPENCGVKFAQTLVDLFISTCNPPVTRMSAVAYLSSYLARGKFLSAAFV  404



>ref|XP_009133000.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Brassica rapa]
Length=605

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 92/153 (60%), Gaps = 22/153 (14%)
 Frame = -1

Query  443  FDIELEDL-----EGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFI  279
            FD+ELED      E P+    Q++   +I+                 LD LMV  F++  
Sbjct  250  FDMELEDAMNEGDELPVGSLNQDTSGGKIE----------------SLDKLMVTCFDHLE  293

Query  278  SCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFE  99
            SCN  GRL +VF+ L  SFE  +L  YKSK +QF+MFYACSLDPENCG +F + L+ IF 
Sbjct  294  SCNLHGRLDQVFEKLFDSFENFILNTYKSKVSQFLMFYACSLDPENCGVKFGSKLLDIFL  353

Query  98   TSVHLE-WRMSAVAYLASYLARARFMDMPFVAA  3
            +S      RMSAVAYLASYLAR +F+ + +VA+
Sbjct  354  SSNKPRPTRMSAVAYLASYLARGKFLPISYVAS  386



>ref|XP_002879723.1| hypothetical protein ARALYDRAFT_902994 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55982.1| hypothetical protein ARALYDRAFT_902994 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 97/152 (64%), Gaps = 16/152 (11%)
 Frame = -1

Query  443  FDIELE-DLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQK--LDSLMVLIFEYFISC  273
            FD+EL+  +EG  ++G++    F +       R   ++ +A    LD LMVL F++  SC
Sbjct  207  FDMELDLAVEGTTNEGEE----FPV-------RSLNQNGNAVSDLLDDLMVLYFDHLKSC  255

Query  272  NESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETS  93
             +SGRL  VF+ L  SF   +L A K+K +QF+MFYACSLDPENCG +FA+ L+ IF  S
Sbjct  256  QDSGRLDEVFENLFESFVNLILNAQKTKISQFLMFYACSLDPENCGVKFASKLLDIFLNS  315

Query  92   VHLEW--RMSAVAYLASYLARARFMDMPFVAA  3
             +     R +AVAYLASYLARA+F+   FVA+
Sbjct  316  NNNNQVTRTNAVAYLASYLARAKFLPASFVAS  347



>gb|AAD25746.1|AC007060_4 EST gb|Z37678 comes from this gene [Arabidopsis thaliana]
Length=622

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 13/154 (8%)
 Frame = -1

Query  443  FDIELED-LEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED +E  +++G       E           G +  ++ LD LMVL F +  SC  
Sbjct  255  FDMELEDAVESTMNEGD------EFPVGALKQNTSGGNVVSELLDKLMVLFFHHLESCQN  308

Query  266  SGRLGRV-----FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF  102
            S RL  V     F+ L  SFE  +L  YK+KF+QF+MFYACSLDPENCG RFA+ L+ I+
Sbjct  309  SDRLDEVWHQMVFEILFKSFENYILNTYKTKFSQFLMFYACSLDPENCGVRFASKLLDIY  368

Query  101  ETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
             +S      RMSAVAYLASYL+R +F+   FVA+
Sbjct  369  LSSNTCRLTRMSAVAYLASYLSRGKFLPASFVAS  402



>ref|XP_009143744.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Brassica rapa]
Length=597

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 94/147 (64%), Gaps = 7/147 (5%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED     D+  +E  +F++           ES     LD LMVL F++  SC  +
Sbjct  246  FDMELED--AVEDNTMKEGDEFQVGSLTSDGNVIFES-----LDKLMVLSFDHLESCKLA  298

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VF+ L  +FE  ++  +K+K +QF+MFYACSLDPENCG +FA  L+ IF  S  L
Sbjct  299  GRLDQVFEKLFEAFEHYIMDIHKTKVSQFLMFYACSLDPENCGVKFAIKLMDIFLFSNKL  358

Query  83   EWRMSAVAYLASYLARARFMDMPFVAA  3
              RMSA+AYLASYLAR +F+ + +VA+
Sbjct  359  PTRMSAMAYLASYLARGKFLHVSYVAS  385



>gb|EEC81212.1| hypothetical protein OsI_24246 [Oryza sativa Indica Group]
Length=622

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 86/144 (60%), Gaps = 17/144 (12%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL    D   QE               FG +A A+KLD LMV+  E+  SC E 
Sbjct  252  FDMELEDLGEDEDSLGQEG----------TKALFGGNACAEKLDGLMVVFCEHLKSCKEH  301

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF----ET  96
            GRL + FD L   F  +VL  +KSKFAQF+MFYACSLDPE CG  FA  L  IF    E 
Sbjct  302  GRLPQEFDILKTIFRASVLRVHKSKFAQFIMFYACSLDPEICGLEFALFLSDIFIKKEED  361

Query  95   SVHLEWRMSAVAYLASYLARARFM  24
            S+    RMSAV+Y+ SYL+RARF+
Sbjct  362  SIS---RMSAVSYVGSYLSRARFI  382



>ref|XP_006849976.1| hypothetical protein AMTR_s00022p00154500 [Amborella trichopoda]
 gb|ERN11557.1| hypothetical protein AMTR_s00022p00154500 [Amborella trichopoda]
Length=563

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A+K+D LM + FE+   C     + +VF+TLL SF+ TVL  YKSKF QF++FY CSLDP
Sbjct  312  AEKMDCLMEVTFEHLRLCYTENHVDKVFETLLQSFQTTVLGTYKSKFTQFLLFYMCSLDP  371

Query  146  ENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARARFMDMPFVAA  3
            ENCG +FA +L+ IF    H    RMSAVAYLASYL+R RF+    VA+
Sbjct  372  ENCGAKFACLLVDIFVGKNHPPNTRMSAVAYLASYLSRGRFVSSSLVAS  420



>emb|CDX79576.1| BnaC03g19120D [Brassica napus]
Length=608

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 17/153 (11%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELED     D+    S + +  R              + LD LMV  F++  SCN  
Sbjct  249  FDMELEDAMNEGDELPVGSLNQDTSR-----------GKIESLDKLMVACFDHLESCNLH  297

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSV--  90
            GRL +VF+ L  SFE  +L  YKSK +QF+MFYACSLDPENCG +F + L+ IF +S   
Sbjct  298  GRLDQVFEKLFDSFENFILNTYKSKVSQFLMFYACSLDPENCGVKFGSKLLDIFLSSNKP  357

Query  89   ----HLEWRMSAVAYLASYLARARFMDMPFVAA  3
                 +   MSAVAYLASYLAR +F+ + +VA 
Sbjct  358  RPTRQVSLWMSAVAYLASYLARGKFLPVSYVAT  390



>ref|NP_001058413.2| Os06g0688100 [Oryza sativa Japonica Group]
 dbj|BAD45608.1| putative RNA polymerase I transcription factor RRN3 [Oryza sativa 
Japonica Group]
 dbj|BAD46064.1| putative RNA polymerase I transcription factor RRN3 [Oryza sativa 
Japonica Group]
 dbj|BAG94924.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66248.1| hypothetical protein OsJ_22429 [Oryza sativa Japonica Group]
 dbj|BAF20327.2| Os06g0688100 [Oryza sativa Japonica Group]
Length=622

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 86/144 (60%), Gaps = 17/144 (12%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELEDL    D   QE               FG +A A+KLD LMV+  E+  SC E 
Sbjct  252  FDMELEDLGEDEDSLGQEG----------TKALFGGNACAEKLDGLMVVFCEHLKSCKEH  301

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF----ET  96
            GRL + FD L   F  +VL  +KSKFAQF+MFYACSLDPE CG  FA  L  IF    E 
Sbjct  302  GRLPQEFDILKTIFRASVLRVHKSKFAQFIMFYACSLDPEICGLEFALFLSDIFIKKEED  361

Query  95   SVHLEWRMSAVAYLASYLARARFM  24
            S+    RMSAV+Y+ SYL+RARF+
Sbjct  362  SIS---RMSAVSYVGSYLSRARFI  382



>ref|XP_002881638.1| hypothetical protein ARALYDRAFT_321615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57897.1| hypothetical protein ARALYDRAFT_321615 [Arabidopsis lyrata subsp. 
lyrata]
Length=584

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 97/151 (64%), Gaps = 15/151 (10%)
 Frame = -1

Query  443  FDIELE-DLEGPIDDGQQESFDFEIQRDMWIDRFFGESAS--AQKLDSLMVLIFEYFISC  273
            FD+EL+  +EG  ++G++ S            R   ++ +  ++ LD LMVL F +   C
Sbjct  247  FDMELDLAVEGTTNEGEEFSV-----------RSLNQNGNVVSKSLDDLMVLSFHHLEFC  295

Query  272  NESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETS  93
             ++GRL  VF+ L +SFE  +L   K+K +QF+MFYACSLDP++CG +FA+ L+ IF +S
Sbjct  296  QDAGRLDEVFENLFVSFENLILNTQKTKISQFLMFYACSLDPKSCGVKFASKLLDIFLSS  355

Query  92   -VHLEWRMSAVAYLASYLARARFMDMPFVAA  3
              H   R +AVAYLASYLARA+F+   FVA+
Sbjct  356  NKHQVTRTNAVAYLASYLARAKFLPTSFVAS  386



>ref|XP_008782843.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Phoenix dactylifera]
Length=466

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELE+ E   +   ++     I+     +     +  A+KLD LMV++ E+   C + 
Sbjct  88   FDMELEEWEENTNSTGKDG----IKPLEEANGVLNGNVFAEKLDVLMVIVCEHLKLCADG  143

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VFD L   F +T++ A+KSKFAQFVMFYACSLDPE CG +FA +L  IF +    
Sbjct  144  GRLLKVFDMLTEIFRRTIMNAHKSKFAQFVMFYACSLDPEICGLKFAVLLTDIFVSKTES  203

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAV YLASYL+RA+F+    VA+
Sbjct  204  PMSRMSAVLYLASYLSRAKFISSVMVAS  231



>ref|XP_010552506.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Tarenaya hassleriana]
Length=443

 Score =   115 bits (287),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD+LMVL F++  SC+ SG LG VF++L  SFE  +L  YK KFAQFV+FYACSLDP++C
Sbjct  272  LDNLMVLTFKHLESCHTSGHLGEVFESLFKSFE--ILNTYK-KFAQFVIFYACSLDPDHC  328

Query  137  GKRFANMLIHIF-ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
            G RFAN L  IF   S     RMSAVAYLASYL+R +F+    VA 
Sbjct  329  GVRFANNLADIFLSKSKPPLTRMSAVAYLASYLSRGKFLSTSTVAG  374



>emb|CDX84629.1| BnaA03g16010D [Brassica napus]
Length=613

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 93/162 (57%), Gaps = 32/162 (20%)
 Frame = -1

Query  443  FDIELEDL-----EGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFI  279
            FD+ELED      E P+    Q++   +I+                 LD LMV  F++  
Sbjct  250  FDMELEDAMNEGDELPVGSLNQDTSGGKIE----------------SLDKLMVTCFDHLE  293

Query  278  SCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF-  102
            SCN  GRL +VF+ L  SFE  +L  YKSK +QF+MFYACSLDPENCG +F + L+ IF 
Sbjct  294  SCNLHGRLDQVFEKLFDSFENFILNTYKSKVSQFLMFYACSLDPENCGVKFGSKLLDIFL  353

Query  101  ---------ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
                     + S+   W MSAVAYLASYLAR +F+ + +VA+
Sbjct  354  SSNKPRPTRQVSLSPLW-MSAVAYLASYLARGKFLPISYVAS  394



>ref|XP_008782841.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Phoenix dactylifera]
Length=570

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            FD+ELE+ E   +   ++     I+     +     +  A+KLD LMV++ E+   C + 
Sbjct  192  FDMELEEWEENTNSTGKDG----IKPLEEANGVLNGNVFAEKLDVLMVIVCEHLKLCADG  247

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL +VFD L   F +T++ A+KSKFAQFVMFYACSLDPE CG +FA +L  IF +    
Sbjct  248  GRLLKVFDMLTEIFRRTIMNAHKSKFAQFVMFYACSLDPEICGLKFAVLLTDIFVSKTES  307

Query  83   EW-RMSAVAYLASYLARARFMDMPFVAA  3
               RMSAV YLASYL+RA+F+    VA+
Sbjct  308  PMSRMSAVLYLASYLSRAKFISSVMVAS  335



>ref|XP_006656405.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Oryza brachyantha]
Length=622

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = -1

Query  347  FFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMF  168
             FG +A A+KLD LMV+  E+  +C+E GRL + FD L   F  +VLT +KSKFAQF++F
Sbjct  274  LFGGNACAEKLDGLMVVFCEHLKACSEHGRLLKEFDILKTIFRTSVLTVHKSKFAQFIVF  333

Query  167  YACSLDPENCGKRFANMLIHIF-ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
            YACSLDPE CG  F+  L  IF +    L  RMSAV+Y+ SYL+RARF+    V A
Sbjct  334  YACSLDPEICGIEFSLFLTDIFIKKEEDLLSRMSAVSYVGSYLSRARFISADTVVA  389



>ref|XP_006656406.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Oryza brachyantha]
Length=597

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = -1

Query  347  FFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMF  168
             FG +A A+KLD LMV+  E+  +C+E GRL + FD L   F  +VLT +KSKFAQF++F
Sbjct  249  LFGGNACAEKLDGLMVVFCEHLKACSEHGRLLKEFDILKTIFRTSVLTVHKSKFAQFIVF  308

Query  167  YACSLDPENCGKRFANMLIHIF-ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
            YACSLDPE CG  F+  L  IF +    L  RMSAV+Y+ SYL+RARF+    V A
Sbjct  309  YACSLDPEICGIEFSLFLTDIFIKKEEDLLSRMSAVSYVGSYLSRARFISADTVVA  364



>ref|NP_181457.2| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
 gb|ABE65893.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Arabidopsis thaliana]
 gb|AEC09649.1| RNA polymerase I specific transcription initiation factor RRN3 
protein [Arabidopsis thaliana]
Length=573

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -1

Query  365  DMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKF  186
            DM +D     +  ++ LD LMV  F +  SC ++GRL  VF+ L  SFE  +L   K KF
Sbjct  248  DMELDVAVEGTLVSKLLDDLMVESFNHLKSCQDAGRLDEVFENLFESFENLILNTQKLKF  307

Query  185  AQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-WRMSAVAYLASYLARARFMDMPFV  9
            +QF+MFYACSLDPENCG +FA+ L+  F +S + +  R +AV YLASYLARA F+   FV
Sbjct  308  SQFLMFYACSLDPENCGVKFASKLLEKFLSSNNNQVTRTNAVTYLASYLARANFLSASFV  367

Query  8    AA  3
            A+
Sbjct  368  AS  369



>ref|XP_006293892.1| hypothetical protein CARUB_v10022885mg [Capsella rubella]
 gb|EOA26790.1| hypothetical protein CARUB_v10022885mg [Capsella rubella]
Length=585

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 97/150 (65%), Gaps = 15/150 (10%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESAS--AQKLDSLMVLIFEYFISCN  270
            FD+EL D+EG +++G++    F +       R   ++ +  ++  D LMVL F++  SC 
Sbjct  247  FDMEL-DVEGTMNEGEE----FPV-------RSLNKNGNVVSELFDDLMVLSFKHLESCQ  294

Query  269  ESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSV  90
            ++GRL  VF+ L  SFE  +L   K K +QF+MFYACSLD ENCG +FA+ L+ I+ +S 
Sbjct  295  DAGRLDEVFENLFESFENLILNTQKLKVSQFLMFYACSLDTENCGVKFASKLLDIYLSSK  354

Query  89   HLE-WRMSAVAYLASYLARARFMDMPFVAA  3
            + +  R +AVAYLASYLARA F+   FVA+
Sbjct  355  NPQVTRTNAVAYLASYLARAEFLPASFVAS  384



>ref|XP_010928803.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Elaeis guineensis]
Length=610

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A+KLD LMV++ E+   C +  RL +VF+ L   F +TVL A+KSKFAQFVMFYACSLDP
Sbjct  267  AEKLDVLMVIVCEHLKLCADGRRLLKVFEMLTEIFRRTVLNAHKSKFAQFVMFYACSLDP  326

Query  146  ENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            E CG +FA +L  IF +       RMSAV+YLASYL+RA+F+    VA+
Sbjct  327  EICGLKFAVVLTDIFVSKTESPMSRMSAVSYLASYLSRAKFISAVMVAS  375



>ref|XP_010928802.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Elaeis guineensis]
Length=634

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A+KLD LMV++ E+   C +  RL +VF+ L   F +TVL A+KSKFAQFVMFYACSLDP
Sbjct  291  AEKLDVLMVIVCEHLKLCADGRRLLKVFEMLTEIFRRTVLNAHKSKFAQFVMFYACSLDP  350

Query  146  ENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            E CG +FA +L  IF +       RMSAV+YLASYL+RA+F+    VA+
Sbjct  351  EICGLKFAVVLTDIFVSKTESPMSRMSAVSYLASYLSRAKFISAVMVAS  399



>ref|XP_010499599.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X2 [Camelina sativa]
Length=597

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD LM L FE+   C+ +GRL  VF+ L  SFE  +L   K+KF+QF+MFYACSLDPENC
Sbjct  282  LDKLMDLAFEHLNFCHNTGRLDEVFEILFESFENYILNTCKTKFSQFLMFYACSLDPENC  341

Query  137  GKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            G +FA+ L+ I+ +S      RMSAV+YLASYL+R +F+   FVA 
Sbjct  342  GVKFASKLLEIYLSSNKTRLNRMSAVSYLASYLSRGKFLPPSFVAT  387



>ref|XP_010499598.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like isoform X1 [Camelina sativa]
Length=622

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD LM L FE+   C+ +GRL  VF+ L  SFE  +L   K+KF+QF+MFYACSLDPENC
Sbjct  307  LDKLMDLAFEHLNFCHNTGRLDEVFEILFESFENYILNTCKTKFSQFLMFYACSLDPENC  366

