BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013B11

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO36325.1|  hypothetical protein CISIN_1g046287mg                   124   7e-33   Citrus sinensis [apfelsine]
gb|KDO36599.1|  hypothetical protein CISIN_1g037758mg                   120   1e-31   Citrus sinensis [apfelsine]
emb|CDP01451.1|  unnamed protein product                                127   5e-31   Coffea canephora [robusta coffee]
ref|XP_010027848.1|  PREDICTED: asparagine synthetase [glutamine-...    127   5e-31   
ref|XP_010027849.1|  PREDICTED: asparagine synthetase [glutamine-...    127   6e-31   
ref|XP_011031010.1|  PREDICTED: asparagine synthetase [glutamine-...    126   9e-31   Populus euphratica
gb|KDP46836.1|  hypothetical protein JCGZ_24045                         126   1e-30   Jatropha curcas
ref|XP_004288204.2|  PREDICTED: asparagine synthetase [glutamine-...    127   1e-30   Fragaria vesca subsp. vesca
ref|XP_009343558.1|  PREDICTED: asparagine synthetase [glutamine-...    125   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009364610.1|  PREDICTED: asparagine synthetase [glutamine-...    125   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_008369048.1|  PREDICTED: asparagine synthetase [glutamine-...    125   1e-30   
ref|XP_007047957.1|  Asparagine synthetase 3 isoform 2                  125   2e-30   
ref|XP_007207234.1|  hypothetical protein PRUPE_ppa015268mg             125   2e-30   
ref|XP_007047958.1|  Asparagine synthetase 3 isoform 3                  125   2e-30   
ref|XP_007047956.1|  Asparagine synthetase 3 isoform 1                  125   2e-30   
ref|XP_008233969.1|  PREDICTED: asparagine synthetase [glutamine-...    125   3e-30   Prunus mume [ume]
ref|XP_006428190.1|  hypothetical protein CICLE_v10025269mg             125   3e-30   Citrus clementina [clementine]
ref|XP_010087589.1|  Glutamine-dependent asparagine synthetase 2        125   4e-30   
gb|ABK95431.1|  unknown                                                 124   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002306310.2|  hypothetical protein POPTR_0005s07720g             124   5e-30   
ref|XP_010680552.1|  PREDICTED: asparagine synthetase [glutamine-...    124   6e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009617044.1|  PREDICTED: asparagine synthetase [glutamine-...    117   6e-30   Nicotiana tomentosiformis
ref|XP_004502424.1|  PREDICTED: asparagine synthetase [glutamine-...    123   1e-29   Cicer arietinum [garbanzo]
ref|XP_007163648.1|  hypothetical protein PHAVU_001G252200g             123   2e-29   Phaseolus vulgaris [French bean]
ref|XP_009150576.1|  PREDICTED: asparagine synthetase [glutamine-...    122   2e-29   Brassica rapa
ref|XP_006399518.1|  hypothetical protein EUTSA_v10013088mg             122   2e-29   Eutrema salsugineum [saltwater cress]
gb|KFK25345.1|  hypothetical protein AALP_AA8G100600                    122   2e-29   Arabis alpina [alpine rockcress]
ref|XP_010519584.1|  PREDICTED: asparagine synthetase [glutamine-...    122   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_009759011.1|  PREDICTED: asparagine synthetase [glutamine-...    121   4e-29   Nicotiana sylvestris
gb|KJB48988.1|  hypothetical protein B456_008G096300                    121   5e-29   Gossypium raimondii
ref|XP_009759010.1|  PREDICTED: asparagine synthetase [glutamine-...    121   6e-29   Nicotiana sylvestris
ref|XP_010266657.1|  PREDICTED: asparagine synthetase [glutamine-...    121   7e-29   Nelumbo nucifera [Indian lotus]
gb|KJB48986.1|  hypothetical protein B456_008G096300                    121   7e-29   Gossypium raimondii
gb|KJB48987.1|  hypothetical protein B456_008G096300                    121   7e-29   Gossypium raimondii
ref|XP_002531258.1|  asparagine synthetase, putative                    121   8e-29   Ricinus communis
ref|XP_004237391.1|  PREDICTED: asparagine synthetase [glutamine-...    120   8e-29   Solanum lycopersicum
ref|NP_001031864.1|  asparagine synthetase 3                            121   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196586.1|  asparagine synthetase 3                               121   9e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAC72836.1|  asparagine synthetase                                   121   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355345.1|  PREDICTED: asparagine synthetase [glutamine-...    120   9e-29   Solanum tuberosum [potatoes]
ref|XP_002864935.1|  hypothetical protein ARALYDRAFT_496723             120   1e-28   
ref|NP_851272.1|  asparagine synthetase 2                               120   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAC72837.1|  asparagine synthetase                                   120   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201306.2|  asparagine synthetase 2                               120   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003552061.1|  PREDICTED: asparagine synthetase [glutamine-...    120   1e-28   
ref|XP_010269254.1|  PREDICTED: asparagine synthetase [glutamine-...    114   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_002873446.1|  hypothetical protein ARALYDRAFT_908981             120   2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010444467.1|  PREDICTED: asparagine synthetase [glutamine-...    120   2e-28   
ref|XP_010462467.1|  PREDICTED: asparagine synthetase [glutamine-...    120   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010484304.1|  PREDICTED: asparagine synthetase [glutamine-...    120   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010484303.1|  PREDICTED: asparagine synthetase [glutamine-...    120   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003538618.1|  PREDICTED: asparagine synthetase [glutamine-...    119   3e-28   Glycine max [soybeans]
ref|XP_006280142.1|  hypothetical protein CARUB_v10026039mg             120   3e-28   
emb|CDY14529.1|  BnaC03g49300D                                          119   5e-28   Brassica napus [oilseed rape]
gb|KFK28186.1|  hypothetical protein AALP_AA8G483400                    119   5e-28   Arabis alpina [alpine rockcress]
ref|XP_010907409.1|  PREDICTED: asparagine synthetase [glutamine-...    119   6e-28   Elaeis guineensis
ref|XP_006394086.1|  hypothetical protein EUTSA_v10003890mg             119   6e-28   Eutrema salsugineum [saltwater cress]
ref|XP_008440595.1|  PREDICTED: asparagine synthetase [glutamine-...    119   6e-28   Cucumis melo [Oriental melon]
ref|XP_004143467.1|  PREDICTED: asparagine synthetase [glutamine-...    119   6e-28   Cucumis sativus [cucumbers]
ref|XP_010917498.1|  PREDICTED: asparagine synthetase [glutamine-...    119   6e-28   Elaeis guineensis
ref|XP_010547614.1|  PREDICTED: asparagine synthetase [glutamine-...    118   6e-28   Tarenaya hassleriana [spider flower]
ref|XP_006287293.1|  hypothetical protein CARUB_v10000487mg             119   6e-28   
emb|CAN82675.1|  hypothetical protein VITISV_034450                     118   1e-27   Vitis vinifera
ref|XP_010922574.1|  PREDICTED: asparagine synthetase [glutamine-...    118   1e-27   Elaeis guineensis
ref|XP_010415168.1|  PREDICTED: asparagine synthetase [glutamine-...    110   2e-27   
ref|XP_008805175.1|  PREDICTED: asparagine synthetase [glutamine-...    117   2e-27   Phoenix dactylifera
sp|O24338.3|ASNS_SANAU  RecName: Full=Asparagine synthetase [glut...    117   2e-27   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AAF02776.1|AF190729_1  asparagine synthetase                         117   2e-27   Helianthus annuus
ref|XP_003601953.1|  Asparagine synthetase                              117   2e-27   Medicago truncatula
emb|CAA73762.1|  asparagine synthetase 1                                108   2e-27   Pisum sativum [garden pea]
ref|XP_009417634.1|  PREDICTED: asparagine synthetase [glutamine-...    117   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB35223.1|  hypothetical protein B456_006G105200                    115   4e-27   Gossypium raimondii
ref|XP_008812468.1|  PREDICTED: asparagine synthetase [glutamine-...    116   4e-27   Phoenix dactylifera
