BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013B15

Length=348
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14        68.9    8e-12   Sesamum indicum [beniseed]
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14        63.9    5e-10   Vitis vinifera
emb|CDO99148.1|  unnamed protein product                              62.0    2e-09   Coffea canephora [robusta coffee]
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg              62.0    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14        60.1    1e-08   Sesamum indicum [beniseed]
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                 59.3    3e-08   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14        58.5    5e-08   Prunus mume [ume]
gb|KJB38278.1|  hypothetical protein B456_006G246000                  57.4    2e-07   Gossypium raimondii
gb|KJB38279.1|  hypothetical protein B456_006G246000                  56.2    2e-07   Gossypium raimondii
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                  56.6    3e-07   Gossypium arboreum [tree cotton]
gb|AEE25653.1|  auxin-responsive protein                              56.6    3e-07   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                  56.2    4e-07   Gossypium raimondii
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg           52.8    6e-06   
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg              52.4    8e-06   Erythranthe guttata [common monkey flower]
gb|ADJ68049.1|  auxin responsive protein                              52.0    9e-06   Catharanthus roseus [chatas]
emb|CBI26357.3|  unnamed protein product                              51.6    1e-05   Vitis vinifera
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like   49.7    8e-05   
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like   49.7    1e-04   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...  48.9    1e-04   Cicer arietinum [garbanzo]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...  48.5    2e-04   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like              48.5    2e-04   Malus domestica [apple tree]
gb|KHN05057.1|  Auxin-responsive protein IAA14                        48.5    2e-04   Glycine soja [wild soybean]
ref|NP_001240213.1|  auxin-induced protein ali50                      48.1    2e-04   Glycine max [soybeans]
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...  47.4    4e-04   
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2      47.4    4e-04   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...  47.4    4e-04   Cucumis sativus [cucumbers]
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g           47.4    5e-04   Phaseolus vulgaris [French bean]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like   47.0    6e-04   Cucumis melo [Oriental melon]
gb|KHN30563.1|  Auxin-responsive protein IAA14                        46.6    7e-04   Glycine soja [wild soybean]
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like    46.6    8e-04   Malus prunifolia



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            MEVGRKMG +LAE  GLNLK TELCLGLPGGGGG +    K+TGKRGFSETVDLKLNLQ 
Sbjct  1    MEVGRKMGGLLAEEQGLNLKETELCLGLPGGGGGAD----KITGKRGFSETVDLKLNLQP  56

Query  326  AADSSLD  346
               ++LD
Sbjct  57   NESAALD  63



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            MEVGRKM SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS
Sbjct  1    MEVGRKMSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQS  59



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 3/57 (5%)
 Frame = +2

Query  164  MGSMLAE-HGGLNLKATElclglpgggggN--ESESLKVTGKRGFSETVDLKLNLQS  325
            M +ML E HGGLNLKATELCLGLPGGGG    ++ESLK+TGKRGFSETVDLKLNLQ 
Sbjct  1    MTTMLGEEHGGLNLKATELCLGLPGGGGCAGADTESLKITGKRGFSETVDLKLNLQP  57



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            MEV RKM   +AE  GLN K TELCLGLPGGGGG E +++K+ GKRGFSETVDLKLNLQS
Sbjct  1    MEVCRKM---VAEERGLNFKETELCLGLPGGGGGGEPDAVKINGKRGFSETVDLKLNLQS  57

Query  326  AADSSLD  346
               +S D
Sbjct  58   NDSASTD  64



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 55/73 (75%), Gaps = 6/73 (8%)
 Frame = +2

Query  146  MEVGRKMGSMLAEH--GGLNLKATElclglpgggggNES---ESLKVTGKRGFSETVDLK  310
            MEVGR M  MLAE    GLNLK TELCLGLPGGGGG ES   + +K+TGKRGFSETVDLK
Sbjct  1    MEVGRNMAGMLAEEHDDGLNLKETELCLGLPGGGGGGESTATDPIKITGKRGFSETVDLK  60

Query  311  LNL-QSAADSSLD  346
            L L QS   ++LD
Sbjct  61   LKLHQSNEPAALD  73



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATE------lclglpgggggNESESLKVTGKRGFSETVDL  307
            MEV RKM +ML     LN K TE         G  GGGGGNE E+ K TGKRGFSETVDL
Sbjct  1    MEVSRKMANMLGAERDLNFKETELCLGLPGGGGGGGGGGGNEVETPKTTGKRGFSETVDL  60

Query  308  KLNLQS  325
            KLNLQS
Sbjct  61   KLNLQS  66



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  152  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA  331
            V RKM +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  
Sbjct  6    VSRKMPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKE  65

Query  332  D  334
            D
Sbjct  66   D  66



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +2

Query  143  SMEVGRKMGSMLAEHGGLNLKATEl----clglpgggggNESES---LKVTGKRGFSETV  301
            SMEVGRKM +ML     LN K TEL      G+     GNE+ES    K  GKRGFSETV
Sbjct  45   SMEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETV  104

Query  302  DLKLNLQSAADSSLD  346
            DLKLNLQS  +S++D
Sbjct  105  DLKLNLQS-KESTMD  118



>gb|KJB38279.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=217

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATEl----clglpgggggNESES---LKVTGKRGFSETVD  304
            MEVGRKM +ML     LN K TEL      G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  305  LKLNLQSAADSSLD  346
            LKLNLQS  +S++D
Sbjct  61   LKLNLQS-KESTMD  73