Query  137  GKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            G +FA+ L+ I+ +S      RMSAV+YLASYL+R +F+   FVA 
Sbjct  367  GVKFASKLLEIYLSSNKTRLNRMSAVSYLASYLSRGKFLPPSFVAT  412



>ref|XP_010552505.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Tarenaya hassleriana]
Length=550

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD+LMVL F++  SC+ SG LG VF++L  SFE  +L  YK KFAQFV+FYACSLDP++C
Sbjct  272  LDNLMVLTFKHLESCHTSGHLGEVFESLFKSFE--ILNTYK-KFAQFVIFYACSLDPDHC  328

Query  137  GKRFANMLIHIF-ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
            G RFAN L  IF   S     RMSAVAYLASYL+R +F+    VA 
Sbjct  329  GVRFANNLADIFLSKSKPPLTRMSAVAYLASYLSRGKFLSTSTVAG  374



>ref|XP_010478481.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like [Camelina sativa]
 ref|XP_010478483.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor rrn3-like [Camelina sativa]
Length=597

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD LMV  F++   C  SGRL  VF+ L  SFE  +L   K+KF+QF+MFYACSLDPENC
Sbjct  279  LDKLMVRSFKHLKFCQNSGRLDEVFEILFESFENYILNTCKTKFSQFLMFYACSLDPENC  338

Query  137  GKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            G +FA+ L+ I+ +S      RMSAV+YLASYL+R +F+   FVA+
Sbjct  339  GVKFASKLLEIYLSSNTTRLNRMSAVSYLASYLSRGKFLPPSFVAS  384



>emb|CDY71933.1| BnaCnng75170D, partial [Brassica napus]
Length=348

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = -1

Query  437  IELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGR  258
            IE +D+  P DD     FD E++  + ++    E    + LD LMVL FE+  SC  +GR
Sbjct  1    IERDDI--PQDDSTLGLFDMELE--VAVEETMNEGE--ELLDKLMVLSFEHLESCQNAGR  54

Query  257  LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-  81
            L  VF+ L   FE  +LT  K KF QF++FYACSLDPE+CG +FA+ L+ IF +S     
Sbjct  55   LDEVFEILFDLFENLILTTCKPKFPQFLLFYACSLDPEDCGVKFASKLLAIFLSSNKDRV  114

Query  80   WRMSAVAYLASYLARARFMDMPFVA  6
             R +AV YLASYL+R +F+   FVA
Sbjct  115  TRTNAVDYLASYLSRGKFLHASFVA  139



>ref|XP_008242159.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase I-specific transcription 
initiation factor rrn3-like, partial [Prunus mume]
Length=701

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 93/148 (63%), Gaps = 6/148 (4%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F+++ ED+    D     + D E+ R   ++    + A A+KLDSL+VLIFE+  SC   
Sbjct  149  FEMKQEDVNECTD--HDLNVDSELPRQSILNNSEAK-AFAEKLDSLIVLIFEHLESCG--  203

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANML-IHIFETSVH  87
            G L + F  LL SF KTVLTAYKSKF+QFV+FYAC+LDP NCG  FA  L    F ++  
Sbjct  204  GHLIQAFQNLLDSFMKTVLTAYKSKFSQFVIFYACALDPGNCGVTFALKLEDKFFCSTTF  263

Query  86   LEWRMSAVAYLASYLARARFMDMPFVAA  3
               RMS V YLASYL+RA+F+ +  VA 
Sbjct  264  PNIRMSVVLYLASYLSRAKFLSVSVVAG  291



>emb|CDX84284.1| BnaC04g10460D [Brassica napus]
Length=600

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 21/157 (13%)
 Frame = -1

Query  413  PIDDGQQESFDFEIQRDMWIDRFFGESASA-----------QKLDSLMVLIFEYFISCNE  267
            P DD  +  FD E++ ++  +   G+               + LD LMVL F++  SC  
Sbjct  237  PQDDSSRGMFDMELEDEVEDNMKEGDELPVGSLTSDGNVVFESLDKLMVLSFDHLESCKL  296

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF-----  102
             GRL +VF+ L  +FEK +L   K K +QF+MFYACSLDPENCG +FA+ L+ IF     
Sbjct  297  DGRLDQVFEKLFEAFEKFILDIDKIKVSQFLMFYACSLDPENCGVKFASKLMDIFLFSNK  356

Query  101  ----ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
                + S  L W MSA+AYLASYLAR +F+ + +VA+
Sbjct  357  PTTRQVSPSLLW-MSAMAYLASYLARGKFLPVSYVAS  392



>gb|EMT22842.1| hypothetical protein F775_01666 [Aegilops tauschii]
Length=604

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 86/151 (57%), Gaps = 17/151 (11%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELEDL    D   Q                FG +A A+KLDSLMV++ E+  SC E 
Sbjct  228  FEMELEDLNEDEDGLGQAGTKV----------LFGGNACAEKLDSLMVVVCEHLKSCAER  277

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF----ET  96
            G L + FD L   F  +VL  ++SKF QF+MFYACSLDP+ CG  FA  L  IF    E 
Sbjct  278  GYLDKEFDILKAIFRASVLRVHRSKFCQFIMFYACSLDPKICGLEFAFFLTEIFLNKEED  337

Query  95   SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             +    RMSAV+Y+ SYL+RARF+    V A
Sbjct  338  PIS---RMSAVSYVGSYLSRARFISADTVLA  365



>gb|KHN37948.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Glycine soja]
Length=368

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED+    D  + E+ D     ++   +    +   +KLDSLMVL F +  SC  S
Sbjct  247  FEMELEDVTEFAD--EDENCDSMPPSELLNRKNLQGNLVVEKLDSLMVLAFLHLESCQSS  304

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
            GRL  VFDTLL SF++TVL AYKSKF Q+VMFYAC+LDPE CG +FA +L  +F   V+
Sbjct  305  GRLTEVFDTLLASFQRTVLNAYKSKFTQYVMFYACALDPEGCGVKFAMVLADMFGCDVN  363



>ref|XP_010227381.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Brachypodium distachyon]
Length=538

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -1

Query  347  FFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMF  168
              G +A A+KLD LMV++ E+  SC E G L + FDTL   F  ++L  +KSKFAQF+MF
Sbjct  190  LLGGNACAEKLDGLMVVVCEHLKSCAEHGYLTKEFDTLKTIFRASLLRVHKSKFAQFIMF  249

Query  167  YACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFM  24
            YACSLDPE CG  FA  L   F         RMSAV+Y+ SYL+RARF+
Sbjct  250  YACSLDPEICGLEFAIFLTDTFTKKEEDPISRMSAVSYVGSYLSRARFI  298



>ref|XP_003563455.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Brachypodium distachyon]
Length=622

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -1

Query  347  FFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMF  168
              G +A A+KLD LMV++ E+  SC E G L + FDTL   F  ++L  +KSKFAQF+MF
Sbjct  274  LLGGNACAEKLDGLMVVVCEHLKSCAEHGYLTKEFDTLKTIFRASLLRVHKSKFAQFIMF  333

Query  167  YACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFM  24
            YACSLDPE CG  FA  L   F         RMSAV+Y+ SYL+RARF+
Sbjct  334  YACSLDPEICGLEFAIFLTDTFTKKEEDPISRMSAVSYVGSYLSRARFI  382



>ref|XP_009411620.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
Length=629

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 8/149 (5%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELED +  +D+  +      ++  +        +A A KLD LMV++ E+     +S
Sbjct  255  FEMELEDWDDDMDNVAKAGTKLPMENGV-----LKGNAYADKLDGLMVIVCEHLKLRADS  309

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH-  87
            G L  VF+TL   F   VL  +KSKFAQF+MFYACSLDP+ CG +FA +L  IF  S H 
Sbjct  310  GHLLNVFETLSEIFRIAVLKLHKSKFAQFLMFYACSLDPDICGLKFAVLLTDIF-VSKHE  368

Query  86   -LEWRMSAVAYLASYLARARFMDMPFVAA  3
              + RM AV+YLASYLARA+F+    VA+
Sbjct  369  DPDSRMKAVSYLASYLARAKFISSSLVAS  397



>ref|XP_004966190.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Setaria italica]
Length=618

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = -1

Query  347  FFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMF  168
             FG +  A+KLD LMV++ E+  SCN   RL + F  L   F K+VL  +KSKFAQF+MF
Sbjct  271  LFGGNVCAEKLDGLMVVVCEHLKSCNRD-RLFKEFGILKTIFRKSVLKVHKSKFAQFIMF  329

Query  167  YACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            YACSLDPE CG  FA  L  IF         RMSAV+Y+ SYL+RARF+    V A
Sbjct  330  YACSLDPEICGVDFALFLTDIFTKKEDDPIARMSAVSYVGSYLSRARFISADTVVA  385



>ref|XP_010460863.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Camelina sativa]
Length=538

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD LM   F++   C  SGRL  VF+ L  SFE  +L   K+ F QF+MFYACSLDPENC
Sbjct  281  LDELMDRSFKHLKFCQNSGRLDEVFEILFESFENYILNTCKTNFLQFLMFYACSLDPENC  340

Query  137  GKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            G +FA+ L+ I+ +S   +  RM AV+YLASYL+R +F+   FVA+
Sbjct  341  GVKFASKLLEIYLSSNKTQLNRMRAVSYLASYLSRGKFLPPSFVAS  386



>ref|XP_010460864.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Camelina sativa]
Length=611

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENC  138
            LD LM   F++   C  SGRL  VF+ L  SFE  +L   K+ F QF+MFYACSLDPENC
Sbjct  281  LDELMDRSFKHLKFCQNSGRLDEVFEILFESFENYILNTCKTNFLQFLMFYACSLDPENC  340

Query  137  GKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            G +FA+ L+ I+ +S   +  RM AV+YLASYL+R +F+   FVA+
Sbjct  341  GVKFASKLLEIYLSSNKTQLNRMRAVSYLASYLSRGKFLPPSFVAS  386



>ref|XP_009391870.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391871.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391872.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Musa acuminata subsp. malaccensis]
Length=632

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 6/148 (4%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELE+ E    D      +  ++  M      G +A A KLD LMV++ E+  S  E+
Sbjct  255  FEMELEEWE----DNMGTDAEVGVKPPMENGVLKG-NAFADKLDGLMVIVCEHLKSRAEN  309

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF-ETSVH  87
            G L +VF+ L   F + +L  +KSKFAQF+MFYACSLDP+ CG +FA +L  IF   +  
Sbjct  310  GHLLKVFEALSEIFRRAMLKLHKSKFAQFLMFYACSLDPDICGLKFAVLLTDIFVSKNED  369

Query  86   LEWRMSAVAYLASYLARARFMDMPFVAA  3
             + RM AVAYLASYLARA+F+    VA+
Sbjct  370  PDSRMKAVAYLASYLARAKFVSSSMVAS  397



>ref|XP_004966189.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Setaria italica]
Length=644

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = -1

Query  347  FFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMF  168
             FG +  A+KLD LMV++ E+  SCN   RL + F  L   F K+VL  +KSKFAQF+MF
Sbjct  271  LFGGNVCAEKLDGLMVVVCEHLKSCNRD-RLFKEFGILKTIFRKSVLKVHKSKFAQFIMF  329

Query  167  YACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            YACSLDPE CG  FA  L  IF         RMSAV+Y+ SYL+RARF+    V A
Sbjct  330  YACSLDPEICGVDFALFLTDIFTKKEDDPIARMSAVSYVGSYLSRARFISADTVVA  385



>gb|AAC16259.1| unknown protein [Arabidopsis thaliana]
Length=602

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 86/142 (61%), Gaps = 16/142 (11%)
 Frame = -1

Query  443  FDIELEDL-EGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNE  267
            FD+ELED  EG ++DG +      +++D         S  ++ LD LMV+ FE+  SC  
Sbjct  267  FDMELEDAAEGTMNDGDELPVG-PLKQDTS-----DGSIVSKLLDKLMVVAFEHLESCQN  320

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
             GRL +VF++L  SFE  +L  YKSKF QF++FYACSLDPENCG +FA+ L+ IF     
Sbjct  321  DGRLDQVFESLFKSFENFILNTYKSKFTQFLIFYACSLDPENCGVKFASKLVEIF-----  375

Query  86   LEWRMSAVAYLASYLARARFMD  21
                +S+  ++A+  A  R +D
Sbjct  376  ----LSSNKHVATRQASLRLID  393



>emb|CDY31637.1| BnaA05g09100D [Brassica napus]
Length=583

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 91/161 (57%), Gaps = 30/161 (19%)
 Frame = -1

Query  440  DIELE-DLEG-PIDDGQQESFDFEIQRDMWIDRFFGESASAQ-------------KLDSL  306
            D++LE D +G P DD  +  FD E++ D   D    E    Q              LD L
Sbjct  226  DMDLEIDWDGIPQDDSSRGLFDMELE-DAVEDNTMNEGDEFQVGSLTSDGNVIFESLDKL  284

Query  305  MVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRF  126
            MVL F++  SC  +GRL +VF+ L  +FE  ++  +K+K +QF+MFYACSLDPEN     
Sbjct  285  MVLSFDHLESCKLAGRLDQVFEKLFEAFEHYIMDIHKTKVSQFLMFYACSLDPEN-----  339

Query  125  ANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
                     ++  L+ +MSA+AYLASYLAR +F+ + +VA+
Sbjct  340  ---------STSQLQGKMSAMAYLASYLARGKFLHVSYVAS  371



>ref|XP_009359751.1| PREDICTED: uncharacterized protein LOC103950283 [Pyrus x bretschneideri]
Length=517

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 84/147 (57%), Gaps = 33/147 (22%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F++ELE ++   DD   +    EI R +   +  G ++ A+KLDSL+VL FE+  SC   
Sbjct  251  FEMELEAVDKSTDDDLNDGS--EITRKLST-KISGSNSFAEKLDSLLVLTFEHLESCEVG  307

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL  VF+TLL SF++TVLTAYKSKFAQFV+F                            
Sbjct  308  GRLIEVFETLLESFKRTVLTAYKSKFAQFVIF----------------------------  339

Query  83   EWRMSAVAYLASYLARARFMDMPFVAA  3
              RMSAV+YLASYL+RA+F+    +A+
Sbjct  340  --RMSAVSYLASYLSRAKFLSASVIAS  364



>ref|XP_008681385.1| PREDICTED: uncharacterized protein LOC100272544 isoform X1 [Zea 
mays]
 gb|AFW69236.1| hypothetical protein ZEAMMB73_457339 [Zea mays]
Length=620

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 85/151 (56%), Gaps = 15/151 (10%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFIS-CNE  267
            FD+ELEDL    D+  QE               FG +  A+KLD LMV++ E+  S   E
Sbjct  248  FDMELEDLAEDEDNLGQEGTKVH----------FGGNMCAEKLDGLMVVVCEHLKSRVEE  297

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVH  87
              RL + F TL   F+  VL  +KSKFAQF+MFYACSL PE  G  FAN L  IF     
Sbjct  298  PERLIKEFVTLKAIFKSHVLRVHKSKFAQFIMFYACSLHPE-IGDGFANFLTDIFIDKDK  356

Query  86   LE---WRMSAVAYLASYLARARFMDMPFVAA  3
             E    R+SAV+Y+ SYL+RARF+ +  V +
Sbjct  357  NEDAITRVSAVSYVGSYLSRARFISVNIVVS  387



>ref|XP_002963952.1| hypothetical protein SELMODRAFT_405493 [Selaginella moellendorffii]
 gb|EFJ34285.1| hypothetical protein SELMODRAFT_405493 [Selaginella moellendorffii]
Length=635

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A K+D LM L+FE+   C ++ RL  V+ TL++SF+ TVL  YKSKF QF++FY CSL P
Sbjct  306  ADKMDHLMELVFEHLHQCAKNERLDEVYTTLMVSFKSTVLDTYKSKFTQFLIFYLCSLSP  365

Query  146  ENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFV  9
             +CG  FA  L   F T S+    RMSA AYLASYLARA F+ +P V
Sbjct  366  SSCGANFAGFLCETFVTRSIPSNTRMSAAAYLASYLARANFLPLPVV  412



>ref|XP_002967968.1| hypothetical protein SELMODRAFT_440149 [Selaginella moellendorffii]
 gb|EFJ31315.1| hypothetical protein SELMODRAFT_440149 [Selaginella moellendorffii]
Length=637

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A K+D LM L+FE+   C ++ RL  V+ TL++SF+ TVL  YKSKF QF++FY CSL P
Sbjct  306  ADKMDHLMELVFEHLHQCAKNERLDEVYTTLMVSFKSTVLDTYKSKFTQFLIFYLCSLSP  365

Query  146  ENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFV  9
             +CG  FA  L   F T S+    RMSA AYLASYLARA F+ +P V
Sbjct  366  SSCGVNFAGFLCETFVTRSIPSNTRMSAAAYLASYLARANFLPLPVV  412



>ref|XP_007204151.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica]
 gb|EMJ05350.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica]
Length=569

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 82/150 (55%), Gaps = 24/150 (16%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASA--QKLDSLMVLIFEYFISCN  270
            F++E ED+         ES D ++  D    R     A A  +KLDSLMVLIFE+  SC 
Sbjct  193  FEMEQEDV--------NESTDQDLNDDSERPRQLSPEAKAIAEKLDSLMVLIFEHLESC-  243

Query  269  ESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSV  90
             SG L + F TLL SF KT           FV+FYAC+LDP NC   FA  L   F  S 
Sbjct  244  -SGHLIQTFQTLLDSFMKT-----------FVIFYACALDPVNCSVTFAMKLEDKFFCST  291

Query  89   HL-EWRMSAVAYLASYLARARFMDMPFVAA  3
                 RMSAVAYLASYL+RA+F+ +  VA 
Sbjct  292  DFPNSRMSAVAYLASYLSRAKFLSVSVVAG  321



>gb|AAC28984.1| unknown protein [Arabidopsis thaliana]
Length=545

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = -1

Query  365  DMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKF  186
            DM +D     +  ++ LD LMV  F +  SC ++GRL  VF+ L  SFE  +L   K KF
Sbjct  248  DMELDVAVEGTLVSKLLDDLMVESFNHLKSCQDAGRLDEVFENLFESFENLILNTQKLKF  307