ref|XP_009792170.1|  PREDICTED: asparagine synthetase [glutamine-...    116   5e-27   Nicotiana sylvestris
ref|XP_009616367.1|  PREDICTED: asparagine synthetase [glutamine-...    116   5e-27   Nicotiana tomentosiformis
emb|CDX78372.1|  BnaA03g02840D                                          116   5e-27   
emb|CDX81165.1|  BnaC03g04190D                                          116   5e-27   
ref|XP_009131148.1|  PREDICTED: asparagine synthetase [glutamine-...    116   5e-27   Brassica rapa
ref|XP_007146780.1|  hypothetical protein PHAVU_006G069300g             116   6e-27   Phaseolus vulgaris [French bean]
dbj|BAM93579.1|  asparagine synthase                                    116   6e-27   Vigna unguiculata
emb|CAB57292.1|  asparagine synthetase (type-I)                         116   6e-27   Phaseolus vulgaris [French bean]
ref|XP_008792949.1|  PREDICTED: asparagine synthetase [glutamine-...    116   6e-27   Phoenix dactylifera
ref|XP_010422871.1|  PREDICTED: asparagine synthetase [glutamine-...    115   6e-27   Camelina sativa [gold-of-pleasure]
gb|AAZ66934.1|  117M18_15                                               116   6e-27   Brassica rapa
gb|KJB08980.1|  hypothetical protein B456_001G117000                    115   7e-27   Gossypium raimondii
ref|XP_009402383.1|  PREDICTED: asparagine synthetase [glutamine-...    115   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011080785.1|  PREDICTED: asparagine synthetase [glutamine-...    115   8e-27   Sesamum indicum [beniseed]
gb|EYU45708.1|  hypothetical protein MIMGU_mgv1a003412mg                115   8e-27   Erythranthe guttata [common monkey flower]
ref|XP_010422870.1|  PREDICTED: asparagine synthetase [glutamine-...    115   8e-27   Camelina sativa [gold-of-pleasure]
gb|KJB35221.1|  hypothetical protein B456_006G105200                    115   8e-27   Gossypium raimondii
gb|AFH57273.1|  asparagine synthetase                                   115   8e-27   Gossypium hirsutum [American cotton]
ref|XP_009338945.1|  PREDICTED: asparagine synthetase [glutamine-...    115   8e-27   Pyrus x bretschneideri [bai li]
ref|XP_009353891.1|  PREDICTED: asparagine synthetase [glutamine-...    115   8e-27   Pyrus x bretschneideri [bai li]
ref|XP_008384782.1|  PREDICTED: asparagine synthetase [glutamine-...    115   8e-27   
ref|XP_008221198.1|  PREDICTED: asparagine synthetase [glutamine-...    115   8e-27   Prunus mume [ume]
ref|XP_007208013.1|  hypothetical protein PRUPE_ppa003265mg             115   8e-27   Prunus persica
ref|XP_010453051.1|  PREDICTED: asparagine synthetase [glutamine-...    115   9e-27   Camelina sativa [gold-of-pleasure]
gb|KJB08981.1|  hypothetical protein B456_001G117000                    115   1e-26   Gossypium raimondii
gb|KJB35226.1|  hypothetical protein B456_006G105400                    115   1e-26   Gossypium raimondii
gb|KJB08976.1|  hypothetical protein B456_001G117000                    115   1e-26   Gossypium raimondii
ref|XP_008805038.1|  PREDICTED: asparagine synthetase [glutamine-...    115   2e-26   
ref|XP_007016070.1|  Glutamine-dependent asparagine synthase 1          114   2e-26   
ref|XP_010491681.1|  PREDICTED: asparagine synthetase [glutamine-...    114   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008465262.1|  PREDICTED: asparagine synthetase [glutamine-...    114   3e-26   Cucumis melo [Oriental melon]
sp|P49092.2|ASNS1_LOTJA  RecName: Full=Asparagine synthetase [glu...    114   3e-26   Lotus japonicus
gb|AAO38524.1|  asparagine synthetase                                   114   3e-26   Securigera parviflora
ref|XP_010685525.1|  PREDICTED: asparagine synthetase [glutamine-...    114   4e-26   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAO45866.1|  asparagine synthetase                                  114   4e-26   Acacia mangium
ref|XP_010253782.1|  PREDICTED: asparagine synthetase [glutamine-...    114   4e-26   Nelumbo nucifera [Indian lotus]
gb|KHG05830.1|  hypothetical protein F383_10738                         112   4e-26   Gossypium arboreum [tree cotton]
sp|O24661.3|ASNS_TRIVS  RecName: Full=Asparagine synthetase [glut...    114   4e-26   Triphysaria versicolor
ref|XP_010690144.1|  PREDICTED: asparagine synthetase [glutamine-...    113   5e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI15932.3|  unnamed protein product                                113   6e-26   Vitis vinifera
ref|NP_001268166.1|  asparagine synthetase [glutamine-hydrolyzing...    113   6e-26   Vitis vinifera
gb|AAU89392.1|  glutamine-dependent asparagine synthetase               113   6e-26   Triticum aestivum [Canadian hard winter wheat]
gb|AAK49456.1|AF307145_1  glutamine-dependent asparagine syntheta...    113   6e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT27682.1|  Asparagine glutamine-hydrolyzing synthetase             113   6e-26   
gb|KJB35222.1|  hypothetical protein B456_006G105200                    112   6e-26   Gossypium raimondii
ref|NP_001235721.1|  asparagine synthetase 2                            113   7e-26   
ref|XP_003519256.1|  PREDICTED: asparagine synthetase, root [glut...    113   7e-26   
gb|KEH34318.1|  asparagine synthetase [glutamine-hydrolyzing] pro...    112   8e-26   Medicago truncatula
ref|XP_004294298.1|  PREDICTED: asparagine synthetase [glutamine-...    113   8e-26   Fragaria vesca subsp. vesca
ref|XP_010515041.1|  PREDICTED: asparagine synthetase [glutamine-...    112   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010503333.1|  PREDICTED: asparagine synthetase [glutamine-...    112   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006290806.1|  hypothetical protein CARUB_v10016913mg             112   8e-26   Capsella rubella
ref|XP_007142192.1|  hypothetical protein PHAVU_008G259900g             112   9e-26   Phaseolus vulgaris [French bean]
dbj|BAA96251.1|  asparagine synthetase                                  112   9e-26   Astragalus sinicus
gb|KJB08978.1|  hypothetical protein B456_001G117000                    111   9e-26   Gossypium raimondii
gb|AGV54350.1|  asparagine synthetase                                   112   9e-26   Phaseolus vulgaris [French bean]
gb|ABU95104.1|  asparagine synthetase                                   112   9e-26   Phaseolus vulgaris [French bean]
emb|CAA08913.1|  asparagine synthetase type II                          112   9e-26   Phaseolus vulgaris [French bean]
ref|XP_002438207.1|  hypothetical protein SORBIDRAFT_10g009590          112   1e-25   Sorghum bicolor [broomcorn]
ref|XP_002526709.1|  asparagine synthetase, putative                    112   1e-25   Ricinus communis
sp|P31752.2|ASNS_ASPOF  RecName: Full=Asparagine synthetase [glut...    112   1e-25   Asparagus officinalis
emb|CAA67889.1|  asparagine synthetase                                  112   1e-25   Asparagus officinalis
sp|P49094.2|ASNS_MAIZE  RecName: Full=Asparagine synthetase [glut...    112   1e-25   Zea mays [maize]
gb|KDO66933.1|  hypothetical protein CISIN_1g007799mg                   112   1e-25   Citrus sinensis [apfelsine]
ref|NP_001235492.1|  asparagine synthetase                              112   1e-25   Glycine max [soybeans]
ref|NP_001235738.1|  asparagine synthetase 1                            112   1e-25   
gb|ABB04097.1|  asparagine synthetase                                   112   1e-25   Glycine max [soybeans]
ref|XP_006602084.1|  PREDICTED: asparagine synthetase [glutamine-...    112   1e-25   
ref|XP_003538303.1|  PREDICTED: asparagine synthetase [glutamine-...    112   1e-25   
gb|KDP45791.1|  hypothetical protein JCGZ_17398                         112   1e-25   Jatropha curcas
ref|XP_004984566.1|  PREDICTED: asparagine synthetase [glutamine-...    112   1e-25   Setaria italica
ref|NP_001278720.1|  asparagine synthetase [glutamine-hydrolyzing]      112   1e-25   Zea mays [maize]
gb|AAC16325.1|  asparagine synthetase                                   112   1e-25   Elaeagnus umbellata [aki-gumi]
ref|XP_004173679.1|  PREDICTED: asparagine synthetase [glutamine-...    104   1e-25   