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATEl----clglpgggggNESES---LKVTGKRGFSETVD  304
            MEVGRKM +ML     LN K TEL      G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  305  LKLNLQSAADSSLD  346
            LKLNLQS  +S++D
Sbjct  61   LKLNLQS-KESTMD  73



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATEl----clglpgggggNESES---LKVTGKRGFSETVD  304
            MEVGRKM +ML     LN K TEL      G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  305  LKLNLQSAADSSLD  346
            LKLNLQS  +S++D
Sbjct  61   LKLNLQS-KESTMD  73



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATEl----clglpgggggNESES---LKVTGKRGFSETVD  304
            MEVGRKM +ML     LN K TEL      G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  305  LKLNLQSAADSSLD  346
            LKLNLQS  +S++D
Sbjct  61   LKLNLQS-KESTMD  73



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAAD  334
            M +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  D
Sbjct  1    MPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKED  57



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 4/58 (7%)
 Frame = +2

Query  152  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            VGRKM  +   HG LN   TELCLGLPGGGGG  ++ +K TGKRGFSETVDLKLNLQS
Sbjct  4    VGRKMAGL---HG-LNFMETELCLGLPGGGGGESTDPIKTTGKRGFSETVDLKLNLQS  57



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 46/59 (78%), Gaps = 4/59 (7%)
 Frame = +2

Query  182  EHGGLNLKATElclglpgggggNESE----SLKVTGKRGFSETVDLKLNLQSAADSSLD  346
            E  GLNLK TELCLGLPGGGGG   E    S+++TGKRGFSETVDLKLNLQS   SS+D
Sbjct  2    EVHGLNLKETELCLGLPGGGGGGTGEITDQSMRITGKRGFSETVDLKLNLQSNDQSSVD  60



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            M SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS
Sbjct  1    MSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQS  53



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATElclglpg--ggggNESESLKVTGKRGFSETVDLKLNLQSAAD  334
            M SML     LNL+ TELCLGLPG       E E+ K TGKRGFSETVDLKLNLQS  D
Sbjct  1    MTSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETVDLKLNLQSKED  59



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 40/66 (61%), Gaps = 9/66 (14%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATE---------lclglpgggggNESESLKVTGKRGFSETVDLKLN  316
            M +ML +  GLNLK TE            G  GGGGG E E+ + TGKRGFSETVDLKLN
Sbjct  85   MATMLTKEHGLNLKETELCLGLPGGGGGGGGGGGGGGGEVETPRATGKRGFSETVDLKLN  144

Query  317  LQSAAD  334
            L S  D
Sbjct  145  LHSKED  150



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATE-lclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            M +++ +  GLNLK TE       GGG G+E E+ +  GKRGFSETVDLKLNLQS
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQS  55



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATE-lclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            M +++ +  GLNLK TE       GGG G+E E+ +  GKRGFSETVDLKLNLQS
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQS  55



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATElclglpg--ggggNESESLKVTGKRGFSETVDLKLNLQSAAD  334
            M SML     LNL+ TELCLGLPG       E E+ K TGKRGFSET+DLKLNLQS  D
Sbjct  1    MMSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKED  59



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 7/64 (11%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATElclglpggggg-------NESESLKVTGKRGFSETVDLKLNLQ  322
            M +ML +  GLNLK TELCLGLPGG          +E E+ + TGKRGFSETVDLKLNL 
Sbjct  1    MATMLTKEHGLNLKETELCLGLPGGELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLH  60

Query  323  SAAD  334
            S  D
Sbjct  61   SKED  64



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAAD  334
            M +ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D
Sbjct  1    MTTMLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED  57



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 11/67 (16%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  326  AADSSLD  346
                ++D
Sbjct  50   KPGVTVD  56



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  248  NESESLKVTGKRGFSETVDLKLNLQS  325
            NE E+ K TGKRGFSETVDLKLNLQS
Sbjct  4    NEVETPKTTGKRGFSETVDLKLNLQS  29



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 11/67 (16%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  326  AADSSLD  346
                ++D
Sbjct  50   KPGVTVD  56



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 8/65 (12%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATE--------lclglpgggggNESESLKVTGKRGFSETVDLKLNL  319
            M +ML +   LNLK TE           G  GGGGG+E E+ + TGKRGFSETVDLKLNL
Sbjct  1    MATMLGKEHHLNLKETELCLGLPGAGGGGGSGGGGGSEVETPRATGKRGFSETVDLKLNL  60

Query  320  QSAAD  334
            Q+  D
Sbjct  61   QAKED  65



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 37/67 (55%), Gaps = 11/67 (16%)
 Frame = +2

Query  146  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  325
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  326  AADSSLD  346
                ++D
Sbjct  50   KTGVTVD  56



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 3/52 (6%)
 Frame = +2

Query  182  EHG-GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAAD  334
            EHG  LNLK TELCLGLPGGG  +E E+ + TGKRGFSETVDLKLNLQ+  D
Sbjct  5    EHGLSLNLKETELCLGLPGGG--SEVETPRATGKRGFSETVDLKLNLQTKED  54



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  164  MGSMLAEHGGLNLKATElclglpg--ggggNESESLKVTGKRGFSETVDLKLNLQSAAD  334
            M SML     LNL+  ELCLGLPG       E E+ K TGKRGFSET+DLKLNLQS  D
Sbjct  1    MMSMLGVERDLNLREAELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKED  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552569507840