Query  185  AQFVMFYACSLDPENCGKRFANMLIHIFETS  93
            +QF+MFYACSLDPENCG +FA+ L+  F +S
Sbjct  308  SQFLMFYACSLDPENCGVKFASKLLEKFLSS  338



>ref|XP_001775034.1| predicted protein [Physcomitrella patens]
 gb|EDQ60141.1| predicted protein [Physcomitrella patens]
Length=655

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A K+D +M +  ++  +C ++G    VF+TL+ SF+ T+L  YKSKF QF++FY CSL P
Sbjct  264  ADKMDLIMDMTLDHLHTCVQNGHGDLVFETLMRSFQTTILDTYKSKFTQFLIFYLCSLAP  323

Query  146  ENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARARFMDMPFV  9
            E CG  FA++L  IFE        RMSA AYLASYLARA ++ +  V
Sbjct  324  ETCGSTFASLLCDIFECKTRPPNTRMSAAAYLASYLARAAYLPLNVV  370



>ref|XP_001771048.1| predicted protein [Physcomitrella patens]
 gb|EDQ64203.1| predicted protein [Physcomitrella patens]
Length=624

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A K+D +M +  ++  +C ++G    VF+TL+ SF+ T+L  YKSKF QF++FY CSL P
Sbjct  230  ADKMDLIMDMTLDHLHTCVQNGHGDLVFETLMRSFQTTILDTYKSKFTQFLIFYLCSLAP  289

Query  146  ENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARARFMDMPFVA  6
              CG  FA++L  IFE+       RMSA AYLASYLARA ++ +  V 
Sbjct  290  STCGNTFASLLCDIFESKTRPPNTRMSAAAYLASYLARAGYLPLTVVV  337



>ref|XP_002437492.1| hypothetical protein SORBIDRAFT_10g028030 [Sorghum bicolor]
 gb|EER88859.1| hypothetical protein SORBIDRAFT_10g028030 [Sorghum bicolor]
Length=593

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = -1

Query  347  FFGESASAQKLDSLMVLIFEYFIS-CNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVM  171
             FG +  A+KLD LMV++ ++  S   E  RL + FDTL   F+  V+  +KSKFAQF+M
Sbjct  270  LFGGNVCAEKLDGLMVVVCKHLKSRAEEPDRLNKEFDTLKAIFKSHVIRVHKSKFAQFIM  329

Query  170  FYACSLDPENCGKRFANMLIHIF  102
            FYACSL P+ CG+ FA  L+ IF
Sbjct  330  FYACSLYPKICGEGFAFFLVDIF  352



>gb|AFW69235.1| hypothetical protein ZEAMMB73_457339 [Zea mays]
Length=592

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 64/115 (56%), Gaps = 12/115 (10%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFIS-CNE  267
            FD+ELEDL    D+  QE               FG +  A+KLD LMV++ E+  S   E
Sbjct  248  FDMELEDLAEDEDNLGQEGTKVH----------FGGNMCAEKLDGLMVVVCEHLKSRVEE  297

Query  266  SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF  102
              RL + F TL   F+  VL  +KSKFAQF+MFYACSL PE  G  FAN L  IF
Sbjct  298  PERLIKEFVTLKAIFKSHVLRVHKSKFAQFIMFYACSLHPE-IGDGFANFLTDIF  351



>ref|XP_002950319.1| hypothetical protein VOLCADRAFT_120872 [Volvox carteri f. nagariensis]
 gb|EFJ48520.1| hypothetical protein VOLCADRAFT_120872 [Volvox carteri f. nagariensis]
Length=881

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 12/101 (12%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A K+DS+M L FE+      +G L +++DTLL  FE+T+L  ++SKF QF++FY C  +P
Sbjct  418  ANKMDSMMELAFEHLQKRIAAGELRQLWDTLLSCFERTILNTHRSKFTQFLLFYVCIHNP  477

Query  146  ENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFM  24
             +C +  A +             R +  AYLAS+LARA F+
Sbjct  478  GHCSQSLAPIT------------RAACAAYLASFLARAAFV  506



>gb|KDO67298.1| hypothetical protein CISIN_1g0416052mg, partial [Citrus sinensis]
Length=292

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -1

Query  179  FVMFYACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            FVMFYAC+LDPENCG RFA ML  +F + ++    RMS+V+YLASYL+RARF+   F+ +
Sbjct  1    FVMFYACALDPENCGLRFATMLADVFVSGLYPPLTRMSSVSYLASYLSRARFLSPCFIVS  60



>gb|KDO67467.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis]
Length=202

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -1

Query  179  FVMFYACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            FVMFYAC+LDPENCG RFA ML  +F + ++    RMSAV+YLAS+L+RARF+   F+ +
Sbjct  1    FVMFYACALDPENCGLRFATMLADVFVSGLYPPLTRMSAVSYLASFLSRARFLSPCFIVS  60



>gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis]
Length=292

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -1

Query  179  FVMFYACSLDPENCGKRFANMLIHIFETSVHLEW-RMSAVAYLASYLARARFMDMPFVAA  3
            FVMFYAC+LDPENCG RFA ML  +F + ++    RMSAV+YLAS+L+RARF+   F+ +
Sbjct  1    FVMFYACALDPENCGLRFATMLADVFVSGLYPPLTRMSAVSYLASFLSRARFLSPCFIVS  60



>gb|KJE92659.1| hypothetical protein CAOG_003578 [Capsaspora owczarzaki ATCC 
30864]
Length=942

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 14/114 (12%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCN--ESGRL--GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACS  156
            QK+D +M L+FEY  +C    SG L    +F  LL +FE  +L  ++S+F QF++F  CS
Sbjct  507  QKMDGMMHLLFEYIDTCRLAVSGDLIVYELFTILLRNFEHRILPTHRSRFVQFLLFRICS  566

Query  155  LDPENCGKRFANMLI-HIFETSV----HLEWRMSAVAYLASYLARARFMDMPFV  9
             DP     R A + +  I + ++    H   R SA +Y+AS++ARA+++ +P V
Sbjct  567  FDP-----RLAELFLGFILQKALVEGGHTAIRQSAASYMASFVARAKYLPLPMV  615



>ref|XP_004363306.2| hypothetical protein CAOG_03578 [Capsaspora owczarzaki ATCC 30864]
Length=943

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 61/109 (56%), Gaps = 4/109 (4%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCN--ESGRL--GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACS  156
            QK+D +M L+FEY  +C    SG L    +F  LL +FE  +L  ++S+F QF++F  CS
Sbjct  508  QKMDGMMHLLFEYIDTCRLAVSGDLIVYELFTILLRNFEHRILPTHRSRFVQFLLFRICS  567

Query  155  LDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFV  9
             DP         +L        H   R SA +Y+AS++ARA+++ +P V
Sbjct  568  FDPRLAELFLGFILQKALVEGGHTAIRQSAASYMASFVARAKYLPLPMV  616



>dbj|GAN08251.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Mucor ambiguus]
Length=654

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 62/106 (58%), Gaps = 4/106 (4%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRL---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACS  156
             +KLD++M L F+YF  C +S  +     +F +L+  F++ VL   KS++ QF++FY CS
Sbjct  324  VRKLDAMMSLAFQYFSKCAQSASVDVQNEIFYSLVDIFDRAVLKTLKSRYTQFLLFYFCS  383

Query  155  LDPENCGKRFANMLIHIFETSVHLE-WRMSAVAYLASYLARARFMD  21
            L+       F   LIH     +     R++A AY+ SY+ARA+F+D
Sbjct  384  LNVNVYSDYFLEHLIHHITDPLKPNVTRVAAAAYIQSYVARAKFLD  429



>emb|CEP19450.1| hypothetical protein [Parasitella parasitica]
Length=661

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCNESGRL---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            +KLD++M L F+YF  C +S  +     +F  L+  F++ VL   KS++ QF++FY CSL
Sbjct  329  RKLDAMMNLAFQYFQKCGQSASVDIQNEIFHALVDIFDRAVLKTLKSRYTQFLLFYFCSL  388

Query  152  DPENCGKRFANMLI-HIFETSVHLEWRMSAVAYLASYLARARFMD  21
            +       F   LI HI +       R++A AY+ SY+ARA+F+D
Sbjct  389  NVNVYSDYFLEHLIQHITDPLKPNITRVAAAAYIQSYVARAKFLD  433



>ref|XP_006467185.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Citrus sinensis]
Length=588

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQ-----ESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFI  279
            F++ELED+E   DD +Q     ES +F +       +    +  A+ LDSLMVL FE+  
Sbjct  251  FEMELEDVEEAADDAEQVGDEVESINFHLPSGFLSRKSLSGNLIAELLDSLMVLTFEHLE  310

Query  278  SCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFV  174
            SC  +G L  VF+ LL SF+ TVL  YKSKFAQ +
Sbjct  311  SCEGTGCLIEVFEILLQSFQITVLNTYKSKFAQVM  345



>gb|EIE78658.1| hypothetical protein RO3G_03362 [Rhizopus delemar RA 99-880]
Length=501

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCNESGR---LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            +KLD++M L F+YF  C +S     L  +F  L+  F++ VL   KS++ QF++FY CSL
Sbjct  166  RKLDAMMNLSFQYFQKCAQSASADVLHEIFYALVDIFDRAVLKTLKSRYTQFLLFYFCSL  225

Query  152  DPENCGKRF-ANMLIHIFETSVHLEWRMSAVAYLASYLARARFMD  21
            +       F  ++L HI +       R++A AY++SY+ARA+F+D
Sbjct  226  NVHEYSDYFLEHLLQHITDPLRPNVTRVAAAAYISSYVARAKFLD  270



>gb|EPB87298.1| hypothetical protein HMPREF1544_05919 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=654

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRL---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACS  156
             +KLD++M L F+YF  C +S  +     +F +L+  F++ VL   KS++ QF++FY CS
Sbjct  324  VRKLDAMMNLAFQYFSKCAQSASVDVQNEIFYSLVDIFDRAVLKTLKSRYTQFLLFYFCS  383

Query  155  LDPENCGKRFANMLI-HIFETSVHLEWRMSAVAYLASYLARARFMD  21
            L+       F   LI HI +       R++A AY+ SY+ARA+F+D
Sbjct  384  LNVNVYSDYFLEHLIQHITDPLKPNVTRVAAAAYIQSYVARAKFLD  429



>emb|CEI99737.1| hypothetical protein RMCBS344292_13818 [Rhizopus microsporus]
Length=664

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCNESGR---LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            +KLD++M L F+YF  C ++     L  +F  L+  F++ VL   KS++ QF++FY CSL
Sbjct  331  RKLDAMMQLSFQYFQKCAQTAPSEVLHEIFYALVDIFDRAVLKTLKSRYTQFLLFYFCSL  390

Query  152  DPENCGKRFANMLI-HIFETSVHLEWRMSAVAYLASYLARARFMD  21
            +       F + L+ HI +       R++A AY++SY+ARA+F+D
Sbjct  391  NVHEYSDYFLDHLLQHITDPLKPNVTRVAAAAYISSYVARAKFLD  435



>emb|CEG79886.1| hypothetical protein RMATCC62417_14298 [Rhizopus microsporus]
Length=613

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCNESGR---LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            +KLD++M L F+YF  C ++     L  +F  L+  F++ VL   KS++ QF++FY CSL
Sbjct  331  RKLDAMMQLSFQYFQKCAQTAPSEVLHEIFYALVDIFDRAVLKTLKSRYTQFLLFYFCSL  390

Query  152  DPENCGKRFANMLI-HIFETSVHLEWRMSAVAYLASYLARARFMD  21
            +       F + L+ HI +       R++A AY++SY+ARA+F+D
Sbjct  391  NVHEYSDYFLDHLLQHITDPLKPNVTRVAAAAYISSYVARAKFLD  435



>emb|CEG73256.1| hypothetical protein RMATCC62417_08674 [Rhizopus microsporus]
 emb|CEI85962.1| hypothetical protein RMCBS344292_00411 [Rhizopus microsporus]
Length=664

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCNESGR---LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            +KLD++M L F+YF  C ++     L  +F  L+  F++ VL   KS++ QF++FY CSL
Sbjct  331  RKLDAMMQLSFQYFQKCAQTAPSEVLHEIFYALVDIFDRAVLKTLKSRYTQFLLFYFCSL  390

Query  152  DPENCGKRFANMLI-HIFETSVHLEWRMSAVAYLASYLARARFMD  21
            +       F + L+ HI +       R++A AY++SY+ARA+F+D
Sbjct  391  NVHEYSDYFLDHLLQHITDPLKPNVTRVAAAAYISSYVARAKFLD  435



>ref|XP_008863058.1| hypothetical protein H310_01652 [Aphanomyces invadans]
 gb|ETW09253.1| hypothetical protein H310_01652 [Aphanomyces invadans]
Length=687

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 74/140 (53%), Gaps = 8/140 (6%)
 Frame = -1

Query  425  DLEGPIDDGQQESFDFE--IQRDMWID--RFFGESASAQKLDSLMVLIFEYFISCNESGR  258
            D+E  +D  +++ F  +  +  D  +D     G    A KLD LM+  F Y     E+  
Sbjct  262  DVEIKLDTAEEDVFTMDDFLDDDTCVDPENMKGVDEMADKLDHLMLATFTYL----EAHD  317

Query  257  LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEW  78
              R+F  LL SF++++L  ++SK+ QF++FY C    E+     + ++    +  V    
Sbjct  318  HPRLFSFLLKSFDQSILNTHRSKYPQFLLFYVCKQPTEHQELLLSQLISVALDAKVPPVT  377

Query  77   RMSAVAYLASYLARARFMDM  18
            R+S  +YLASY+ARA+++ M
Sbjct  378  RLSCSSYLASYVARAKYLSM  397



>ref|XP_001870906.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Culex quinquefasciatus]
 gb|EDS34774.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Culex quinquefasciatus]
Length=603

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (51%), Gaps = 20/153 (13%)
 Frame = -1

Query  434  ELEDLEGP--IDDGQ----QESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISC  273
            E+ED E P   DDGQ    +E+   EI  D  +     E+     LD  +  +F Y    
Sbjct  246  EIEDAEFPDEADDGQIFAMEETPVIEIDDDETMKLPLAET-----LDCCLETMFRYI---  297

Query  272  NESGRL----GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHI  105
             E  R+     RV+  LL  F+K +L  + +   QF+MFY CS D ++ G+RF   L+ +
Sbjct  298  EERARIEGGSDRVYGLLLKLFDKHILPTHNTHHVQFLMFYCCSFD-QSYGERFIEHLLKM  356

Query  104  FET-SVHLEWRMSAVAYLASYLARARFMDMPFV  9
                ++    R +AV Y+AS LARA+++ MP +
Sbjct  357  VRNPNISTPTRQAAVGYVASLLARAKYVPMPLL  389



>ref|XP_005844143.1| hypothetical protein CHLNCDRAFT_54625 [Chlorella variabilis]
 gb|EFN52041.1| hypothetical protein CHLNCDRAFT_54625 [Chlorella variabilis]
Length=925

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            +A KLDS+M L F +  +   +G+L   + TLL +FE+ VL  ++SKF QF++FYAC   
Sbjct  353  TADKLDSMMELTFAHLAARQAAGQLPGAWATLLGAFERCVLLTHRSKFTQFLLFYACRQA  412

Query  149  PENCGKRFANMLI  111
            PE C + F ++LI
Sbjct  413  PEPCCRAFLHLLI  425



>ref|XP_005645323.1| RRN3-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20779.1| RRN3-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=801

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/122 (33%), Positives = 67/122 (55%), Gaps = 21/122 (17%)
 Frame = -1

Query  335  SASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYAC-  159
            + SA+KLD+LM L+FE+     E+G+L   + T L +F++T+L  ++SKF Q++++Y C 
Sbjct  324  TESAEKLDALMGLVFEHLGRRCEAGQLHAAWATTLHTFQRTILHTHRSKFTQYLLWYLCE  383

Query  158  -------------------SLDPENCGKRFANMLI-HIFETSVHLEWRMSAVAYLASYLA  39
                               S DP++C      +L+  +   +V    R +A AY+AS+LA
Sbjct  384  KARPLPLPFLPQPIYPSSTSEDPKHCSVSLVQLLLGQLTSPNVAPITRSAAAAYMASFLA  443

Query  38   RA  33
            RA
Sbjct  444  RA  445



>ref|XP_005834186.1| hypothetical protein GUITHDRAFT_107116 [Guillardia theta CCMP2712]
 gb|EKX47206.1| hypothetical protein GUITHDRAFT_107116 [Guillardia theta CCMP2712]
Length=591

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 6/130 (5%)
 Frame = -1

Query  386  FDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG----RVFDTLLLSFE  219
            FD +I      +R     A  +KLD++M L+F +F   N   R G    +VF  LL  F+
Sbjct  249  FDIDIDDSSTSERSENMKA-VEKLDAMMTLMFRFFHK-NLGKRAGHDRDQVFSVLLRIFD  306

Query  218  KTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLA  39
              VLT ++SK+ QF+ FY+C        +    ++  + E S     R +A +YL S+LA
Sbjct  307  SRVLTTFRSKYVQFLCFYSCHFRERYSREFLQYLMTKVVERSNPDNERHAAGSYLGSFLA  366

Query  38   RARFMDMPFV  9
            RARF+ +P V
Sbjct  367  RARFVKLPMV  376



>gb|EMS63005.1| hypothetical protein TRIUR3_02342 [Triticum urartu]
Length=571

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 6/100 (6%)
 Frame = -1

Query  344  FGESASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            FG +A A+KLD LMV++ E+  S +    L + F  L   F  ++L  ++SKFAQF+MFY
Sbjct  244  FGGNACAEKLDGLMVVVCEHLKSLDRQC-LYKEFVILKTIFRASLLRVHRSKFAQFIMFY  302