ref|XP_004490613.1|  PREDICTED: asparagine synthetase, root [glut...    112   1e-25   Cicer arietinum [garbanzo]
ref|XP_004143163.1|  PREDICTED: asparagine synthetase [glutamine-...    112   1e-25   Cucumis sativus [cucumbers]
ref|XP_004500279.1|  PREDICTED: asparagine synthetase, nodule [gl...    112   2e-25   Cicer arietinum [garbanzo]
gb|KEH34317.1|  asparagine synthetase [glutamine-hydrolyzing] pro...    112   2e-25   Medicago truncatula
gb|AAB81011.1|  asparagine synthetase                                   112   2e-25   Medicago sativa [alfalfa]
gb|AAB48058.1|  asparagine synthetase                                   112   2e-25   Medicago sativa [alfalfa]
sp|P19251.3|ASNS1_PEA  RecName: Full=Asparagine synthetase, nodul...    112   2e-25   Pisum sativum [garden pea]
emb|CAA96526.1|  asparagine synthetase                                  112   2e-25   Vicia faba [broad bean]
ref|NP_850663.1|  asparagine synthetase [glutamine-hydrolyzing]         111   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828491.1|  hypothetical protein AMTR_s00060p00168860          112   2e-25   Amborella trichopoda
gb|EPS59577.1|  asparagine synthetase                                   103   2e-25   Genlisea aurea
gb|AFW87612.1|  hypothetical protein ZEAMMB73_955390                    109   2e-25   
gb|KDO66931.1|  hypothetical protein CISIN_1g007799mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|XP_006488550.1|  PREDICTED: asparagine synthetase [glutamine-...    112   2e-25   Citrus sinensis [apfelsine]
ref|XP_006425094.1|  hypothetical protein CICLE_v10028078mg             112   2e-25   Citrus clementina [clementine]
gb|KJB35224.1|  hypothetical protein B456_006G105200                    111   3e-25   Gossypium raimondii
ref|XP_009416292.1|  PREDICTED: asparagine synthetase [glutamine-...    111   3e-25   
ref|XP_009416293.1|  PREDICTED: asparagine synthetase [glutamine-...    111   3e-25   
ref|XP_009416291.1|  PREDICTED: asparagine synthetase [glutamine-...    111   3e-25   
ref|XP_010426174.1|  PREDICTED: asparagine synthetase [glutamine-...    111   3e-25   Camelina sativa [gold-of-pleasure]
ref|NP_190318.1|  asparagine synthetase [glutamine-hydrolyzing]         111   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877554.1|  hypothetical protein ARALYDRAFT_905953             111   3e-25   Arabidopsis lyrata subsp. lyrata
gb|AAL93300.1|AF488726_1  asparagine synthetase                         110   3e-25   Securigera parviflora
ref|XP_003615712.1|  Asparagine synthetase                              110   3e-25   
ref|XP_004144212.1|  PREDICTED: asparagine synthetase [glutamine-...    111   3e-25   
gb|KFK32648.1|  hypothetical protein AALP_AA6G270400                    111   3e-25   Arabis alpina [alpine rockcress]
ref|XP_006404395.1|  hypothetical protein EUTSA_v10010235mg             111   4e-25   Eutrema salsugineum [saltwater cress]
gb|AEE81749.1|  asparagine synthetase                                   110   4e-25   Morus alba var. multicaulis
gb|KDO66936.1|  hypothetical protein CISIN_1g007799mg                   109   4e-25   Citrus sinensis [apfelsine]
gb|KHG19876.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...    110   5e-25   Gossypium arboreum [tree cotton]
ref|XP_010535370.1|  PREDICTED: asparagine synthetase [glutamine-...    110   5e-25   Tarenaya hassleriana [spider flower]
ref|NP_001057340.1|  Os06g0265000                                       110   5e-25   
ref|XP_003615711.1|  Asparagine synthetase                              110   6e-25   Medicago truncatula
ref|NP_850664.1|  asparagine synthetase [glutamine-hydrolyzing]         109   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008445536.1|  PREDICTED: asparagine synthetase [glutamine-...    110   6e-25   
emb|CAA73763.1|  asparagine synthetase 2                                102   7e-25   Pisum sativum [garden pea]
gb|KEH34319.1|  asparagine synthetase [glutamine-hydrolyzing] pro...    108   8e-25   Medicago truncatula
ref|XP_006425093.1|  hypothetical protein CICLE_v10028078mg             108   1e-24   
gb|KDO66934.1|  hypothetical protein CISIN_1g007799mg                   108   1e-24   Citrus sinensis [apfelsine]
ref|XP_009150235.1|  PREDICTED: asparagine synthetase [glutamine-...    110   1e-24   
ref|XP_009622719.1|  PREDICTED: asparagine synthetase [glutamine-...    109   1e-24   Nicotiana tomentosiformis
gb|AAF02775.1|AF190728_1  asparagine synthetase                         109   1e-24   Helianthus annuus
gb|AAM94340.1|  asparagine synthetase                                   109   1e-24   Striga hermonthica [purple witchweed]
ref|XP_006655987.1|  PREDICTED: asparagine synthetase [glutamine-...    109   1e-24   Oryza brachyantha
gb|ABK26163.1|  unknown                                                 103   1e-24   Picea sitchensis
sp|P49093.2|ASNS2_LOTJA  RecName: Full=Asparagine synthetase [glu...    109   2e-24   Lotus japonicus
dbj|BAA96252.1|  asparagine synthetase                                  109   2e-24   Astragalus sinicus
gb|ACJ83289.1|  unknown                                                 104   2e-24   Medicago truncatula
ref|XP_009766230.1|  PREDICTED: asparagine synthetase [glutamine-...    108   2e-24   Nicotiana sylvestris
gb|KHN46143.1|  Asparagine synthetase, root [glutamine-hydrolyzing]     108   3e-24   Glycine soja [wild soybean]
gb|KHN40086.1|  Asparagine synthetase [glutamine-hydrolyzing] 1         108   3e-24   Glycine soja [wild soybean]
gb|EPS71106.1|  asparagine synthetase                                   108   3e-24   Genlisea aurea
gb|AAL91002.1|  asparagine synthetase                                   108   3e-24   Securigera parviflora
ref|XP_003579059.1|  PREDICTED: asparagine synthetase [glutamine-...    108   4e-24   Brachypodium distachyon [annual false brome]
gb|AAF74755.1|  asparagine synthetase                                   108   4e-24   Helianthus annuus
gb|KJB83674.1|  hypothetical protein B456_013G259500                    108   4e-24   Gossypium raimondii
gb|ACJ85706.1|  unknown                                                 106   4e-24   Medicago truncatula
gb|KHN05227.1|  Asparagine synthetase [glutamine-hydrolyzing] 2         108   4e-24   Glycine soja [wild soybean]
gb|ADK13052.1|  asparagine synthetase                                   108   5e-24   Pinus pinaster [cluster pine]
gb|KGN47585.1|  hypothetical protein Csa_6G362920                       107   5e-24   Cucumis sativus [cucumbers]
ref|XP_011024933.1|  PREDICTED: asparagine synthetase [glutamine-...    107   5e-24   Populus euphratica
ref|XP_010102790.1|  Glutamine-dependent asparagine synthetase 2        107   6e-24   
ref|XP_011003961.1|  PREDICTED: asparagine synthetase [glutamine-...    107   6e-24   Populus euphratica
ref|XP_002313246.2|  asparagine synthetase family protein               107   6e-24   
ref|XP_011097578.1|  PREDICTED: asparagine synthetase [glutamine-...    107   7e-24   Sesamum indicum [beniseed]
gb|ABR16560.1|  unknown                                                 107   1e-23   Picea sitchensis
gb|KJB55713.1|  hypothetical protein B456_009G0905002                   103   1e-23   Gossypium raimondii
emb|CDY51796.1|  BnaC03g75390D                                          103   1e-23   Brassica napus [oilseed rape]
gb|ABR16980.1|  unknown                                                 107   1e-23   Picea sitchensis
ref|XP_003568184.1|  PREDICTED: asparagine synthetase [glutamine-...    107   1e-23   Brachypodium distachyon [annual false brome]
dbj|BAB17726.1|  asparagine synthetase                                  106   1e-23   Raphanus sativus
gb|AFZ85291.1|  asparagine synthetase                                   106   2e-23   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|EMT24348.1|  Asparagine synthetase (glutamine-hydrolyzing)           106   2e-23   
gb|EMT31774.1|  Asparagine synthetase (glutamine-hydrolyzing)           106   2e-23   