Query  164  ACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASY  45
             CSLDP+  G+ FA     +F T +  E +   ++ L  +
Sbjct  303  TCSLDPKTLGEDFA-----VFLTDIVTEKKEDPISRLVDW  337



>ref|XP_010108004.1| hypothetical protein L484_012360 [Morus notabilis]
 gb|EXC17569.1| hypothetical protein L484_012360 [Morus notabilis]
Length=344

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 68/147 (46%), Gaps = 36/147 (24%)
 Frame = -1

Query  443  FDIELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNES  264
            F +ELE +E   DD  ++  +   +      +  G +  A+KLD L+VL FE+  SC  S
Sbjct  197  FKMELELIEEATDDEFEDGGELPREPSR---KSLGANQFAEKLDCLLVLTFEHLESCEVS  253

Query  263  GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHL  84
            GRL ++                                 +NCG RFA +L  IF ++V+ 
Sbjct  254  GRLIQIL--------------------------------KNCGARFATVLTDIFVSNVYP  281

Query  83   EW-RMSAVAYLASYLARARFMDMPFVA  6
               RM AVAYLASYL+R +F+    V 
Sbjct  282  PLLRMRAVAYLASYLSRGKFLSTSLVT  308



>emb|CEF99449.1| RNA polymerase I specific transcription initiation factor RRN3 
[Ostreococcus tauri]
Length=759

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 4/142 (3%)
 Frame = -1

Query  434  ELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRL  255
            EL+D+E  I    +E    E ++            +A  LD+LM L   +     + G +
Sbjct  277  ELDDIEKSI----EEQCRAEWEQRPTTSAPLAVDEAADTLDALMELTLAHVNKRMDDGEM  332

Query  254  GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWR  75
              V   L+ +F+ T+L A +SKF QF++F+ CS D + C +    +   + + S     R
Sbjct  333  MLVRRALMHAFKVTLLPAPRSKFVQFLVFHMCSRDEQACRELTEELFTTLTDVSAAGSLR  392

Query  74   MSAVAYLASYLARARFMDMPFV  9
            ++A AY AS+LARA+ +   FV
Sbjct  393  LAAAAYFASFLARAKHLTPDFV  414



>ref|XP_003081725.1| RNA polymerase I transcription factor (ISS) [Ostreococcus tauri]
Length=631

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 4/142 (3%)
 Frame = -1

Query  434  ELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRL  255
            EL+D+E  I    +E    E ++            +A  LD+LM L   +     + G +
Sbjct  277  ELDDIEKSI----EEQCRAEWEQRPTTSAPLAVDEAADTLDALMELTLAHVNKRMDDGEM  332

Query  254  GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWR  75
              V   L+ +F+ T+L A +SKF QF++F+ CS D + C +    +   + + S     R
Sbjct  333  MLVRRALMHAFKVTLLPAPRSKFVQFLVFHMCSRDEQACRELTEELFTTLTDVSAAGSLR  392

Query  74   MSAVAYLASYLARARFMDMPFV  9
            ++A AY AS+LARA+ +   FV
Sbjct  393  LAAAAYFASFLARAKHLTPDFV  414



>ref|XP_009523651.1| hypothetical protein PHYSODRAFT_328981 [Phytophthora sojae]
 gb|EGZ20934.1| hypothetical protein PHYSODRAFT_328981 [Phytophthora sojae]
Length=786

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 64/120 (53%), Gaps = 14/120 (12%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISC-----------NESGRLGR---VFDTLLLSFEKTVLTAYKSK  189
            A KLD +M+++FE+   C           NE   + +   +F  LL  FE ++L  ++SK
Sbjct  319  ADKLDQMMLVMFEHIEQCTAAPDAATDASNEETDVRQAALIFKYLLKVFEHSILNTHRSK  378

Query  188  FAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFV  9
            + QF++FY C +DP+      + +L    +       R S  AYLAS+LARA+++ + ++
Sbjct  379  YPQFLLFYVCRMDPQFQDIFISQLLTTSLDPHTPPTTRQSCGAYLASFLARAKYISVAYL  438



>gb|ACJ85821.1| unknown [Medicago truncatula]
Length=292

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -1

Query  173  MFYACSLDPENCGKRFANMLIHIFETSVHLE-WRMSAVAYLASYLARARFMDMPFVA  6
            MFYAC+LD E CG  FA +L  +F++ V+    RMSAVAYLASYL+RA+F+    VA
Sbjct  1    MFYACALDSEGCGVNFAMVLTEMFDSRVNPPITRMSAVAYLASYLSRAKFLSSELVA  57



>emb|CCA21261.1| RNA polymerase Ispecific transcription initiation factor rrn3 
putative [Albugo laibachii Nc14]
Length=988

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 64/116 (55%), Gaps = 12/116 (10%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLG----------RVFDTLLLSFEKTVLTAYKSKFAQF  177
            A KLD +M+++FEY      SG++G           +F +LL +FE ++L  ++SK+ QF
Sbjct  304  ADKLDEMMLVMFEYL--GQSSGQVGENDSVTHEAAHIFKSLLRAFELSILNTHRSKYPQF  361

Query  176  VMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFV  9
            ++FY C    +      ++++    +  +    R +  AYLAS+LARA+++   ++
Sbjct  362  LLFYVCQYHSKFQNAFISHLITACIDPKIPAVTRQNCGAYLASFLARAKYVSTTYL  417



>ref|XP_006960280.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Wallemia sebi CBS 633.66]
 gb|EIM19617.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Wallemia sebi CBS 633.66]
Length=679

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISCNESGRLGRV--FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            QKLD +++++FE+     ++ +  ++  F TLL  FE+T+L  ++S++ QF +F   S D
Sbjct  325  QKLDDMLLILFEHLEKTRQNTQELQLNQFSTLLSVFERTILPTFRSRYTQFTLFKYSSYD  384

Query  149  PENCGKRFANMLIH--IFETSVHLEWRMSAVAYLASYLARARFMD  21
              +    F  ML+   IF++      R+ A +YLASY++RARF+D
Sbjct  385  A-HFADVFQGMLLSKAIFQSDEPSVTRIVAASYLASYVSRARFID  428



>ref|XP_001420013.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98306.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=761

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            +A  LD LM L   +     + G    V   L+ +F  T+L A +SKF QF++F+ CS D
Sbjct  314  AADTLDGLMELAVAHIDKRCDGGETDAVRQALIHAFTVTLLPAPRSKFVQFLVFHLCSRD  373

Query  149  PENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFV  9
               C +    +   + + SV    R++A AY AS+LARA+ +   FV
Sbjct  374  ERACRELTELLFTKLTDVSVAGSIRLAAAAYFASFLARAKHLKPEFV  420



>ref|XP_011420908.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Crassostrea gigas]
Length=279

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 67/135 (50%), Gaps = 30/135 (22%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYFIS--CNESGRLG-------------------------RVFDTLL  231
            +A KLD +M L+FE FIS  C  S  +G                         R+   LL
Sbjct  46   NADKLDGMMALMFE-FISERCRRSVVVGSFEGMTTGGVLTGNEKLMGGDNESERLLHALL  104

Query  230  LSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH-IFETSVHLEWRMSAVAYL  54
            ++F +++L  YK +  QF++F+ACS         F   L+H +    +H E R+++ AYL
Sbjct  105  IAFHESLLCTYKCRCVQFLIFFACSFSTRFTSA-FTRFLLHQVGNEQIHAEARIASAAYL  163

Query  53   ASYLARARFMDMPFV  9
            AS+LARA F+ +  V
Sbjct  164  ASFLARASFVPLSTV  178



>emb|CCI46668.1| unnamed protein product [Albugo candida]
Length=748

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 63/115 (55%), Gaps = 11/115 (10%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRL---------GRVFDTLLLSFEKTVLTAYKSKFAQFV  174
            A KLD +M+++FEY      SG+L           VF +LL +FE ++L  ++SK+ QF+
Sbjct  305  ADKLDKMMLVMFEYLEEA--SGQLRNECVPCEAAHVFRSLLRAFELSILNTHRSKYPQFL  362

Query  173  MFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFV  9
            +FY C    +      ++++    +  +    R S  AYLAS+LARA+++   ++
Sbjct  363  LFYLCQYHAKYQNAFISHLITASIDPKIPPVTRQSCGAYLASFLARAKYVSTTYL  417



>ref|XP_007302420.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Stereum hirsutum FP-91666 SS1]
 gb|EIM87917.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Stereum hirsutum FP-91666 SS1]
Length=875

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -1

Query  257  LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHL  84
            L   F TLL  F++T+L  +KS++ QF++FY  SLDPE     F   L+H  +F   + +
Sbjct  462  LRTTFHTLLSIFDRTILLTFKSRYTQFLLFYLTSLDPE-FADTFTGELVHKALFSPELPV  520

Query  83   EWRMSAVAYLASYLARARFM  24
              R ++ +Y+AS+++RARF+
Sbjct  521  VTRAASASYVASFVSRARFV  540



>ref|XP_009820935.1| hypothetical protein H257_00104 [Aphanomyces astaci]
 gb|ETV88535.1| hypothetical protein H257_00104 [Aphanomyces astaci]
Length=684

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP  147
            A KLD LM+  F Y  +   +    R+F  LL SF++++L  ++SK+ QF++FY C    
Sbjct  297  ADKLDHLMLATFTYLEAA--ASDHPRLFAFLLKSFDQSILNTHRSKYPQFLLFYICKSPS  354

Query  146  ENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDM  18
            E+     + ++    +  V    R+S  +YLASY+ARA+++ +
Sbjct  355  EHQELLLSQLISVALDAKVPPVTRLSCSSYLASYVARAKYLGL  397



>emb|CCU97734.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=581

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 42/134 (31%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGRV------------FDTLLLSFEKTVLTAYKSKFA  183
            A KLD++M  I+++       G +G +            + TLL  F +TVLT +KS+  
Sbjct  146  AGKLDAIMKAIYQFL-----DGHVGTLAHHDVHVRRHTLYQTLLGIFTRTVLTTFKSRHV  200

Query  182  QFVMFYACSLDPENCGKRFANMLIHIF------------------ETSVHLEWRMSAVAY  57
            QF++F+  SLD E     FA+M +                     E+SV L  R++A +Y
Sbjct  201  QFILFWFASLDHE-----FADMFLGTLLSKSLYATPAAGVAGESGESSVVL--RIAAASY  253

Query  56   LASYLARARFMDMP  15
            +ASY+ARAR++D P
Sbjct  254  VASYVARARYIDAP  267



>gb|KDO33327.1| hypothetical protein SPRG_02135 [Saprolegnia parasitica CBS 223.65]
Length=672

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 63/105 (60%), Gaps = 4/105 (4%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYF--ISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACS  156
            +A KLD++M+ +F +F  +   +      +F  LL SF+ +VL  ++SK+ QF++FY   
Sbjct  287  NADKLDNMMLTVFTHFEQLLATDPTVHTALFTFLLKSFDASVLNTHQSKYPQFLLFYIAK  346

Query  155  LDPENCGKRFANMLIHI-FETSVHLEWRMSAVAYLASYLARARFM  24
              PE+  + F + LI +  +T +    R S  +YLASY+ARA+++
Sbjct  347  TAPEH-QELFLSQLISVSLDTKIPPVTRHSCASYLASYVARAKYL  390



>gb|EKC17834.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Crassostrea gigas]
Length=557

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 67/135 (50%), Gaps = 30/135 (22%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYFIS--CNESGRLG-------------------------RVFDTLL  231
            +A KLD +M L+FE FIS  C  S  +G                         R+   LL
Sbjct  46   NADKLDGMMALMFE-FISERCRRSVVVGSFEGMTTGGVLTGNEKLMGGDNESERLLHALL  104

Query  230  LSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH-IFETSVHLEWRMSAVAYL  54
            ++F +++L  YK +  QF++F+ACS         F   L+H +    +H E R+++ AYL
Sbjct  105  IAFHESLLCTYKCRCVQFLIFFACSFSTRFTSA-FTRFLLHQVGNEQIHAEARIASAAYL  163

Query  53   ASYLARARFMDMPFV  9
            AS+LARA F+ +  V
Sbjct  164  ASFLARASFVPLSTV  178



>ref|XP_009269093.1| RNA polymerase I-specific transcription initiation factor rrn3 
[Wallemia ichthyophaga EXF-994]
 gb|EOR00029.1| RNA polymerase I-specific transcription initiation factor rrn3 
[Wallemia ichthyophaga EXF-994]
Length=676

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 63/105 (60%), Gaps = 6/105 (6%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFISC--NESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            QKLD ++ +IFEY      N+  +L + F TLL  FE+T+L  ++S++ QF++F   S +
Sbjct  322  QKLDGMLYMIFEYLDKSVRNQEVQLDQ-FSTLLSVFERTILPTFRSRYTQFILFKYSSYN  380

Query  149  PENCGKRFANMLIH--IFETSVHLEWRMSAVAYLASYLARARFMD  21
              +    F  ML+   +F+       R+ A +YLASY++RA+F+D
Sbjct  381  -AHFADIFQGMLLSKAMFQNEEPSVTRVVAASYLASYVSRAKFID  424



>ref|XP_009037267.1| hypothetical protein AURANDRAFT_71709 [Aureococcus anophagefferens]
 gb|EGB07890.1| hypothetical protein AURANDRAFT_71709 [Aureococcus anophagefferens]
Length=2046

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = -1

Query  332  ASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
             +  KLD +M  +F Y      S      FD LL  FE  +L   +SKF QF +F A + 
Sbjct  570  GAGAKLDDVMDGLFTYAQKRLASDSGDAFFDVLLDVFESAILKTKQSKFVQFAVFSAAAS  629

Query  152  DPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFVA  6
             P  C K    + + + + +  L  ++ AVAYLAS + R   +D P VA
Sbjct  630  SPARCAKFARRLTLVVADEATPLVTKVPAVAYLASLVCRCAAVDAPLVA  678



>gb|ETP25265.1| hypothetical protein F441_01846 [Phytophthora parasitica CJ01A1]
Length=783

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 64/127 (50%), Gaps = 21/127 (17%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF----------------ISCN-----ESGRLGRVFDTLLLSFEKTV  210
            A KLD +M+++FE+                 ++ N     +  +   +F  LL  FE ++
Sbjct  315  ADKLDQMMLVMFEHIEQSAASSSPASVSSDSVAANGDKDVDVRQAAVIFKYLLKVFEHSI  374

Query  209  LTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARAR  30
            L  ++SK+ QF++FY C +DP+      + +L    +       R S  AYLAS+LARA+
Sbjct  375  LNTHRSKYPQFLLFYVCRMDPQFQDVFISQLLATSLDPQTPPTTRQSCGAYLASFLARAK  434

Query  29   FMDMPFV  9
            ++ + ++
Sbjct  435  YISVAYL  441



>gb|ETK95246.1| hypothetical protein L915_01809 [Phytophthora parasitica]
 gb|ETM01707.1| hypothetical protein L917_01736 [Phytophthora parasitica]
Length=783

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 64/127 (50%), Gaps = 21/127 (17%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF----------------ISCN-----ESGRLGRVFDTLLLSFEKTV  210
            A KLD +M+++FE+                 ++ N     +  +   +F  LL  FE ++
Sbjct  315  ADKLDQMMLVMFEHIEQSAASSSPASVSSDSVAANGDKDVDVRQAAVIFKYLLKVFEHSI  374

Query  209  LTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARAR  30
            L  ++SK+ QF++FY C +DP+      + +L    +       R S  AYLAS+LARA+
Sbjct  375  LNTHRSKYPQFLLFYVCRMDPQFQDVFISQLLATSLDPQTPPTTRQSCGAYLASFLARAK  434

Query  29   FMDMPFV  9
            ++ + ++
Sbjct  435  YISVAYL  441



>ref|XP_008899287.1| hypothetical protein PPTG_06982 [Phytophthora parasitica INRA-310]
 gb|ETI55460.1| hypothetical protein F443_01885 [Phytophthora parasitica P1569]
 gb|ETM54938.1| hypothetical protein L914_01786 [Phytophthora parasitica]
 gb|ETN15778.1| hypothetical protein PPTG_06982 [Phytophthora parasitica INRA-310]
Length=783

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 64/127 (50%), Gaps = 21/127 (17%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF----------------ISCN-----ESGRLGRVFDTLLLSFEKTV  210
            A KLD +M+++FE+                 ++ N     +  +   +F  LL  FE ++
Sbjct  315  ADKLDQMMLVMFEHIEQSAASSSPASVSSDSVAANGDKDVDVRQAAVIFKYLLKVFEHSI  374

Query  209  LTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARAR  30
            L  ++SK+ QF++FY C +DP+      + +L    +       R S  AYLAS+LARA+
Sbjct  375  LNTHRSKYPQFLLFYVCRMDPQFQDVFISQLLATSLDPQTPPTTRQSCGAYLASFLARAK  434

Query  29   FMDMPFV  9
            ++ + ++
Sbjct  435  YISVAYL  441



>ref|XP_003055684.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60936.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=396

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 11/93 (12%)
 Frame = -1

Query  248  VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDP------ENCGKRFANMLIHIF---ET  96
            V D LL +F  T+L A+KSKF QF++F+AC+ D       E  G   A+ ++ +     T
Sbjct  21   VSDALLRTFVSTLLPAHKSKFTQFILFHACARDAAGIQGNEGEGGELASRVVEVLLERLT  80

Query  95   SVHLE--WRMSAVAYLASYLARARFMDMPFVAA  3
              H     R++A AYLAS+LARA F+   F+++
Sbjct  81   DPHHPPAGRLAATAYLASFLARATFLSAAFMSS  113



>emb|CBK20142.2| unnamed protein product [Blastocystis hominis]
Length=305

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 66/115 (57%), Gaps = 5/115 (4%)
 Frame = -1

Query  338  ESASAQKLDSLMVLIFEYFISCNESGRLGRV-FDTLLLSFEKTVLTAYKSKFAQFVMFYA  162
            +++ + K+D +M+++FEY     ES    +V F  L  +FEK ++  ++SK+ QF++FY 
Sbjct  106  QNSLSYKMDEIMMILFEYLKEQMESIENRKVLFRILQKAFEKFIMLTHRSKYTQFLIFYV  165

Query  161  CSLDPENCGKRFANMLIHIF--ETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
            CS DP +  +RF   L+  +  E S  L  R +   Y AS++ RA F+ +  + +
Sbjct  166  CSYDP-SFVERFVGRLVDWYCSEESPVLT-RQTCCVYCASFICRANFISIDIIRS  218



>gb|EMD40585.1| hypothetical protein CERSUDRAFT_111179 [Ceriporiopsis subvermispora 
B]
Length=738

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 78/158 (49%), Gaps = 29/158 (18%)
 Frame = -1

Query  419  EGPIDDGQQESFDFEIQRDM----------WIDRFFGESAS---------AQKLDSLMVL  297
            +GPIDD      DF+  +DM            D F    AS         +   DS ++L
Sbjct  323  DGPIDDVPS---DFQHVQDMVNKLDAILKNIFDHFNKMHASVAPTPLLSPSSPPDSFLLL  379

Query  296  IFEYFISCN--ESGRLGR--VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKR  129
                  S N  E GR  R   F+TLL  F++T+L  +KS++ QF++F+  SLDPE     
Sbjct  380  DIVRPASPNSLEEGRARRRAQFNTLLSIFDRTILRTFKSRYTQFLVFWYSSLDPE-FSDL  438

Query  128  FANMLI--HIFETSVHLEWRMSAVAYLASYLARARFMD  21
            F  ML+   + E       R +A +Y+AS+++RA+F+D
Sbjct  439  FQGMLVSKSLLEEDQPAVTRAAAASYIASFVSRAQFVD  476



>gb|ETO84187.1| hypothetical protein F444_01889 [Phytophthora parasitica P1976]
 gb|ETP53314.1| hypothetical protein F442_01824 [Phytophthora parasitica P10297]
Length=783

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 63/127 (50%), Gaps = 21/127 (17%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF----------------ISCN-----ESGRLGRVFDTLLLSFEKTV  210
            A KLD +M+++FE+                 ++ N     +  +   +F  LL  FE ++
Sbjct  315  ADKLDQMMLVMFEHIEQSAASSSPASVSSDSVAANGDKDVDVRQAAVIFKYLLKVFEHSI  374

Query  209  LTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARAR  30
            L  ++SK+ QF++FY C  DP+      + +L    +       R S  AYLAS+LARA+
Sbjct  375  LNTHRSKYPQFLLFYVCRTDPQFQDVFISQLLATSLDPQTPPTTRQSCGAYLASFLARAK  434

Query  29   FMDMPFV  9
            ++ + ++
Sbjct  435  YISVAYL  441



>gb|ETL48645.1| hypothetical protein L916_01774 [Phytophthora parasitica]
Length=783

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 63/127 (50%), Gaps = 21/127 (17%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF----------------ISCN-----ESGRLGRVFDTLLLSFEKTV  210
            A KLD +M+++FE+                 ++ N     +  +   +F  LL  FE ++
Sbjct  315  ADKLDQMMLVMFEHIEQSAASSSPASVSSDSVAANGDKDVDVRQAAVIFKYLLKVFEHSI  374

Query  209  LTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARAR  30
            L  ++SK+ QF++FY C  DP+      + +L    +       R S  AYLAS+LARA+
Sbjct  375  LNTHRSKYPQFLLFYVCRTDPQFQDVFISQLLATSLDPQTPPTTRQSCGAYLASFLARAK  434

Query  29   FMDMPFV  9
            ++ + ++
Sbjct  435  YISVAYL  441



>gb|EPS96015.1| hypothetical protein FOMPIDRAFT_1151482 [Fomitopsis pinicola 
FP-58527 SS1]
Length=776

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -1

Query  269  ESGRLGR--VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLI--HIF  102
            E GRL R   F  LL  F++T+L  +KS++ QF++F+  SLDPE     F  ML+   + 
Sbjct  429  EEGRLLRRQQFHMLLSIFDRTILRTFKSRYTQFLVFWYSSLDPE-FSDLFQGMLVSKSLL  487

Query  101  ETSVHLEWRMSAVAYLASYLARARFMD  21
            E       R +A +Y+AS+++RA+F+D
Sbjct  488  EEDQPAVTRAAAASYIASFVSRAQFVD  514



>ref|XP_002897714.1| RNA polymerase I-specific transcription initiation factor rrn3, 
putative [Phytophthora infestans T30-4]
 gb|EEY64787.1| RNA polymerase I-specific transcription initiation factor rrn3, 
putative [Phytophthora infestans T30-4]
Length=787

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -1

Query  248  VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMS  69
            +F  LL  FE ++L  ++SK+ QF++FY C +DP+      + +L    +       R S
Sbjct  363  IFKYLLKVFEHSILNTHRSKYPQFLLFYVCRMDPQFQDVFISQLLATSLDPQTPPTTRQS  422

Query  68   AVAYLASYLARARFMDMPFV  9
              AYLAS+LARA+++ + ++
Sbjct  423  CGAYLASFLARAKYISVAYL  442



>gb|KIM57353.1| hypothetical protein SCLCIDRAFT_1219565 [Scleroderma citrinum 
Foug A]
Length=769

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -1

Query  269  ESGRLGRV--FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IF  102
            ESGR  R   F TLL  FE+T++  +KS++ QF++F+  SLDPE     F  +L+   + 
Sbjct  423  ESGRTLRAKQFHTLLAIFERTIIRTFKSRYTQFLIFWYSSLDPE-FSDLFQGLLVEKALL  481

Query  101  ETSVHLEWRMSAVAYLASYLARARFMD  21
               +    R +A +Y+AS+++RA+F+D
Sbjct  482  GQDIPAVTRAAAASYIASFVSRAKFVD  508



>ref|XP_002023097.1| GL21145 [Drosophila persimilis]
 gb|EDW27225.1| GL21145 [Drosophila persimilis]
Length=596

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 61/120 (51%), Gaps = 7/120 (6%)
 Frame = -1

Query  356  IDRFFGESASAQKLDSLMVLIFEYFISC-----NESGR--LGRVFDTLLLSFEKTVLTAY  198
            ID    ++   Q  DS++  I     +C     NE  R    R F TLL  F++ +L ++
Sbjct  263  IDDITSDTVVKQPEDSVVHPIGHTLDTCLSMLYNEGKRWAANRFFKTLLYIFDEVLLPSH  322

Query  197  KSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDM  18
             +   QFV+F+ CS+         +++ + +   +V    R +AV Y+ASYLARA+F+ +
Sbjct  323  NTHHVQFVIFHVCSIRSAYSEAFLSSLWLKVQNPNVSAIIRHAAVGYIASYLARAKFVPL  382



>gb|KDQ29722.1| hypothetical protein PLEOSDRAFT_1039246 [Pleurotus ostreatus 
PC15]
Length=650

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F++T++  +KS++ QF++F+  SLDPE     F  +L+   + E  +    R 
Sbjct  329  FHTLLSIFDRTIIKTFKSRYTQFLLFWYSSLDPEYT-DLFQGLLVSKALLEEDLPAVTRS  387

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+ SY++RA+F+D
Sbjct  388  AAASYIGSYISRAKFID  404



>dbj|BAD45609.1| RNA polymerase I specific transcription initiation factor RRN3-like 
[Oryza sativa Japonica Group]
 dbj|BAD46065.1| RNA polymerase I specific transcription initiation factor RRN3-like 
[Oryza sativa Japonica Group]
Length=291

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 7/54 (13%)
 Frame = -1

Query  173  MFYACSLDPENCGKRFANMLIHIF----ETSVHLEWRMSAVAYLASYLARARFM  24
            MFYACSLDPE CG  FA  L  IF    E S+    RMSAV+Y+ SYL+RARF+
Sbjct  1    MFYACSLDPEICGLEFALFLSDIFIKKEEDSIS---RMSAVSYVGSYLSRARFI  51



>emb|CBJ29597.1| conserved unknown protein [Ectocarpus siliculosus]
Length=880

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = -1

Query  257  LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF--ETSVHL  84
            + R+  +LLL FE+ +L  ++SKF QFV+F+A S      G    + L+ +   E+   L
Sbjct  315  VARLLKSLLLVFEENILPTHRSKFVQFVLFFA-SGRARGLGYALVSKLVGVLGDESRPKL  373

Query  83   EWRMSAVAYLASYLARARFMDMPFVA  6
              R S+VAYLAS+LARA F+D   V+
Sbjct  374  T-RQSSVAYLASFLARASFVDPSLVS  398



>ref|XP_007365075.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Dichomitus squalens LYAD-421 SS1]
 gb|EJF62363.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Dichomitus squalens LYAD-421 SS1]
Length=789

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F++T+L  +KS++ QFV+F+  SLDPE     F  ML+   + E       R 
Sbjct  449  FHTLLAIFDRTILRTFKSRYTQFVVFWYSSLDPE-FADLFQGMLVSKALLEEDQPPVTRA  507

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RA+F+D
Sbjct  508  AAASYIASFVSRAQFVD  524



>emb|CDO73785.1| hypothetical protein BN946_scf185015.g113 [Trametes cinnabarina]
Length=786

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLI--HIFETSVHLEWRM  72
            F+TLL  F++T+L  +KS++ QF++F+  SLDPE     F  ML+   + E       R 
Sbjct  441  FNTLLSIFDRTILRTFKSRYTQFIVFWYSSLDPE-FADLFQGMLVSKSLLEEDQPAVTRA  499

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RA+F+D
Sbjct  500  AAASYIASFVSRAQFVD  516



>ref|XP_002179815.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48801.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=723

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 23/121 (19%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF-ISCNESGRLGR-VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            A+KLDSLM L+ EY   SC  +  L R  +  L   FE +++  +KSKF QF++ + C L
Sbjct  321  AEKLDSLMFLLLEYVEQSCAGNADLIREKYRILAQFFESSIIITHKSKFVQFLIVHVCGL  380

Query  152  D--------------PENCGKRFANMLIHI----FETSVHLEWRMSAVAYLASYLARARF  27
            +              P    ++FA+ LIH+    +  +V    R +A  YLAS+++RA F
Sbjct  381  ENKALESASCQNDQSPAILYRKFASSLIHVIVDPYRATV---TRQAAACYLASFVSRASF  437

Query  26   M  24
            +
Sbjct  438  V  438



>ref|XP_002845899.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Arthroderma otae CBS 113480]
 gb|EEQ32949.1| RNA polymerase I-specific transcription initiation factor rrn3 
[Arthroderma otae CBS 113480]
Length=683

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+DS++ ++FEY+     SG L    +V D LL  F+  +L  Y+S+ AQFV+F+     
Sbjct  349  KVDSMIDILFEYYHYPFISGSLEDQEQVLDILLAHFQTIILPTYRSRHAQFVLFHFAQAS  408

Query  149  PENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARA  33
            P     RFA   I I     H +  R  A AYLAS++AR 
Sbjct  409  PIFV-DRFATTCIEIILNKSHPVIIRQYAAAYLASFVARG  447



>ref|XP_002185107.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43239.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=745

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 23/121 (19%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF-ISCNESGRLGR-VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            A+KLDSLM L+ EY   SC  +  L R  +  L   FE +++  +KSKF QF++ + C L
Sbjct  321  AEKLDSLMFLLLEYVEQSCAGNADLIREKYRILAQFFESSIIITHKSKFVQFLIVHVCGL  380

Query  152  D--------------PENCGKRFANMLIHI----FETSVHLEWRMSAVAYLASYLARARF  27
            +              P    ++FA+ LIH+    +  +V    R +A  YLAS+++RA F
Sbjct  381  ENKALESASCQNDQSPAILYRKFASSLIHVIVDPYRATV---TRQAAACYLASFVSRASF  437

Query  26   M  24
            +
Sbjct  438  V  438



>ref|XP_002051281.1| GJ13145 [Drosophila virilis]
 gb|EDW63436.1| GJ13145 [Drosophila virilis]
Length=617

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 2/88 (2%)
 Frame = -1

Query  275  CNESGRLG--RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIF  102
            C +  R+   R F TL+  FE+ +L ++ +   QFV+FYACS+ P       + +   + 
Sbjct  310  CTDDQRIAKSRFFKTLVHIFEEVLLPSHNTHHVQFVIFYACSIRPAYTEIFLSALWHKVQ  369

Query  101  ETSVHLEWRMSAVAYLASYLARARFMDM  18
              +V    R +AV+Y+AS+LARA+F+ +
Sbjct  370  NPNVSSIIRHAAVSYIASFLARAKFVPL  397



>ref|XP_008035540.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Trametes versicolor FP-101664 SS1]
 gb|EIW61642.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Trametes versicolor FP-101664 SS1]
Length=785

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLI--HIFETSVHLEWRM  72
            F+TLL  F++T+L  +KS++ QF++F+  SLDPE     F  ML+   + E       R 
Sbjct  441  FNTLLSIFDRTILRTFKSRYTQFIVFWYSSLDPE-FADLFQGMLVSKSLLEEDQPAVTRA  499

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RA+F+D
Sbjct  500  AAASYIASFVSRAQFVD  516



>gb|EMS19160.1| RNA polymerase I specific transcription initiation factor RRN3 
[Rhodosporidium toruloides NP11]
 emb|CDR36767.1| RHTO0S02e06590g1_1 [Rhodosporidium toruloides]
Length=915

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 50/78 (64%), Gaps = 3/78 (4%)
 Frame = -1

Query  248  VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLI--HIFETSVHLEWR  75
            +F TLL  F++T+L  +K++  QFV+FY CSLD  +    F  +L+   +F+       R
Sbjct  506  LFRTLLDIFDRTLLRTFKTRNVQFVLFYLCSLDSAST-DHFIGVLLGRALFDQDAPPVTR  564

Query  74   MSAVAYLASYLARARFMD  21
            ++A  Y+AS++ARA+++D
Sbjct  565  VAAAGYVASFIARAKYVD  582



>ref|XP_001729985.1| hypothetical protein MGL_2971 [Malassezia globosa CBS 7966]
 gb|EDP42771.1| hypothetical protein MGL_2971 [Malassezia globosa CBS 7966]
Length=588

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 17/119 (14%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF-------ISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMF  168
            A KLD++M  + E+         S N   R  +++ TLL  F +T+LT +KS+  QF+MF
Sbjct  130  AGKLDAIMKALHEFLERQVGTPRSQNMLTRRYQLYQTLLGLFTRTILTTFKSRHVQFIMF  189

Query  167  YACSLDPENCGKRFANML---IHIFETSVHLE-------WRMSAVAYLASYLARARFMD  21
            +  SLD E        +L   ++   T+   E        R++A +Y+ASY+ARAR++D
Sbjct  190  WFASLDHEFADMFLGTLLSKSLYAVPTAGTSETGESATILRIAAASYVASYVARARYID  248



>ref|XP_003714640.1| hypothetical protein MGG_01654 [Magnaporthe oryzae 70-15]
 gb|EHA54833.1| hypothetical protein MGG_01654 [Magnaporthe oryzae 70-15]
 gb|ELQ43288.1| RNA polymerase I-specific transcription initiation factor rrn3 
[Magnaporthe oryzae Y34]
 gb|ELQ60494.1| RNA polymerase I-specific transcription initiation factor rrn3 
[Magnaporthe oryzae P131]
Length=692

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 52/104 (50%), Gaps = 3/104 (3%)
 Frame = -1

Query  335  SASAQKLDSLMVLIFEYFISCNE---SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            S + QKLD++M ++FE +    E   S     V   L+  F   VL  YKS+  QF++F+
Sbjct  357  STTIQKLDAIMDMLFEVYKPSFENPTSDEAKEVLGDLISDFVNLVLPTYKSRHTQFLVFH  416

Query  164  ACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARA  33
                 PE        +    FE++  +  R SA AYLASY+AR 
Sbjct  417  FSQYSPELMDLFVGTLFNMAFESNRPMALRQSATAYLASYVARG  460



>gb|EGU13471.1| Pirin domain-containing protein [Rhodotorula glutinis ATCC 204091]
Length=1886

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 50/78 (64%), Gaps = 3/78 (4%)
 Frame = -1

Query  248   VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLI--HIFETSVHLEWR  75
             +F TLL  F++T+L  +K++  QFV+FY CSLD  +    F  +L+   +F+       R
Sbjct  1225  LFRTLLDIFDRTLLRTFKTRNVQFVLFYLCSLDSAST-DHFIGVLLGRALFDQDAPPVTR  1283

Query  74    MSAVAYLASYLARARFMD  21
             ++A  Y+AS++ARA+++D
Sbjct  1284  VAAAGYVASFIARAKYVD  1301



>ref|XP_009495733.1| hypothetical protein H696_03588 [Fonticula alba]
 gb|KCV70127.1| hypothetical protein H696_03588 [Fonticula alba]
Length=724

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNES---GRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+D+L+ + F++  +C++        +V   LL  FE+ V+   +S+FAQF++F+  SL 
Sbjct  317  KIDTLLKIAFDFLNNCHQHLDEATCLKVLQALLRPFERYVVPTNQSRFAQFLVFHFASLS  376

Query  149  PENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARAR  30
            P        +M   + + S  L  R +A +Y++S+LAR+R
Sbjct  377  PALAQHFITHMQRLLLDPSKPLVSRQAAASYISSFLARSR  416



>ref|XP_001876557.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Laccaria bicolor S238N-H82]
 gb|EDR12293.1| predicted protein [Laccaria bicolor S238N-H82]
Length=643

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -1

Query  293  FEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANML  114
            F+     ++S  L   F +LL  F++T+L  +KS++ QF++F+  SLDPE     F  ML
Sbjct  316  FDSHAQASKSSSLRIQFHSLLSIFDRTILRTFKSRYTQFLVFWYTSLDPE-FADIFQGML  374

Query  113  I-HIFETSVHLEWRMSAVAYLASYLARARFMD  21
            +   F  +     R +A +Y+ S+++RA F+D
Sbjct  375  VDRAFSPTTPELTRAAAASYIGSFVSRATFVD  406