dbj|BAK06280.1|  predicted protein                                      106   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX99060.1|  BnaA06g17510D                                          106   2e-23   
emb|CAD43058.1|  putative asparagine synthetase                         106   2e-23   Pinus sylvestris [Scotch pine]
gb|ADU02856.1|  asparagine synthetase                                   106   2e-23   Pinus pinaster [cluster pine]
gb|KCW85423.1|  hypothetical protein EUGRSUZ_B02239                     106   2e-23   Eucalyptus grandis [rose gum]
dbj|BAJ84981.1|  predicted protein                                      106   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006344055.1|  PREDICTED: asparagine synthetase [glutamine-...    106   3e-23   Solanum tuberosum [potatoes]
ref|XP_004240406.1|  PREDICTED: asparagine synthetase [glutamine-...    106   3e-23   
ref|XP_009149924.1|  PREDICTED: asparagine synthetase [glutamine-...    105   3e-23   Brassica rapa
sp|P49091.2|ASNS_BRAOL  RecName: Full=Asparagine synthetase [glut...    105   4e-23   Brassica oleracea
ref|XP_002299991.2|  asparagine synthetase family protein               104   9e-23   
emb|CDY21785.1|  BnaA06g20540D                                          104   1e-22   Brassica napus [oilseed rape]
gb|KHN02080.1|  Asparagine synthetase [glutamine-hydrolyzing] 2         103   1e-22   Glycine soja [wild soybean]
sp|P19252.3|ASNS2_PEA  RecName: Full=Asparagine synthetase, root ...    103   2e-22   Pisum sativum [garden pea]
ref|XP_010043416.1|  PREDICTED: asparagine synthetase [glutamine-...    103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010264605.1|  PREDICTED: asparagine synthetase [glutamine-...    102   4e-22   Nelumbo nucifera [Indian lotus]
gb|AHA44834.1|  asparagine synthetase                                   102   5e-22   Larix kaempferi [karamatsu]
dbj|BAJ88564.1|  predicted protein                                      102   6e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87368.1|  predicted protein                                      102   6e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAO39048.1|  asparagine synthetase 2                                 102   6e-22   Hordeum vulgare [barley]
emb|CDX77846.1|  BnaC03g53730D                                          100   2e-21   
tpg|DAA59148.1|  TPA: hypothetical protein ZEAMMB73_422165              100   3e-21   
ref|XP_004962101.1|  PREDICTED: asparagine synthetase [glutamine-...    100   3e-21   Setaria italica
ref|NP_001241726.1|  asparagine synthetase                              100   4e-21   
ref|NP_001131013.1|  asparagine synthetase2                             100   4e-21   Zea mays [maize]
emb|CDP09210.1|  unnamed protein product                                100   4e-21   Coffea canephora [robusta coffee]
ref|XP_006843600.1|  hypothetical protein AMTR_s00007p00134530        99.8    5e-21   Amborella trichopoda
emb|CBU30418.1|  asparagine synthase                                  99.0    8e-21   Polytomella sp. Pringsheim 198.80
ref|XP_001702113.1|  asparagine synthase                              98.2    2e-20   Chlamydomonas reinhardtii
ref|XP_002955283.1|  hypothetical protein VOLCADRAFT_65699            97.4    3e-20   Volvox carteri f. nagariensis
ref|XP_002450094.1|  hypothetical protein SORBIDRAFT_05g000440        96.7    6e-20   
dbj|BAJ97133.1|  predicted protein                                    94.4    4e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIW63723.1|  asparagine synthetase                                 88.6    5e-19   Lupinus luteus
ref|XP_004984856.1|  PREDICTED: asparagine synthetase [glutamine-...  93.6    8e-19   
gb|KHG15500.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...  92.4    2e-18   Gossypium arboreum [tree cotton]
ref|XP_001783027.1|  predicted protein                                91.7    3e-18   
gb|KHG11690.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...  90.9    5e-18   Gossypium arboreum [tree cotton]
dbj|BAJ93127.1|  predicted protein                                    90.5    5e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006651276.1|  PREDICTED: asparagine synthetase [glutamine-...  90.9    7e-18   
gb|AFW88703.1|  hypothetical protein ZEAMMB73_416382                  90.5    8e-18   
ref|NP_001131015.1|  asparagine synthetase4                           90.5    8e-18   Zea mays [maize]
emb|CAR70075.1|  asparagine synthetase                                90.5    8e-18   Zea mays [maize]
ref|NP_001131014.1|  asparagine synthetase3                           90.5    8e-18   Zea mays [maize]
emb|CAR70074.1|  asparagine synthetase                                90.5    8e-18   Zea mays [maize]
gb|AFW88704.1|  asparagine synthetase                                 90.5    1e-17   
gb|ACV52579.1|  asparagine synthetase                                 85.9    1e-17   Nicotiana benthamiana
gb|AFW88701.1|  hypothetical protein ZEAMMB73_416382                  87.0    2e-17   
gb|AFW88702.1|  hypothetical protein ZEAMMB73_416382                  87.4    3e-17   
sp|Q10MX3.1|ASNS1_ORYSJ  RecName: Full=Asparagine synthetase [glu...  87.8    6e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658042.1|  PREDICTED: asparagine synthetase4 isoform X1     87.4    6e-17   Zea mays [maize]
ref|XP_003558155.1|  PREDICTED: asparagine synthetase [glutamine-...  87.8    7e-17   Brachypodium distachyon [annual false brome]
ref|XP_001784562.1|  predicted protein                                86.3    2e-16   
emb|CBI25890.3|  unnamed protein product                              78.2    8e-16   Vitis vinifera
gb|KHG11567.1|  Asparagine synthetase [glutamine-hydrolyzing] 1       84.0    1e-15   Gossypium arboreum [tree cotton]
ref|XP_008803884.1|  PREDICTED: asparagine synthetase [glutamine-...  79.3    2e-15   Phoenix dactylifera
ref|XP_008803885.1|  PREDICTED: uncharacterized protein LOC103717...  79.0    2e-15   Phoenix dactylifera
ref|XP_002963950.1|  hypothetical protein SELMODRAFT_81509            83.6    2e-15   
ref|XP_008803887.1|  PREDICTED: asparagine synthetase [glutamine-...  78.6    2e-15   Phoenix dactylifera
ref|XP_008803886.1|  PREDICTED: uncharacterized protein LOC103717...  78.2    4e-15   
ref|XP_002967970.1|  hypothetical protein SELMODRAFT_145135           81.3    1e-14   
emb|CDY71298.1|  BnaCnng72260D                                        81.3    1e-14   
ref|XP_008348628.1|  PREDICTED: asparagine synthetase [glutamine-...  75.1    6e-14   
ref|WP_026898384.1|  asparagine synthetase B                          78.6    9e-14   
ref|XP_002786033.1|  conserved hypothetical protein                   78.2    1e-13   
ref|XP_002777456.1|  asparagine synthetase, putative                  78.2    2e-13   
gb|EEC75023.1|  hypothetical protein OsI_11112                        77.4    2e-13   
gb|EEE58857.1|  hypothetical protein OsJ_10452                        77.4    3e-13   
ref|XP_004360300.1|  asparagine synthetase                            75.9    7e-13   
ref|XP_008381549.1|  PREDICTED: asparagine synthetase [glutamine-...  71.6    1e-12   
ref|WP_022129500.1|  asparagine synthetase                            75.1    1e-12   
ref|WP_021963649.1|  asparagine synthetase                            74.7    2e-12   
ref|WP_021896793.1|  asparagine synthetase                            74.7    2e-12   
ref|WP_021930176.1|  asparagine synthetase                            74.3    2e-12   
ref|WP_044074489.1|  asparagine synthetase B                          74.3    3e-12   
ref|WP_044073467.1|  asparagine synthetase B                          74.3    3e-12   
ref|WP_022317461.1|  asparagine synthetase                            74.3    3e-12   
ref|WP_042518378.1|  asparagine synthetase B                          74.3    3e-12   
ref|WP_044065074.1|  asparagine synthetase B                          74.3    3e-12   
ref|WP_044079772.1|  asparagine synthetase B                          74.3    3e-12   
ref|WP_022158888.1|  asparagine synthetase                            74.3    3e-12   
ref|WP_033149579.1|  asparagine synthetase B                          74.3    3e-12   