>emb|CBI37498.3| unnamed protein product [Vitis vinifera]
Length=61

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKF  186
            KLDSL VL FE+  SC   GRL  VF TL+ SF+ TVL AYKS  
Sbjct  14   KLDSLRVLTFEHLESCEGGGRLIEVFKTLIPSFQTTVLNAYKSNL  58



>ref|XP_002172987.1| ribosomal DNA transcription factor Rrn3 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB06694.1| ribosomal DNA transcription factor Rrn3 [Schizosaccharomyces 
japonicus yFS275]
Length=590

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (56%), Gaps = 12/109 (11%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNESGRLGR--VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
             ++LD L+ ++F Y  S      + R  V++ L+ SF  TVL  ++S++ QF++F+A   
Sbjct  311  VEQLDQLLYMLFAYLDSNLSPINVDREIVYNYLINSFVSTVLNTFQSRYVQFLIFWASQK  370

Query  152  DPENCGKRFANMLIHI-----FETSVHLEWRMSAVAYLASYLARARFMD  21
            DPE     F ++L+ +      + S     R+S+  Y+ SY+ARA+ +D
Sbjct  371  DPE-----FTDILLGVLTEVCLDPSKSCTIRISSAMYIGSYVARAKSLD  414



>ref|XP_005943145.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Haplochromis burtoni]
Length=610

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-CNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            A++LD+LM ++  Y    C   G     R   ++  LL  F+K +L  + S   Q+ +FY
Sbjct  274  AERLDTLMAVLMAYIKDVCYVDGSFHAERTKELYRDLLTVFDKLILPTHASCHVQYTLFY  333

Query  164  ACSLDPENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             CS  P    + F + L  I +  S+    R +A  YL S+LARA+F+ +  V A
Sbjct  334  LCSFKPA-LAEAFLDHLWKILQNPSLPAVLRQAAAGYLGSFLARAKFIPLSTVRA  387



>gb|KDQ15362.1| hypothetical protein BOTBODRAFT_54658 [Botryobasidium botryosum 
FD-172 SS1]
Length=725

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 67/135 (50%), Gaps = 36/135 (27%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCN-------------------------------ESGRLGR--VFD  240
            KLD+++ LIFE+F   +                               E GR  R   F 
Sbjct  335  KLDAILKLIFEHFNHTHSIAISRPMTPSRHDPPRDASPSSRPHSPISPEQGRAMRRSQFL  394

Query  239  TLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRMSA  66
             LL  F++T++  +KS++ QF++F+  SLDPE     F  +L+   +FE       R++A
Sbjct  395  ALLAIFDRTIIRTFKSRYTQFLLFWYSSLDPE-FTDLFQGLLVSKALFEADQPAVTRVAA  453

Query  65   VAYLASYLARARFMD  21
             +Y+ASY++RA+F+D
Sbjct  454  ASYVASYVSRAQFVD  468



>ref|XP_005943146.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Haplochromis burtoni]
Length=611

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-CNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            A++LD+LM ++  Y    C   G     R   ++  LL  F+K +L  + S   Q+ +FY
Sbjct  274  AERLDTLMAVLMAYIKDVCYVDGSFHAERTKELYRDLLTVFDKLILPTHASCHVQYTLFY  333

Query  164  ACSLDPENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             CS  P    + F + L  I +  S+    R +A  YL S+LARA+F+ +  V A
Sbjct  334  LCSFKPA-LAEAFLDHLWKILQNPSLPAVLRQAAAGYLGSFLARAKFIPLSTVRA  387



>ref|XP_003838675.1| hypothetical protein LEMA_P023480.1 [Leptosphaeria maculans JN3]
 emb|CBX95196.1| hypothetical protein LEMA_P023480.1 [Leptosphaeria maculans JN3]
Length=751

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 62/125 (50%), Gaps = 11/125 (9%)
 Frame = -1

Query  395  QESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRL---GRVFDTLLLS  225
            +ES D E  R   I          +KLD++M + F Y+ S  E G L     +F++LL  
Sbjct  385  EESLDPEEARVKQIKELM------RKLDNIMDVQFAYYDSIFEKGNLLAIDEIFESLLSQ  438

Query  224  FEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHI-FETSVHLEWRMSAVAYLAS  48
            F   +L  Y+S+  QFV+F+  S    +   RFA    H+ F+       R SA AYLAS
Sbjct  439  FANIILPTYRSRHTQFVLFH-FSQTSSDLINRFAGCCSHLAFDQGRPQLMRASAAAYLAS  497

Query  47   YLARA  33
            ++AR 
Sbjct  498  FIARG  502



>ref|XP_004576055.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Maylandia zebra]
Length=610

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-CNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            A++LD+LM ++  Y    C   G     R   ++  LL  F+K +L  + S   Q+ +FY
Sbjct  274  AERLDTLMAVLMAYIKDVCYVDGSFHAERTKELYRDLLTVFDKLILPTHASCHVQYTLFY  333

Query  164  ACSLDPENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             CS  P    + F + L  I +  S+    R +A  YL S+LARA+F+ +  V A
Sbjct  334  LCSFKPA-LAEAFLDHLWKILQNPSLPAVLRQAAAGYLGSFLARAKFIPLSTVRA  387



>ref|XP_004576056.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Maylandia zebra]
Length=611

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-CNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            A++LD+LM ++  Y    C   G     R   ++  LL  F+K +L  + S   Q+ +FY
Sbjct  274  AERLDTLMAVLMAYIKDVCYVDGSFHAERTKELYRDLLTVFDKLILPTHASCHVQYTLFY  333

Query  164  ACSLDPENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             CS  P    + F + L  I +  S+    R +A  YL S+LARA+F+ +  V A
Sbjct  334  LCSFKPA-LAEAFLDHLWKILQNPSLPAVLRQAAAGYLGSFLARAKFIPLSTVRA  387



>ref|XP_005754251.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X1 [Pundamilia nyererei]
Length=610

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-CNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            A++LD+LM ++  Y    C   G     R   ++  LL  F+K +L  + S   Q+ +FY
Sbjct  274  AERLDTLMAVLMAYIKDVCYVDGSFHAERTKELYRDLLTVFDKLILPTHASCHVQYTLFY  333

Query  164  ACSLDPENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             CS  P    + F + L  I +  S+    R +A  YL S+LARA+F+ +  V A
Sbjct  334  LCSFKPA-LAEAFLDHLWKILQNPSLPAVLRQAAAGYLGSFLARAKFIPLSTVRA  387



>ref|XP_005754252.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like isoform X2 [Pundamilia nyererei]
Length=611

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-CNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            A++LD+LM ++  Y    C   G     R   ++  LL  F+K +L  + S   Q+ +FY
Sbjct  274  AERLDTLMAVLMAYIKDVCYVDGSFHAERTKELYRDLLTVFDKLILPTHASCHVQYTLFY  333

Query  164  ACSLDPENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             CS  P    + F + L  I +  S+    R +A  YL S+LARA+F+ +  V A
Sbjct  334  LCSFKPA-LAEAFLDHLWKILQNPSLPAVLRQAAAGYLGSFLARAKFIPLSTVRA  387



>ref|XP_001356293.2| GA17133 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL33356.2| GA17133 [Drosophila pseudoobscura pseudoobscura]
Length=609

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 59/112 (53%), Gaps = 9/112 (8%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-------CNESGR--LGRVFDTLLLSFEKTVLTAYKSKFAQFV  174
               LD+ + +++++  S       C+E  R    R F TLL  F++ +L ++ +   QFV
Sbjct  284  GHTLDTCLSMLYKFVDSKTRILPDCSEGKRWAANRFFKTLLYIFDEVLLPSHNTHHVQFV  343

Query  173  MFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDM  18
            +F+ CS+         +++ + +   +V    R +AV Y ASYLARA+F+ +
Sbjct  344  IFHVCSIRSAYSEAFLSSLWLKVQNPNVSAIIRHAAVGYTASYLARAKFVPL  395



>emb|CDS11486.1| hypothetical protein LRAMOSA03749 [Absidia idahoensis var. thermophila]
Length=667

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 64/109 (59%), Gaps = 12/109 (11%)
 Frame = -1

Query  323  QKLDSLMVLIFEYF----ISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACS  156
            +KLD++MVL+  Y     I+   + R   +++TLL  F++ ++   KS++ QF++FY  S
Sbjct  322  RKLDAMMVLVLRYLSKYAINSTNTER-TEMYNTLLNLFDQQIVMTLKSRYTQFLLFYFSS  380

Query  155  LDPENCGKRFANMLIHIFE----TSVHLEWRMSAVAYLASYLARARFMD  21
            L+     + F +   H+FE    +S     R++  AY++SY+ARA+ +D
Sbjct  381  LEVNVFPEHFID---HLFESMNDSSRPGIIRIACAAYISSYVARAKVLD  426



>ref|XP_008557240.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like, partial [Microplitis demolitor]
Length=385

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 54/106 (51%), Gaps = 10/106 (9%)
 Frame = -1

Query  317  LDSLMVLIFEYFISCNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            +D LM+ + EY   C+  G      L +++  LL  FEK VL  + S   QF+MFY CS 
Sbjct  283  MDILMIYVEEY---CHPDGDLNQDNLKKIYFELLQPFEKVVLHTHASHHVQFIMFYICSF  339

Query  152  DPENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARARFMDM  18
                  + F N L   +   +V    R SAV+Y+AS LAR  F+ +
Sbjct  340  KTA-VAEAFLNWLWQKVSNPNVAPIIRQSAVSYIASLLARGNFIPI  384



>ref|XP_005809521.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Xiphophorus maculatus]
Length=606

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 73/155 (47%), Gaps = 14/155 (9%)
 Frame = -1

Query  434  ELEDLEGPIDDGQQESFDFEIQRDMWIDRFFGES----ASAQKLDSLMVLIFEYFIS-CN  270
            E+E+ E   +  Q E   F++  DM  D+    +      A++LD+LMV++  Y    CN
Sbjct  230  EIEEAEE--NQNQPEDGLFDMDEDMTADQPHRTNIMAHPVAERLDTLMVVLMAYIRDVCN  287

Query  269  ESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHI  105
              G     R   ++  LL  F+K +L  + S   Q+ +FY CS       + F + L  +
Sbjct  288  VDGSFHAERTKELYKDLLSVFDKLILPTHASGHVQYTLFYLCSFK-LALAEAFLDHLWKV  346

Query  104  FETSVHLE-WRMSAVAYLASYLARARFMDMPFVAA  3
             +        R +A  YL S++ARA+F+ +  V A
Sbjct  347  LQNPTQPAILRQAAAGYLGSFMARAKFVPVLTVRA  381



>gb|KII95045.1| hypothetical protein PLICRDRAFT_98907 [Plicaturopsis crispa FD-325 
SS-3]
Length=770

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F++T++  +KS++ QF++F+  SLDPE     F  ML+   + +       R 
Sbjct  440  FHTLLSIFDRTIIRTFKSRYTQFLVFWYSSLDPE-FSDLFQGMLVEKALLDRDQPAVTRA  498

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RARF+D
Sbjct  499  AAASYIASFVSRARFVD  515



>gb|ELT94357.1| hypothetical protein CAPTEDRAFT_221291 [Capitella teleta]
Length=567

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 8/119 (7%)
 Frame = -1

Query  338  ESASAQKLDSLMVLIFEYF-ISCNESGRLG-----RVFDTLLLSFEKTVLTAYKSKFAQF  177
            + A A +LD +M L+  Y    C E   L       +F  LL  F+K V+  Y S   QF
Sbjct  246  QHAEADRLDQIMHLLLYYIHFVCYEKDELKWTECKTIFRELLTVFDKIVVKTYASSHTQF  305

Query  176  VMFYACSLDPENCGKRFANMLIHIFETSVH-LEWRMSAVAYLASYLARARFMDMPFVAA  3
             MFY CS + +   + F + L    +   H + +R ++VAY+AS++ARA++++   V A
Sbjct  306  FMFYICSFN-DLLVEGFLDYLWKRVQNPSHGMVFRQASVAYMASFIARAKYVNGSSVTA  363



>gb|EPQ64152.1| hypothetical protein BGT96224_76 [Blumeria graminis f. sp. tritici 
96224]
Length=629

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 5/103 (5%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYFISC---NESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYAC  159
            + +KLD+++ L+F+ +  C     S      F+TLL  F   +L  Y+S+  QF++F+  
Sbjct  309  NVEKLDTILELLFQVYTPCFSDPNSAVAVSTFETLLAHFANIILPTYRSRHTQFLLFHFA  368

Query  158  SLDPENCGKRFANMLIHI-FETSVHLEWRMSAVAYLASYLARA  33
                E+   +FA   + + F+T      R SA AYLAS++AR 
Sbjct  369  Q-KSEHLVDQFAGTCVQLAFQTGRPAILRQSAAAYLASFVARG  410



>ref|XP_319773.4| AGAP009024-PA [Anopheles gambiae str. PEST]
 gb|EAA14800.4| AGAP009024-PA [Anopheles gambiae str. PEST]
Length=602

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF-ISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            A+ LD  M +IF Y   +    G+  R+F  +L  F+  +L A+ +  AQF+MFY CS  
Sbjct  279  AETLDWFMEIIFNYIEQTVKVDGQGDRLFKIVLNQFDAHILPAHNTDHAQFIMFYICSFK  338

Query  149  PENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
                    +++  ++   +     R ++V Y+AS LARA+++ + ++ +
Sbjct  339  LSYAEHFISSLWKNVNNLNKSPNVRQTSVGYIASMLARAKYVPLNYLKS  387



>gb|KIM91228.1| hypothetical protein PILCRDRAFT_811739 [Piloderma croceum F 1598]
Length=762

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (62%), Gaps = 11/81 (14%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEW----  78
            F TLL  F++T++  +KS++ QF++F+  SLDPE     F+++   +  +   LE     
Sbjct  441  FHTLLSIFDRTIIRTFKSRYTQFLVFWYSSLDPE-----FSDLFQGLLVSKALLEQDQPA  495

Query  77   --RMSAVAYLASYLARARFMD  21
              R +A +Y+ S+++RA+F+D
Sbjct  496  VTRAAAASYIGSFVSRAQFVD  516



>gb|KIJ57003.1| hypothetical protein M422DRAFT_198368 [Sphaerobolus stellatus 
SS14]
Length=747

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F++T++  +KS++ QF++F+  SLDPE     F  ML+   + E +  +  R 
Sbjct  420  FITLLSIFDRTIIRTFKSRYTQFLIFWFSSLDPE-FTDMFQGMLVSKALLEDNQPIVTRA  478

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RA+F+D
Sbjct  479  AAASYIASFVSRAQFVD  495



>ref|XP_007382010.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN10498.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Punctularia strigosozonata HHB-11173 SS5]
Length=743

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F  LL  F++T++  +KS++ QF++F+  SLDPE     F  ML+   + ET      R 
Sbjct  409  FYNLLSIFDRTIIRTFKSRYTQFLVFWYSSLDPE-FSDLFQGMLLSKALLETDQPAVTRA  467

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RARF+D
Sbjct  468  AATSYVASFVSRARFVD  484



>ref|XP_007862226.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Gloeophyllum trabeum ATCC 11539]
 gb|EPQ59164.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Gloeophyllum trabeum ATCC 11539]
Length=752

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F  LL  F++ ++  +KS++ QF++F+  SLDPE     F  ML+   + E    +  R 
Sbjct  411  FHALLSIFDRAIIRTFKSRYTQFLVFWYSSLDPE-FSDLFQGMLVSKALLEDDQPVVTRA  469

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RA+F+D
Sbjct  470  AAASYIASFVSRAQFVD  486



>ref|XP_004998396.1| hypothetical protein PTSG_00924 [Salpingoeca rosetta]
 gb|EGD76221.1| hypothetical protein PTSG_00924 [Salpingoeca rosetta]
Length=865

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 59/110 (54%), Gaps = 3/110 (3%)
 Frame = -1

Query  323  QKLDSLMVLIFEYFIS--CNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            +KLD+++    ++       E G    +F+ L+  F++ VL AY +   QF+ FYA    
Sbjct  308  RKLDTVLSYTLDFVNHKLYEEGGNPDELFEMLMSIFDEQVLMAYHTSHVQFIWFYAAHYG  367

Query  149  PENCGKRFAN-MLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
                 +RF    +  + + ++ +  + +A+AY+ S++ARA ++ + FVA+
Sbjct  368  ENQLARRFVQECMAKLGDPTIAVIVQQAAIAYVGSFVARANYLSLNFVAS  417



>ref|XP_002671366.1| predicted protein [Naegleria gruberi]
 gb|EFC38622.1| predicted protein [Naegleria gruberi]
Length=821

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 39/131 (30%), Positives = 63/131 (48%), Gaps = 31/131 (24%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCN--------------------ESGR---------LGRVFDTL  234
            A+KLDS++ ++FEY                         ESG          L  +F ++
Sbjct  314  AEKLDSIVTILFEYINERANAPPSSPVHLHPPRQNNKYLESGNSEIKGKNEFLDSIFHSM  373

Query  233  LLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLI-HIFETSVHLEWRMSAVAY  57
            ++ F   VL  Y+    QF+MFY CS    N  +RF + L+ +IF + +H+E R    AY
Sbjct  374  MVLFRSFVLNQYQLHSIQFLMFYVCSFHV-NYMERFISFLLGNIFNSQLHVEVRKCCAAY  432

Query  56   LASYLARARFM  24
            L+  L+RA+++
Sbjct  433  LSGLLSRAKYV  443



>ref|XP_002002618.1| GI11780 [Drosophila mojavensis]
 gb|EDW12060.1| GI11780 [Drosophila mojavensis]
Length=617

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = -1

Query  338  ESASAQKLDSLMVLIFEYF-------ISCNESGRLG--RVFDTLLLSFEKTVLTAYKSKF  186
            E    Q LD  ++ +F++          C++  R+   R F TL+  F++ +L ++ +  
Sbjct  282  EHPIGQMLDICLMKLFKFVDDKCRPQPDCSDDQRVAKTRFFKTLVHIFDEVLLPSHNTHH  341