ref|WP_028907006.1|  asparagine synthetase B                          74.3    3e-12   
ref|WP_013064937.1|  asparagine synthetase B                          74.3    3e-12   
ref|XP_001760709.1|  predicted protein                                74.3    3e-12   
ref|WP_033147509.1|  asparagine synthetase B                          73.9    3e-12   
ref|WP_028904113.1|  asparagine synthetase B                          73.9    3e-12   
ref|WP_025863982.1|  asparagine synthetase B                          73.9    3e-12   
ref|WP_018710716.1|  MULTISPECIES: asparagine synthetase B            73.9    3e-12   
ref|WP_028298381.1|  asparagine synthetase B                          73.9    3e-12   
ref|WP_042295457.1|  asparagine synthetase B                          73.6    4e-12   
ref|WP_042270780.1|  asparagine synthetase B                          73.6    4e-12   
ref|WP_036580208.1|  asparagine synthetase B                          73.6    4e-12   
ref|WP_042247839.1|  asparagine synthetase B                          73.6    5e-12   
ref|WP_005778304.1|  asparagine synthetase B                          73.6    5e-12   
ref|WP_032530058.1|  asparagine synthetase B                          73.6    5e-12   
ref|WP_032540500.1|  asparagine synthetase B                          73.6    5e-12   
ref|WP_044300252.1|  asparagine synthetase B                          73.6    5e-12   
ref|WP_032542561.1|  asparagine synthetase B                          73.6    5e-12   
ref|WP_022012621.1|  asparagine synthetase                            73.6    5e-12   
ref|WP_005806605.1|  MULTISPECIES: asparagine synthetase B            73.6    5e-12   
ref|WP_005820570.1|  asparagine synthetase B                          73.6    5e-12   
gb|EMT17910.1|  Asparagine synthetase (glutamine-hydrolyzing)         73.6    5e-12   
ref|WP_006795855.1|  asparagine synthetase B                          73.6    5e-12   
ref|WP_002993807.1|  asparagine synthetase B                          73.2    6e-12   
ref|WP_003010752.1|  asparagine synthetase B                          73.2    6e-12   
ref|WP_015361217.1|  asparagine synthetase B, glutamine-hydrolyzing   73.2    7e-12   
ref|WP_025277295.1|  asparagine synthetase B                          73.2    7e-12   
ref|WP_042292975.1|  asparagine synthetase B                          72.8    7e-12   
ref|WP_042288507.1|  asparagine synthetase B                          72.8    7e-12   
ref|WP_007561520.1|  asparagine synthetase B                          72.8    8e-12   
ref|WP_022054488.1|  asparagine synthetase                            72.8    8e-12   
ref|WP_041495031.1|  asparagine synthetase B                          72.8    8e-12   
ref|WP_022149777.1|  asparagine synthetase                            72.8    8e-12   
ref|WP_044228868.1|  asparagine synthetase B                          72.8    1e-11   
ref|WP_032563075.1|  asparagine synthetase B                          72.4    1e-11   
ref|WP_024989434.1|  asparagine synthetase B                          72.4    1e-11   
ref|WP_042278823.1|  asparagine synthetase B                          72.4    1e-11   
ref|WP_020080540.1|  asparagine synthetase B                          72.0    1e-11   
ref|WP_022252386.1|  asparagine synthetase                            72.0    1e-11   
ref|WP_032585482.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_021990354.1|  asparagine synthetase                            72.0    2e-11   
ref|WP_042985595.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_008769013.1|  MULTISPECIES: asparagine synthetase B            72.0    2e-11   
ref|WP_032573290.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032580054.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032561453.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032574437.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032588772.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032559803.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032564946.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032578607.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032602411.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032588194.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032583646.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_044136307.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032533453.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_005815447.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_011202957.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_005803776.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_009292458.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_013666568.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032594324.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032570753.1|  asparagine synthetase B                          72.0    2e-11   
ref|WP_032528915.1|  asparagine synthetase B                          71.6    2e-11   
ref|WP_005788249.1|  asparagine synthetase B                          71.6    2e-11   
ref|WP_014299031.1|  asparagine synthetase B                          71.6    2e-11   
ref|WP_008660553.1|  MULTISPECIES: asparagine synthetase B            71.6    2e-11   
ref|WP_036914084.1|  asparagine synthetase B                          71.6    2e-11   
ref|WP_022354410.1|  asparagine synthetase                            71.6    2e-11   
ref|WP_008144263.1|  asparagine synthetase B                          71.2    2e-11   
ref|WP_006989326.1|  asparagine synthetase B                          71.2    3e-11   
ref|WP_021848267.1|  asparagine synthetase                            71.2    3e-11   
ref|WP_006848363.1|  asparagine synthetase B                          71.2    3e-11   
ref|WP_022327148.1|  asparagine synthetase                            71.2    3e-11   
ref|WP_027453102.1|  asparagine synthetase B                          70.9    4e-11   
ref|WP_006281327.1|  asparagine synthetase B                          70.9    4e-11   
ref|WP_022278026.1|  asparagine synthetase                            70.9    4e-11   
ref|WP_028911514.1|  asparagine synthetase B                          70.5    5e-11   
ref|WP_005923308.1|  asparagine synthase (glutamine-hydrolyzing)      70.5    5e-11   
ref|WP_007480513.1|  asparagine synthetase B                          70.5    5e-11   
ref|WP_005793377.1|  asparagine synthetase B                          70.1    6e-11   
ref|WP_028910402.1|  asparagine synthetase B                          70.1    7e-11   
ref|WP_022020936.1|  asparagine synthetase                            70.1    7e-11   
ref|WP_025019120.1|  asparagine synthetase B                          70.1    7e-11   
ref|WP_016276361.1|  asparagine synthase (glutamine-hydrolyzing)      70.1    7e-11   
ref|WP_036879927.1|  asparagine synthetase B                          70.1    8e-11   
ref|WP_025832274.1|  asparagine synthetase B                          69.7    8e-11   
ref|WP_007570017.1|  MULTISPECIES: asparagine synthetase B            69.7    9e-11   
gb|KIY92868.1|  asparagine synthase(glutamine-hydrolysing)            67.4    1e-10   
ref|WP_021970609.1|  asparagine synthetase                            69.7    1e-10   
ref|WP_026625211.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_025742688.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_044532090.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_044268783.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_029328777.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_007214330.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_007662374.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_021967740.1|  asparagine synthetase                            69.3    1e-10   
ref|WP_007218628.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_022210242.1|  asparagine synthetase                            69.3    1e-10   
ref|WP_038238554.1|  asparagine synthetase B                          69.3    1e-10   
ref|WP_029428190.1|  asparagine synthetase B                          69.3    1e-10   
gb|EDM43020.1|  asparagine synthetase B                               69.3    1e-10   
ref|WP_022232459.1|  asparagine synthetase                            68.9    2e-10   
ref|WP_022436981.1|  asparagine synthetase                            68.9    2e-10   
ref|WP_038696668.1|  asparagine synthetase B                          68.9    2e-10   
ref|WP_021909932.1|  asparagine synthetase                            68.9    2e-10   
dbj|GAM20643.1|  hypothetical protein SAMD00019534_038180             68.9    2e-10   
ref|WP_018464860.1|  asparagine synthetase B                          68.9    2e-10   
ref|XP_004335677.1|  asparagine synthase (glutaminehydrolyzing), ...  68.9    2e-10   
ref|WP_026450103.1|  asparagine synthetase B                          68.6    2e-10   
ref|WP_013740360.1|  asparagine synthetase B                          68.6    2e-10   
ref|WP_013547660.1|  asparagine synthetase B                          68.6    2e-10   
ref|WP_019668358.1|  asparagine synthetase B                          68.6    2e-10   
ref|WP_022384374.1|  asparagine synthetase                            68.6    2e-10   
ref|WP_021890726.1|  asparagine synthetase                            68.6    3e-10   
ref|WP_005938967.1|  asparagine synthase (glutamine-hydrolyzing)      68.2    3e-10   
ref|WP_032945349.1|  asparagine synthetase B                          68.2    3e-10   
ref|WP_014783300.1|  asparagine synthetase B                          68.2    3e-10   
ref|WP_022163813.1|  asparagine synthetase                            68.2    3e-10   
ref|WP_001690454.1|  MULTISPECIES: glutamine amidotransferase dom...  63.5    3e-10   
ref|WP_029034582.1|  asparagine synthetase B                          68.2    3e-10   
ref|WP_005839624.1|  asparagine synthetase B                          68.2    3e-10   
ref|WP_022508946.1|  asparagine synthetase                            68.2    3e-10   
gb|EXZ99915.1|  asparagine synthase                                   68.2    3e-10   
emb|CEJ70301.1|  Asparagine synthetase B [glutamine-hydrolyzing]      65.1    3e-10   
ref|WP_033562999.1|  asparagine synthetase B                          67.8    4e-10   
ref|WP_022347441.1|  asparagine synthetase                            67.8    4e-10   
ref|WP_008269105.1|  asparagine synthetase B                          67.8    4e-10   
ref|WP_007092738.1|  asparagine synthetase B                          67.8    4e-10   
ref|WP_012573338.1|  asparagine synthetase B                          67.8    4e-10   
ref|WP_009134188.1|  asparagine synthetase B                          67.8    4e-10   
ref|WP_012024318.1|  asparagine synthetase B                          67.8    4e-10   
ref|WP_031456241.1|  asparagine synthetase B                          67.4    5e-10   
ref|WP_008462256.1|  asparagine synthetase B                          67.4    5e-10   
ref|WP_013994089.1|  asparagine synthetase B                          67.4    5e-10   
ref|WP_010519315.1|  asparagine synthetase B                          67.4    5e-10   
ref|WP_022510622.1|  asparagine synthetase                            67.4    5e-10   
gb|EYA95535.1|  asparagine synthase                                   67.4    5e-10   
gb|EYA24309.1|  asparagine synthase                                   67.4    5e-10   
gb|EXZ94064.1|  asparagine synthase                                   67.4    5e-10   
gb|EXZ82676.1|  asparagine synthase                                   67.4    5e-10   
ref|WP_013618611.1|  asparagine synthetase B                          67.4    5e-10   
ref|WP_022041061.1|  asparagine synthetase                            67.4    5e-10   
ref|WP_044544875.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_041525537.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_039849003.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_036632246.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_036612251.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_008774021.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_005866047.1|  MULTISPECIES: asparagine synthetase B            67.4    6e-10   
ref|WP_008780845.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_009276605.1|  MULTISPECIES: asparagine synthetase B            67.4    6e-10   
gb|EFK63970.1|  asparagine synthase (glutamine-hydrolyzing)           67.4    6e-10   
gb|EEU49646.1|  asparagine synthase (glutamine-hydrolyzing)           67.4    6e-10   
gb|ABR42109.1|  glutamine-hydrolyzing asparagine synthetase B         67.4    6e-10   
ref|WP_009127250.1|  asparagine synthase (glutamine-hydrolyzing)      67.4    6e-10   
ref|WP_024995612.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_038607379.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_008653575.1|  asparagine synthetase B                          67.4    6e-10   
ref|WP_028123525.1|  asparagine synthetase B                          67.0    6e-10   
ref|WP_025867946.1|  asparagine synthetase B                          67.0    6e-10   
ref|WP_002560825.1|  asparagine synthase (glutamine-hydrolyzing)      67.0    6e-10   
ref|WP_007485096.1|  asparagine synthetase B                          67.0    6e-10   
ref|WP_027454409.1|  asparagine synthetase B                          67.0    6e-10   
ref|WP_027450721.1|  asparagine synthetase B                          67.0    6e-10   
ref|WP_042566371.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_039119240.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_039111147.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_035649051.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_035619008.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_029268786.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_026981889.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_026729029.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_017495359.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_007811369.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_013444624.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_041519764.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_006798512.1|  asparagine synthetase B                          67.0    7e-10   
ref|WP_034061787.1|  asparagine synthetase B                          67.0    8e-10   
ref|WP_009196999.1|  Asparagine synthetase B                          67.0    8e-10   
gb|EFA84024.1|  asparagine synthetase                                 67.4    8e-10   
ref|WP_035684319.1|  asparagine synthetase B                          66.6    8e-10   
ref|WP_038610504.1|  asparagine synthetase B                          66.6    9e-10   
ref|WP_007832309.1|  asparagine synthetase B                          66.6    9e-10   
ref|WP_022186090.1|  asparagine synthetase                            66.6    9e-10   
ref|WP_005851427.1|  asparagine synthetase B                          66.6    9e-10   
ref|WP_008671402.1|  MULTISPECIES: asparagine synthetase B            66.6    9e-10   
ref|WP_012055983.1|  asparagine synthetase B                          66.6    9e-10   
ref|WP_044654444.1|  hypothetical protein                             63.5    9e-10   
ref|WP_019130049.1|  asparagine synthetase B                          66.6    9e-10   
ref|WP_021070946.1|  hypothetical protein                             66.6    9e-10   
ref|WP_029904041.1|  asparagine synthetase B                          66.6    1e-09   
ref|WP_022217910.1|  asparagine synthetase                            66.6    1e-09   
ref|WP_001636752.1|  glutamine amidotransferase domain protein        63.2    1e-09   
gb|EXX57820.1|  asparagine synthase (glutamine-hydrolyzing) 2         66.6    1e-09   
ref|WP_016270675.1|  asparagine synthase (glutamine-hydrolyzing)      66.6    1e-09   
ref|WP_044468096.1|  asparagine synthetase B                          66.6    1e-09   
ref|WP_034525537.1|  asparagine synthetase B                          66.6    1e-09   