Query  185  AQFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDM  18
             QFV+F+ACS+ P        ++   +   +V    R +AV+Y+AS+LARA+F+ +
Sbjct  342  VQFVIFHACSIRPAYAEIFLTSLWQKVQNPNVSSIIRHAAVSYIASFLARAKFVPL  397



>gb|EZG08879.1| hypothetical protein H106_02061 [Trichophyton rubrum CBS 735.88]
Length=475

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+DS++ ++FEY+     SG L    +V D LL+ F+  +L +Y+S+ AQFV+F+     
Sbjct  141  KVDSMVDILFEYYNYPFISGSLEDQEQVLDFLLVHFQSIILPSYRSRHAQFVLFHFAQAS  200

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA   I  I   S  +  R  A AYLAS++AR 
Sbjct  201  PIFV-DRFATTCIEIILSKSQPVIIRQYAAAYLASFVARG  239



>ref|XP_002484284.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Talaromyces stipitatus ATCC 10500]
 gb|EED17050.1| RNA polymerase I specific transcription initiation factor RRN3 
superfamily [Talaromyces stipitatus ATCC 10500]
Length=697

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (48%), Gaps = 14/148 (9%)
 Frame = -1

Query  431  LEDLEGPI--------DDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFIS  276
            LE+L  P+        DD   ES   + + D+   R      +  K+DS++  +FE++ S
Sbjct  329  LEELSRPLEIEYMDEEDDSDGESV-LDDEADIEARRLQTVKDNISKVDSMIDQLFEFYSS  387

Query  275  CNESGR---LGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHI  105
               +G      ++ D LL  F   VL  Y+S+  QF++F+     P+   K F +  +HI
Sbjct  388  PFNTGTDDTKSQILDLLLSHFVNYVLPTYRSRHTQFLVFHFSQFSPDLVEK-FVSTCMHI  446

Query  104  FETSVHLE-WRMSAVAYLASYLARARFM  24
             ++       R SA AYL S++AR + +
Sbjct  447  IDSKTQPAIMRQSAAAYLGSFVARGKHV  474



>gb|EPZ31565.1| RNA polymerase I transcription initiation factor RRN3 domain-containing 
protein [Rozella allomycis CSF55]
Length=549

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 36/106 (34%), Positives = 53/106 (50%), Gaps = 3/106 (3%)
 Frame = -1

Query  332  ASAQKLDSLMVLIFEYFISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            AS + LDSLM L FE      E      +F   +  FEKT+L  + S++ QF+ FY  SL
Sbjct  265  ASIETLDSLMKLTFENVKEIMEKEEDKEMFLVFMSIFEKTILRTFNSRYVQFIFFYVTSL  324

Query  152  DPENCGKRFANMLIHIFET-SVHL--EWRMSAVAYLASYLARARFM  24
            D +        ++  +F   SV L    R+S   Y+ S++AR  F+
Sbjct  325  DSKYHDIFLGMLMSKLFNNRSVILCDPIRISCAGYIGSFIARGLFL  370



>ref|XP_007711391.1| hypothetical protein COCCADRAFT_4303 [Bipolaris zeicola 26-R-13]
 gb|EUC34254.1| hypothetical protein COCCADRAFT_4303 [Bipolaris zeicola 26-R-13]
Length=692

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 70/139 (50%), Gaps = 14/139 (10%)
 Frame = -1

Query  428  EDLEGPIDDGQ---QESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGR  258
            ED +   DDG     ES + E QR   I        +  KLD++M + F Y+ S  E G 
Sbjct  298  EDDDNMSDDGSVSSHESLEPEEQRLKDI------KDTMLKLDTVMDVQFAYYDSIFEKGD  351

Query  257  L---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHI-FETSV  90
            L    R + +L+  F+  ++  Y+S+  QF++F+   L   +  +RF +   H+  +++ 
Sbjct  352  LLEMDRTYQSLIAQFQSIIIPTYRSRHTQFILFHFSQLS-TDFMERFVDTCSHLAIDSNR  410

Query  89   HLEWRMSAVAYLASYLARA  33
                R SA AYLASY+AR 
Sbjct  411  PPLLRASACAYLASYIARG  429



>gb|EUN30478.1| hypothetical protein COCVIDRAFT_23744 [Bipolaris victoriae FI3]
Length=693

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 70/139 (50%), Gaps = 14/139 (10%)
 Frame = -1

Query  428  EDLEGPIDDGQ---QESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGR  258
            ED +   DDG     ES + E QR   I        +  KLD++M + F Y+ S  E G 
Sbjct  298  EDDDNMSDDGSVSSHESLEPEEQRLKDI------KDTMLKLDTVMDVQFAYYDSIFEKGD  351

Query  257  L---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHI-FETSV  90
            L    R + +L+  F+  ++  Y+S+  QF++F+   L   +  +RF +   H+  +++ 
Sbjct  352  LLEMDRTYQSLIAQFQSIIIPTYRSRHTQFILFHFSQLS-TDFMERFVDTCSHLAIDSNR  410

Query  89   HLEWRMSAVAYLASYLARA  33
                R SA AYLASY+AR 
Sbjct  411  PPLLRASACAYLASYIARG  429



>ref|XP_007407172.1| hypothetical protein MELLADRAFT_34470 [Melampsora larici-populina 
98AG31]
 gb|EGG09445.1| hypothetical protein MELLADRAFT_34470 [Melampsora larici-populina 
98AG31]
Length=511

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 60/109 (55%), Gaps = 7/109 (6%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISCNE---SGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACS  156
            A KLD ++  I ++  +  E          FD LL SFE  +L   +++  QFV+F+  S
Sbjct  224  AAKLDGILRCILDHLHAAPEPRFQAEKELFFDVLLSSFESCILRTQRTRHTQFVIFWYAS  283

Query  155  LDPENCGKRFANML---IHIFETSVH-LEWRMSAVAYLASYLARARFMD  21
            + P+      A ++   ++ ++ S H +  R++++ Y+AS ++RAR++D
Sbjct  284  VHPDFADSLLATLVECALYAYDDSTHPIVTRVASLGYIASLVSRARYID  332



>gb|KIY46603.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Fistulina hepatica ATCC 64428]
Length=764

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F++T+L  +KS++ QF++F+  SLDPE     F  MLI   +++       R 
Sbjct  435  FHTLLAIFDRTILRTFKSRYTQFILFWYTSLDPE-FSDLFQGMLIERALWKPDEPAITRA  493

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+ S+++RA+F+D
Sbjct  494  AAASYVGSFVSRAQFVD  510



>gb|ETN66338.1| transcription initiation factor RRN3 [Anopheles darlingi]
Length=615

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 56/108 (52%), Gaps = 2/108 (2%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFISC--NESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            A+ LD  M ++F +      +E G+  R+F  +   FE  VL  + +   QF++FY CS 
Sbjct  277  AETLDCFMHIMFNFIERSIKDEGGQADRLFKIMFKQFETHVLPTHNTDHVQFLLFYFCSF  336

Query  152  DPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFV  9
                     +++  ++   ++    R ++V Y+AS LARA+F+ + F+
Sbjct  337  KLSYAEHFISSLWKNVSNPNISPTVRQASVGYIASMLARAKFVPLSFL  384



>gb|EZF32850.1| hypothetical protein H101_03560 [Trichophyton interdigitale H6]
 gb|KDB26657.1| hypothetical protein H109_01564 [Trichophyton interdigitale MR816]
Length=717

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  377  EIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVL  207
            E + D  + R     A   K+DS++ ++FEY+     SG L    +V D LL  F+  +L
Sbjct  364  EDEADPDLQRIKSVKACMLKVDSMVDILFEYYNYPFISGSLEDQEQVLDFLLAHFQSIIL  423

Query  206  TAYKSKFAQFVMFYACSLDPENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
             +Y+S+ AQFV+F+     P     RFA   I  I   S  +  R  A AYLAS++AR 
Sbjct  424  PSYRSRHAQFVLFHFAQASPIFV-DRFATTCIEIILSKSQPVIIRQYAAAYLASFVARG  481



>gb|EGE01750.1| hypothetical protein TEQG_00795 [Trichophyton equinum CBS 127.97]
Length=717

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  377  EIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVL  207
            E + D  + R     A   K+DS++ ++FEY+     SG L    +V D LL  F+  +L
Sbjct  364  EDEADPDLQRIKSVKACMLKVDSMVDILFEYYNYPFISGSLEDQEQVLDFLLAHFQSIIL  423

Query  206  TAYKSKFAQFVMFYACSLDPENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
             +Y+S+ AQFV+F+     P     RFA   I  I   S  +  R  A AYLAS++AR 
Sbjct  424  PSYRSRHAQFVLFHFAQASPIFV-DRFATTCIEIILSKSQPVIIRQYAAAYLASFVARG  481



>gb|EGD97283.1| hypothetical protein TESG_04694 [Trichophyton tonsurans CBS 112818]
Length=717

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  377  EIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVL  207
            E + D  + R     A   K+DS++ ++FEY+     SG L    +V D LL  F+  +L
Sbjct  364  EDEADPDLQRIKSVKACMLKVDSMVDILFEYYNYPFISGSLEDQEQVLDFLLAHFQSIIL  423

Query  206  TAYKSKFAQFVMFYACSLDPENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
             +Y+S+ AQFV+F+     P     RFA   I  I   S  +  R  A AYLAS++AR 
Sbjct  424  PSYRSRHAQFVLFHFAQASPIFV-DRFATTCIEIILSKSQPVIIRQYAAAYLASFVARG  481



>gb|EZG08878.1| hypothetical protein H106_02061 [Trichophyton rubrum CBS 735.88]
Length=719

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+DS++ ++FEY+     SG L    +V D LL+ F+  +L +Y+S+ AQFV+F+     
Sbjct  385  KVDSMVDILFEYYNYPFISGSLEDQEQVLDFLLVHFQSIILPSYRSRHAQFVLFHFAQAS  444

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA   I  I   S  +  R  A AYLAS++AR 
Sbjct  445  PIFV-DRFATTCIEIILSKSQPVIIRQYAAAYLASFVARG  483



>dbj|GAA94522.1| hypothetical protein E5Q_01174 [Mixia osmundae IAM 14324]
 gb|KEI42055.1| hypothetical protein L969DRAFT_91520 [Mixia osmundae IAM 14324]
Length=888

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 5/86 (6%)
 Frame = -1

Query  272  NESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFE  99
            NE  R   VFD LL SF+  +L  + ++  QF++F++ SL PE     F   LI   +F+
Sbjct  521  NEQKRA--VFDALLTSFDTHILQTFNTRHVQFLLFWSVSLSPEYTDD-FTGALIERILFK  577

Query  98   TSVHLEWRMSAVAYLASYLARARFMD  21
            T      R+++ AYL S+++RA+F D
Sbjct  578  TDAPNYIRVASAAYLGSFVSRAKFFD  603



>ref|XP_002161101.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3-like [Hydra vulgaris]
Length=546

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 34/124 (27%)
 Frame = -1

Query  320  KLDSLMVLIFEYF-ISCNESGRLGRVFDT-------LLLSFEKTVLTAYKSKFAQFVMFY  165
            KLD LM+++F +   SC   G L  VFDT       LLL FE  +L   +S   QF++FY
Sbjct  235  KLDKLMMILFTFIQSSCLNDGVL--VFDTANELSKDLLLVFENVILKTQQSSHVQFIIFY  292

Query  164  ACSLDPENCGKRFANMLIHIFETSVHLEW------------RMSAVAYLASYLARARFMD  21
              SL+             H +E  +   W            R ++V+Y+AS+LARA+F+D
Sbjct  293  FASLNK------------HFYEEFLDCCWTILKNPNKAVIIRQASVSYIASFLARAKFVD  340

Query  20   MPFV  9
               +
Sbjct  341  QKVI  344



>ref|XP_003459441.2| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 isoform X1 [Oreochromis niloticus]
Length=631

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFIS-CNESG-----RLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            A++LD+LM ++  Y    C   G     R   ++  LL  F+K +L  + S   Q+ +FY
Sbjct  295  AERLDTLMAVLMAYIKDICYVDGSFHVERTKELYRDLLTVFDKLILPTHASCHVQYTLFY  354

Query  164  ACSLDPENCGKRFANMLIHIFET-SVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
             CS  P    + F + L  I +  S+    R +A  YL S+LARA+F+ +  V A
Sbjct  355  LCSFKPA-LAEAFLDHLWKILQNPSLPAVLRQAAAGYLGSFLARAKFIPLSTVWA  408



>gb|KFH71686.1| hypothetical protein MVEG_01981 [Mortierella verticillata NRRL 
6337]
Length=759

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 58/115 (50%), Gaps = 12/115 (10%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYF------------ISCNESGRLGRVFDTLLLSFEKTVLTAYKSKFA  183
             QKLD +++ +F Y             ++     ++   F  LL  F KT+L  +KS+  
Sbjct  350  TQKLDMMLLHVFLYLERFINSCRHMPMVNGQPPAQIQSTFMILLTIFNKTILQTFKSRHT  409

Query  182  QFVMFYACSLDPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDM  18
            QF++FY  S+  +        +   I + S     R++A AYL+S++ARA+++D+
Sbjct  410  QFLLFYYMSIATQFSDYFLGCLCRQILDKSQPQIMRIAAAAYLSSFVARAKYLDI  464



>gb|KFB38508.1| hypothetical protein ZHAS_00005915 [Anopheles sinensis]
Length=598

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (54%), Gaps = 3/110 (3%)
 Frame = -1

Query  326  AQKLDSLMVLIFEYFI--SCNESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSL  153
            A+ LD  M L+F +FI  +  E+G+  R+F  +L  FE  +L  + +   QF++FY CS 
Sbjct  272  AETLDCFMDLMF-HFIERTVKENGQGDRLFKIMLNQFESHILPTHNTDHVQFLLFYFCSF  330

Query  152  DPENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARARFMDMPFVAA  3
                      ++  ++   S+    R ++V Y+AS LAR +F+ + ++ +
Sbjct  331  KLSYAEHFITSLWKNVSNPSMSPVVRQASVGYVASMLARGKFVPLSYLKS  380



>ref|XP_003071560.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EER29415.1| RNA polymerase I specific transcription initiation factor RRN3 
family protein [Coccidioides posadasii C735 delta SOWgp]
Length=697

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = -1

Query  425  DLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG--  252
            D+E  I D  +ES   E QR      F     +  K+D ++ L+FEY+      G L   
Sbjct  346  DVESTISD--EESTSAETQR------FKALKENINKIDYMLDLLFEYYSGPFNYGTLDDK  397

Query  251  -RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-W  78
                D LL  F+  +L  Y+S+ +QF++F+     P     RFA   I I  +  H    
Sbjct  398  ENNLDLLLAHFQNIILPTYRSRHSQFLLFHYSQSSP-ILVDRFAAACIQIILSKSHPSVL  456

Query  77   RMSAVAYLASYLARA  33
            R  A AYLAS++AR 
Sbjct  457  RQYAAAYLASFVARG  471



>gb|KIJ69765.1| hypothetical protein HYDPIDRAFT_104386 [Hydnomerulius pinastri 
MD-312]
Length=770

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -1

Query  269  ESGRLGRV--FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IF  102
            E+GR  R   F TLL  F++ ++  +KS++ QF++F+  SLDPE     F  +L+   + 
Sbjct  422  EAGRALRAAQFHTLLAIFDRAIIRTFKSRYTQFLIFWYSSLDPE-FSDLFQGLLVEKALL  480

Query  101  ETSVHLEWRMSAVAYLASYLARARFMD  21
               V    R +A +Y+AS+++RA+F+D
Sbjct  481  GQDVPAVTRAAAASYIASFVSRAQFVD  507



>ref|XP_007682485.1| hypothetical protein COCMIDRAFT_442 [Bipolaris oryzae ATCC 44560]
 gb|EUC50894.1| hypothetical protein COCMIDRAFT_442 [Bipolaris oryzae ATCC 44560]
Length=695

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRL---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            KLD++M + F Y+ S  E G L    R + +L+  F+  ++  Y+S+  QF++F+   L 
Sbjct  331  KLDTVMDVQFAYYDSIFEKGDLLEMDRTYQSLIAQFQSIIIPTYRSRHTQFILFHFSQLS  390

Query  149  PENCGKRFANMLIHI-FETSVHLEWRMSAVAYLASYLARA  33
              +  +RF +   H+  +++     R SA AYLASY+AR 
Sbjct  391  -TDFMERFVDTCSHLAIDSNRPPLLRASACAYLASYIARG  429



>gb|KEQ67618.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Aureobasidium melanogenum CBS 110374]
Length=667

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 5/103 (5%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYFISCNESGRLGRV---FDTLLLSFEKTVLTAYKSKFAQFVMFYAC  159
            +  KLDS++ L+F ++     SG++  V   F+ L+  F   VL  Y+S+  QF++F+  
Sbjct  335  TVAKLDSVLDLLFSHYTPTFASGKMYEVNDAFEHLISQFSTFVLPTYRSRHTQFLVFHFA  394

Query  158  SLDPENCGKRFANMLIHIFE-TSVHLEWRMSAVAYLASYLARA  33
             +  +   +RFA +LI +    S      +SA AYLAS++AR 
Sbjct  395  QMS-QGYAERFAGVLIRLATGRSSATNGSLSAAAYLASFIARG  436



>ref|XP_002476428.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED78364.1| predicted protein [Postia placenta Mad-698-R]
Length=723

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -1

Query  269  ESGRLGR--VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLI--HIF  102
            E G++ R   F  LL  F++T+L  +KS++ QF++F+  SLDPE     F  ML+   + 
Sbjct  483  EDGKMLRRQQFHALLSIFDRTILRTFKSRYTQFLVFWYSSLDPE-FSDLFQGMLVSKSLL  541

Query  101  ETSVHLEWRMSAVAYLASYLARARFMD  21
            E       R +A +Y+AS+++RA+F+D
Sbjct  542  EEDQPAVTRAAAASYIASFVSRAQFVD  568



>gb|EFW15337.1| RNA polymerase I specific transcription initiation factor RRN3 
[Coccidioides posadasii str. Silveira]
Length=706

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = -1

Query  425  DLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG--  252
            D+E  I D  +ES   E QR      F     +  K+D ++ L+FEY+      G L   
Sbjct  355  DVESTISD--EESTSAETQR------FKALKENINKIDYMLDLLFEYYSGPFNYGTLDDK  406

Query  251  -RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-W  78
                D LL  F+  +L  Y+S+ +QF++F+     P     RFA   I I  +  H    
Sbjct  407  ENNLDLLLAHFQNIILPTYRSRHSQFLLFHYSQSSP-ILVDRFAAACIQIILSKSHPSVL  465

Query  77   RMSAVAYLASYLARA  33
            R  A AYLAS++AR 
Sbjct  466  RQYAAAYLASFVARG  480



>gb|KGO41514.1| RNA polymerase I specific transcription initiation factor RRN3 
[Penicillium expansum]
 gb|KGO47490.1| RNA polymerase I specific transcription initiation factor RRN3 
[Penicillium expansum]
 gb|KGO62466.1| RNA polymerase I specific transcription initiation factor RRN3 
[Penicillium expansum]
Length=691

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+D ++ L+FEYF     SG L       D LL  F+  +L  Y+S+ +QF++F+     
Sbjct  368  KVDGMIDLLFEYFSPPFTSGTLDDQENALDLLLSHFQSIILPTYRSRHSQFLLFHFSQAS  427

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA+  +  IF        R SA AYLAS++AR 
Sbjct  428  PVLV-DRFASTFVQLIFNKLQPGIMRQSAAAYLASFVARG  466



>ref|XP_003175346.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Microsporum gypseum CBS 118893]
 gb|EFQ99863.1| RNA polymerase I-specific transcription initiation factor rrn3 
[Microsporum gypseum CBS 118893]
Length=715

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+DSL+ ++FEY+     SG L    +V D LL  F+  +L  Y+S+ AQFV+F+     
Sbjct  381  KVDSLVDILFEYYNYPFVSGSLEDQEQVLDFLLAHFKSIILPTYRSRHAQFVLFHFAQAS  440

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA + I  I   S  +  R  A AYLAS++AR 
Sbjct  441  PIFV-DRFAAICIEIILSKSQPVIIRQYAAAYLASFVARG  479



>gb|KGO76977.1| RNA polymerase I specific transcription initiation factor RRN3 
[Penicillium italicum]
Length=689

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+D ++ L+FEYF     SG L       D LL  F+  +L  Y+S+ +QF++F+     
Sbjct  366  KVDGMIDLLFEYFSPPFTSGTLDDQENALDLLLSHFQTIILPTYRSRHSQFLLFHFSQAS  425

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA+  +  IF        R SA AYLAS++AR 
Sbjct  426  PVLV-DRFASTFVQLIFNKLQPGILRQSAAAYLASFVARG  464



>ref|XP_007315707.1| hypothetical protein SERLADRAFT_413954 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01992.1| hypothetical protein SERLA73DRAFT_159088 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27616.1| hypothetical protein SERLADRAFT_413954 [Serpula lacrymans var. 
lacrymans S7.9]
Length=776

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -1

Query  269  ESGRLGR--VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IF  102
            E GR  R   F TLL  F++T++  +KS++ QF++F+  SLDPE     F  ML+   + 
Sbjct  424  ERGRALRRSQFHTLLSIFDRTIIRTFKSRYTQFLIFWYSSLDPE-FSDLFQGMLVEKALL  482

Query  101  ETSVHLEWRMSAVAYLASYLARARFMD  21
                    R +A +Y+AS+++RA+F+D
Sbjct  483  TQDQPAVTRAAAASYIASFVSRAQFVD  509



>gb|EZF97865.1| hypothetical protein H113_02202 [Trichophyton rubrum MR1459]
 gb|KFL62532.1| hypothetical protein TERG_06956 [Trichophyton rubrum CBS 118892]
Length=475

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+DS++ ++FEY+     SG L    +V D LL  F+  +L +Y+S+ AQFV+F+     
Sbjct  141  KVDSMVDILFEYYNYPFISGSLEDQEQVLDFLLAHFQSIILPSYRSRHAQFVLFHFAQAS  200

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA   I  I   S  +  R  A AYLAS++AR 
Sbjct  201  PIFV-DRFATTCIEIILSKSQPVIIRQYAAAYLASFVARG  239



>gb|ENI07707.1| hypothetical protein COCC4DRAFT_79726 [Bipolaris maydis ATCC 
48331]
Length=904

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRL---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            KLD++M + F Y+ S  E G L    R + +L+  F+  ++  Y+S+  QF++F+   L 
Sbjct  542  KLDTVMDVQFAYYDSIFEKGDLLEMDRTYQSLIAQFQSIIIPTYRSRHTQFILFHFSQLS  601

Query  149  PENCGKRFANMLIHI-FETSVHLEWRMSAVAYLASYLARA  33
              +  +RF +   H+  +++     R SA AYLASY+AR 
Sbjct  602  -TDFMERFVDTCSHLAIDSNRPPLLRASACAYLASYIARG  640



>gb|EMD93991.1| hypothetical protein COCHEDRAFT_1201821 [Bipolaris maydis C5]
Length=897

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRL---GRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            KLD++M + F Y+ S  E G L    R + +L+  F+  ++  Y+S+  QF++F+   L 
Sbjct  535  KLDTVMDVQFAYYDSIFEKGDLLEMDRTYQSLIAQFQSIIIPTYRSRHTQFILFHFSQLS  594

Query  149  PENCGKRFANMLIHI-FETSVHLEWRMSAVAYLASYLARA  33
              +  +RF +   H+  +++     R SA AYLASY+AR 
Sbjct  595  -TDFMERFVDTCSHLAIDSNRPPLLRASACAYLASYIARG  633



>ref|XP_001794756.1| hypothetical protein SNOG_04337 [Phaeosphaeria nodorum SN15]
 gb|EAT88097.1| hypothetical protein SNOG_04337 [Phaeosphaeria nodorum SN15]
Length=668

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 65/132 (49%), Gaps = 4/132 (3%)
 Frame = -1

Query  419  EGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRL--GRV  246
            E   DD   ES   E   D    R      +  KLD++M L+F ++ +   + R     +
Sbjct  285  EAEDDDSDNESVSSEESLDPEEQRLKDLRQAVSKLDTIMDLLFTHYDNVFAADRFEADEL  344

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHI-FETSVHLEWRMS  69
            F++LL  F  T+L  Y+S+  QF++F+      +   ++FA    H+ F+ +     R++
Sbjct  345  FESLLSQFASTILPTYRSRHTQFLLFHFSQTSADRT-EQFAGACSHLAFDQNRPHILRVT  403

Query  68   AVAYLASYLARA  33
            A AYL S++AR 
Sbjct  404  AAAYLGSFIARG  415



>ref|XP_003297038.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Pyrenophora teres f. teres 0-1]
 gb|EFQ94887.1| hypothetical protein PTT_07309 [Pyrenophora teres f. teres 0-1]
Length=679

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 17/106 (16%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISC---NESGRLGRVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            KLD +M L F Y+ S     +     R++DTLL  F+  ++  Y+S+ AQFV+F+   + 
Sbjct  333  KLDIVMDLQFSYYASIFDKRDVKESDRMYDTLLAQFQSIIIPTYRSRHAQFVLFHFSQMS  392

Query  149  P-------ENCGKRFANMLIHIFETSVHLEWRMSAVAYLASYLARA  33
            P       E C  R A       +++     R SA AYLASY+AR 
Sbjct  393  PHFMELFVEACS-RLA------IDSNRPPLLRASACAYLASYIARG  431



>ref|XP_001602153.1| PREDICTED: RNA polymerase I-specific transcription initiation 
factor RRN3 [Nasonia vitripennis]
Length=601

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 30/119 (25%)
 Frame = -1

Query  326  AQKLDSLMVLIFEY-FISCNESGRLGR-----VFDTLLLSFEKTVLTAYKSKFAQFVMFY  165
            AQ LD  M  +  Y +  C+  G+L       +++ LL +FE+ +LT + S   QF+MFY
Sbjct  284  AQMLDVCMEQVLAYVYNCCHVEGQLQIDSLRIIYNDLLYTFERIILTTHASHHVQFIMFY  343

Query  164  ACSLDPENCGKRFANMLIHIFETSVHLEW------------RMSAVAYLASYLARARFM  24
             CS              + + ET +   W            R SAV+Y+AS LARA ++
Sbjct  344  LCSFK------------LTVAETFIRWLWQKVSNPNVAPIIRQSAVSYIASLLARATYI  390



>gb|EKV09675.1| RNA polymerase I specific transcription initiation factor RRN3 
superfamily [Penicillium digitatum Pd1]
 gb|EKV14983.1| RNA polymerase I specific transcription initiation factor RRN3 
superfamily [Penicillium digitatum PHI26]
Length=692

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+D ++ L+FEYF     SG L       D LL  F+  +L  Y+S+ +QF++F+     
Sbjct  369  KVDGMIDLLFEYFSPPFTSGTLDDQENALDLLLSHFQTIILPTYRSRHSQFLLFHFSQAS  428

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA+  +  IF        R SA AYLAS++AR 
Sbjct  429  PVLV-DRFASTFVQLIFNKLQPGILRQSAAAYLASFVARG  467



>gb|KIO00388.1| hypothetical protein M404DRAFT_1003841 [Pisolithus tinctorius 
Marx 270]
Length=752

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -1

Query  269  ESGRLGR--VFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IF  102
            E+GR  R   F  LL  F++T++  +KS++ QF++F+  SLDPE     F  +L+   + 
Sbjct  414  EAGRAVRDAQFHALLAIFDRTIIRTFKSRYTQFLIFWYSSLDPE-FSDLFQGLLVEKALL  472

Query  101  ETSVHLEWRMSAVAYLASYLARARFMD  21
               V    R +A +Y+AS+++RA+F+D
Sbjct  473  GQDVPAVTRAAAASYIASFVSRAQFVD  499



>gb|KGY14804.1| hypothetical protein PABG_12298 [Paracoccidioides brasiliensis 
Pb03]
Length=354

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 55/115 (48%), Gaps = 5/115 (4%)
 Frame = -1

Query  365  DMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLGR---VFDTLLLSFEKTVLTAYK  195
            D    R    S + QK+D ++ L+FEY+ S   +G         D LL  F+  +L  Y+
Sbjct  3    DSETQRAKKRSETKQKIDYMIDLLFEYYSSPFTNGTFDEKETANDLLLAHFQTIILPTYR  62

Query  194  SKFAQFVMFYACSLDPENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            S+  QF++F+     P     RFA   +  IF  S     R  A AYLAS++AR 
Sbjct  63   SRHTQFLLFHYSQSSPIFI-DRFATTCVQIIFSKSQPTILRQYAAAYLASFVARG  116



>ref|XP_003232965.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Trichophyton rubrum CBS 118892]
 gb|EGD90729.1| hypothetical protein TERG_06956 [Trichophyton rubrum CBS 118892]
 gb|EZF25507.1| hypothetical protein H100_02195 [Trichophyton rubrum MR850]
 gb|EZF44537.1| hypothetical protein H102_02192 [Trichophyton rubrum CBS 100081]
 gb|EZF55194.1| hypothetical protein H103_02201 [Trichophyton rubrum CBS 288.86]
 gb|EZF65809.1| hypothetical protein H104_02176 [Trichophyton rubrum CBS 289.86]
 gb|EZF76452.1| hypothetical protein H105_02213 [Trichophyton soudanense CBS 
452.61]
 gb|EZF87127.1| hypothetical protein H110_02197 [Trichophyton rubrum MR1448]
 gb|EZF97864.1| hypothetical protein H113_02202 [Trichophyton rubrum MR1459]
 gb|EZG19449.1| hypothetical protein H107_02266 [Trichophyton rubrum CBS 202.88]
 gb|KDB36311.1| hypothetical protein H112_02196 [Trichophyton rubrum D6]
Length=719

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            K+DS++ ++FEY+     SG L    +V D LL  F+  +L +Y+S+ AQFV+F+     
Sbjct  385  KVDSMVDILFEYYNYPFISGSLEDQEQVLDFLLAHFQSIILPSYRSRHAQFVLFHFAQAS  444

Query  149  PENCGKRFANMLIH-IFETSVHLEWRMSAVAYLASYLARA  33
            P     RFA   I  I   S  +  R  A AYLAS++AR 
Sbjct  445  PIFV-DRFATTCIEIILSKSQPVIIRQYAAAYLASFVARG  483



>gb|KIO30179.1| hypothetical protein M407DRAFT_69422, partial [Tulasnella calospora 
MUT 4182]
Length=470

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F++T+L  +KS++ QF++F+  SLDPE     F  +L+   +FE       R 
Sbjct  376  FLTLLTIFDRTILRTFKSRYTQFLLFWHSSLDPEYTDL-FLGLLVSRALFEPDQPAITRS  434

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS ++RA F+D
Sbjct  435  AAASYIASLVSRALFVD  451



>gb|KEQ77948.1| RNA polymerase I-specific transcription initiation factor RRN3 
[Aureobasidium pullulans var. namibiae CBS 147.97]
Length=667

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 5/103 (5%)
 Frame = -1

Query  329  SAQKLDSLMVLIFEYFISCNESGRLGRV---FDTLLLSFEKTVLTAYKSKFAQFVMFYAC  159
            +  KLDS++ L+F ++     SG++  V   F+ L+  F   VL  Y+S+  QF++F+  
Sbjct  335  TVAKLDSVLDLLFSHYTPTFASGKMYEVNDAFEHLISQFSTFVLPTYRSRHTQFLVFHFA  394

Query  158  SLDPENCGKRFANMLIHIFE-TSVHLEWRMSAVAYLASYLARA  33
             +  +   +RFA +LI +    S      +SA AYLAS++AR 
Sbjct  395  QMS-QGYAERFAGVLIRLATGRSSASNGSLSAAAYLASFIARG  436



>ref|XP_008025939.1| hypothetical protein SETTUDRAFT_169084 [Setosphaeria turcica 
Et28A]
 gb|EOA86307.1| hypothetical protein SETTUDRAFT_169084 [Setosphaeria turcica 
Et28A]
Length=699

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = -1

Query  320  KLDSLMVLIFEYFISCNESGRLG---RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLD  150
            KLD++M + F Y+ +  E G L    R + +L+  F+  ++  Y+S+  QFV+F+   L 
Sbjct  330  KLDNVMDVQFAYYDAIFEKGDLAEMDRTYQSLIAQFQSIIIPTYRSRHTQFVLFHFSQLS  389

Query  149  PENCGKRFANMLIHI-FETSVHLEWRMSAVAYLASYLARA  33
             +   +RF +   H+  +++     R SA AYLASY+AR 
Sbjct  390  TDFV-ERFVDSCSHLAIDSNRPPLLRASACAYLASYIARG  428



>ref|XP_009543462.1| hypothetical protein HETIRDRAFT_380901, partial [Heterobasidion 
irregulare TC 32-1]
 gb|ETW83701.1| hypothetical protein HETIRDRAFT_380901, partial [Heterobasidion 
irregulare TC 32-1]
Length=655

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F++T+L  +KS++ QF++F+  SLDPE     F   L+   + +    +  R 
Sbjct  437  FHTLLSIFDRTILRTFKSRYTQFLLFWYASLDPE-FSDMFQGELVSKALLDADQPVVTRA  495

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RA+F+D
Sbjct  496  AAASYIASFVSRAQFVD  512



>ref|XP_001245293.1| RNA polymerase I-specific transcription initiation factor RRN3 
family protein [Coccidioides immitis RS]
Length=697

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = -1

Query  425  DLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG--  252
            D+E  I D  +ES   E QR      F     +  K+D ++ L+FEY+      G L   
Sbjct  346  DVESIISD--EESTSAETQR------FKALKENINKIDYMLDLLFEYYSGPFNYGTLDDK  397

Query  251  -RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-W  78
                D LL  F+  +L  Y+S+ +QF++F+     P     RFA   I I  +  H    
Sbjct  398  ENNLDLLLAHFQNIILPTYRSRHSQFLLFHYSQSSP-ILVDRFAAACIQIILSKSHPSVL  456

Query  77   RMSAVAYLASYLARA  33
            R  A AYLAS++AR 
Sbjct  457  RQYAAAYLASFVARG  471



>gb|KDQ64421.1| hypothetical protein JAAARDRAFT_28051 [Jaapia argillacea MUCL 
33604]
Length=792

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  245  FDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIH--IFETSVHLEWRM  72
            F TLL  F+++++  +KS++ QF++F+  SLDPE     F  ML+   + E    +  R 
Sbjct  440  FHTLLAIFDRSIIRTFKSRYTQFLIFWYSSLDPE-FSDLFQGMLVSKALLEDDQPVVTRA  498

Query  71   SAVAYLASYLARARFMD  21
            +A +Y+AS+++RA F+D
Sbjct  499  AAASYIASFVSRALFVD  515



>gb|EAS33710.3| RNA polymerase I-specific transcription initiation factor RRN3 
[Coccidioides immitis RS]
Length=706

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = -1

Query  425  DLEGPIDDGQQESFDFEIQRDMWIDRFFGESASAQKLDSLMVLIFEYFISCNESGRLG--  252
            D+E  I D  +ES   E QR      F     +  K+D ++ L+FEY+      G L   
Sbjct  355  DVESIISD--EESTSAETQR------FKALKENINKIDYMLDLLFEYYSGPFNYGTLDDK  406

Query  251  -RVFDTLLLSFEKTVLTAYKSKFAQFVMFYACSLDPENCGKRFANMLIHIFETSVHLE-W  78
                D LL  F+  +L  Y+S+ +QF++F+     P     RFA   I I  +  H    
Sbjct  407  ENNLDLLLAHFQNIILPTYRSRHSQFLLFHYSQSSP-ILVDRFAAACIQIILSKSHPSVL  465

Query  77   RMSAVAYLASYLARA  33
            R  A AYLAS++AR 
Sbjct  466  RQYAAAYLASFVARG  480



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560109397860