>gb|KDO36325.1| hypothetical protein CISIN_1g046287mg, partial [Citrus sinensis]
Length=105

 Score =   124 bits (310),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/75 (95%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLHC GDCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHGDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75



>gb|KDO36599.1| hypothetical protein CISIN_1g037758mg, partial [Citrus sinensis]
Length=105

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLH  GDCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHYHGDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75



>emb|CDP01451.1| unnamed protein product [Coffea canephora]
Length=581

 Score =   127 bits (319),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 71/75 (95%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAIIDPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHQDCYLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI+VTVN
Sbjct  61   QPLYNEDKTIIVTVN  75


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYMGWGLDGSVWFAS  159



>ref|XP_010027848.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 isoform 
X1 [Eucalyptus grandis]
 gb|KCW54483.1| hypothetical protein EUGRSUZ_I00431 [Eucalyptus grandis]
Length=577

 Score =   127 bits (318),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D SQAKRSRIIELSRRLRHRGPDWSGLHC GDCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDTSQAKRSRIIELSRRLRHRGPDWSGLHCNGDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  400  HCCHGQCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            H      FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  126  HDTRDNSFIAARDAIGITPLYVGWGLDGSVWFAS  159



>ref|XP_010027849.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X2 [Eucalyptus grandis]
Length=586

 Score =   127 bits (318),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D SQAKRSRIIELSRRLRHRGPDWSGLHC GDCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDTSQAKRSRIIELSRRLRHRGPDWSGLHCNGDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  400  HCCHGQCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            H      FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  126  HDTRDNSFIAARDAIGITPLYVGWGLDGSVWFAS  159



>ref|XP_011031010.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Populus 
euphratica]
Length=584

 Score =   126 bits (317),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GCTDNSQAKRSR+IELSRRL+HRGPDWSGLHC GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCTDNSQAKRSRVIELSRRLKHRGPDWSGLHCHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN+DKT+VVTVN
Sbjct  61   QPLYNQDKTVVVTVN  75


 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>gb|KDP46836.1| hypothetical protein JCGZ_24045 [Jatropha curcas]
Length=585

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYLGWGLDGSVWFAS  159



>ref|XP_004288204.2| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Fragaria 
vesca subsp. vesca]
Length=636

 Score =   127 bits (318),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  188  AAMCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTS  367
            AAMCGILAV GC D+SQAKRSRIIELSRRLRHRGPDWSGLHC GDCYLAHQRLAI+DP S
Sbjct  50   AAMCGILAVLGCVDHSQAKRSRIIELSRRLRHRGPDWSGLHCHGDCYLAHQRLAIVDPAS  109

Query  368  GDQPLYNEDKTIVVTVN  418
            GDQPLYNEDKT+VVTVN
Sbjct  110  GDQPLYNEDKTVVVTVN  126


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+AARDAIGITPLYMGWG DGS+W AS
Sbjct  184  FMAARDAIGITPLYMGWGPDGSIWFAS  210



>ref|XP_009343558.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Pyrus x bretschneideri]
Length=582

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRL+HRGPDWSGLHC G+CYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLKHRGPDWSGLHCHGNCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W AS
Sbjct  131  ESFIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_009364610.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Pyrus 
x bretschneideri]
Length=582

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRL+HRGPDWSGLHC G+CYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLKHRGPDWSGLHCHGNCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W AS
Sbjct  131  ESFIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_008369048.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Malus 
domestica]
Length=582

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRL+HRGPDWSGLHC G+CYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLKHRGPDWSGLHCHGNCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            Q FIAARDAIGITPLYMGWGLDGS+W AS
Sbjct  131  QSFIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_007047957.1| Asparagine synthetase 3 isoform 2 [Theobroma cacao]
 gb|EOX92114.1| Asparagine synthetase 3 isoform 2 [Theobroma cacao]
Length=554

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCVDNSQAKRSRIIELSRRLRHRGPDWSGIHCHQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_007207234.1| hypothetical protein PRUPE_ppa015268mg [Prunus persica]
 gb|EMJ08433.1| hypothetical protein PRUPE_ppa015268mg [Prunus persica]
Length=563

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLHC G+CYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHGNCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +IAARDAIGITPLYMGWGLDGS+W AS
Sbjct  133  YIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_007047958.1| Asparagine synthetase 3 isoform 3 [Theobroma cacao]
 gb|EOX92115.1| Asparagine synthetase 3 isoform 3 [Theobroma cacao]
Length=585

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCVDNSQAKRSRIIELSRRLRHRGPDWSGIHCHQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_007047956.1| Asparagine synthetase 3 isoform 1 [Theobroma cacao]
 gb|EOX92113.1| Asparagine synthetase 3 isoform 1 [Theobroma cacao]
Length=586

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCVDNSQAKRSRIIELSRRLRHRGPDWSGIHCHQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_008233969.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Prunus 
mume]
Length=584

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLHC G+CYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHGNCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +IAARDAIGITPLYMGWGLDGS+W AS
Sbjct  133  YIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_006428190.1| hypothetical protein CICLE_v10025269mg [Citrus clementina]
 ref|XP_006464231.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Citrus sinensis]
 gb|ESR41430.1| hypothetical protein CICLE_v10025269mg [Citrus clementina]
Length=571

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLH  GDCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHYHGDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDA+G+TPLYMGWGLDGS+W AS
Sbjct  131  KSFIAARDAVGVTPLYMGWGLDGSIWFAS  159



>ref|XP_010087589.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
 gb|EXB29444.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
Length=626

 Score =   125 bits (314),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC +NSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIENSQAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W AS
Sbjct  131  KSFIAARDAIGITPLYMGWGLDGSIWFAS  159



>gb|ABK95431.1| unknown [Populus trichocarpa]
 gb|ABK96003.1| unknown [Populus trichocarpa]
Length=584

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSR+IELSRRL+HRGPDWSGLHC GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCADNSQAKRSRVIELSRRLKHRGPDWSGLHCHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN+DKT+VVTVN
Sbjct  61   QPLYNQDKTVVVTVN  75


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_002306310.2| hypothetical protein POPTR_0005s07720g [Populus trichocarpa]
 gb|EEE93306.2| hypothetical protein POPTR_0005s07720g [Populus trichocarpa]
Length=585

 Score =   124 bits (312),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSR+IELSRRL+HRGPDWSGLHC GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCADNSQAKRSRVIELSRRLKHRGPDWSGLHCHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN+DKT+VVTVN
Sbjct  61   QPLYNQDKTVVVTVN  75


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_010680552.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Beta 
vulgaris subsp. vulgaris]
Length=587

 Score =   124 bits (311),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCLDNSQAKRSRIIELSRRLRHRGPDWSGIHCFEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W AS
Sbjct  131  KSFIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_009617044.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Nicotiana tomentosiformis]
Length=154

 Score =   117 bits (294),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLH   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHSHDDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVV VN
Sbjct  61   QPLYNEDKTIVVAVN  75


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDG  483
            + FIAARDAIGITPLYMGWGLDG
Sbjct  131  KSFIAARDAIGITPLYMGWGLDG  153



>ref|XP_004502424.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Cicer arietinum]
Length=570

 Score =   123 bits (308),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 69/84 (82%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKR+RI+ELSRRLRHRGPDWSGLHC  D YL+HQRLAIIDPTSGD
Sbjct  1    MCGILAVFGCVDNSQAKRARIVELSRRLRHRGPDWSGLHCHQDSYLSHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVNVSLLPGMLL  445
            QPLYNEDKT+ VTVN  +   MLL
Sbjct  61   QPLYNEDKTVFVTVNGEIYNHMLL  84


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWG DGS+W AS
Sbjct  131  KSFIAARDAIGITPLYLGWGHDGSIWFAS  159



>ref|XP_007163648.1| hypothetical protein PHAVU_001G252200g [Phaseolus vulgaris]
 emb|CAO91866.1| asparagine synthetase type III [Phaseolus vulgaris]
 emb|CAP04368.1| class II asparagine synthetase [Phaseolus vulgaris]
 gb|ESW35642.1| hypothetical protein PHAVU_001G252200g [Phaseolus vulgaris]
Length=570

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D+SQAKR+RIIELSRRLRHRGPDWSGLHC  DC+LAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCVDHSQAKRARIIELSRRLRHRGPDWSGLHCHDDCFLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWG DGS W AS
Sbjct  131  KSFIAARDAIGITPLYLGWGHDGSTWFAS  159



>ref|XP_009150576.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Brassica 
rapa]
 emb|CDY08829.1| BnaA06g23950D [Brassica napus]
Length=565

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 72/96 (75%), Positives = 78/96 (81%), Gaps = 3/96 (3%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVNVSLLPGMLL---VLRHFIWAG  472
            QPLYN+DKT+VVTVN  +    +L   +  H  W G
Sbjct  61   QPLYNQDKTVVVTVNGEIYNHKILREKLKSHQFWTG  96


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSFIAARDAIGVIPLYIGWGVDGSVWFAS  159



>ref|XP_006399518.1| hypothetical protein EUTSA_v10013088mg [Eutrema salsugineum]
 gb|ESQ40971.1| hypothetical protein EUTSA_v10013088mg [Eutrema salsugineum]
Length=578

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 69/75 (92%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>gb|KFK25345.1| hypothetical protein AALP_AA8G100600 [Arabis alpina]
Length=579

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 69/75 (92%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_010519584.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Tarenaya 
hassleriana]
Length=564

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSR+IELSRRLRHRGPDWSGLHC  DCYLAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRVIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  133  KSFIAARDAIGITPLYIGWGLDGSVWFAS  161



>ref|XP_009759011.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X2 [Nicotiana sylvestris]
Length=539

 Score =   121 bits (304),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 69/75 (92%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLH   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHSHDDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVV VN
Sbjct  61   QPLYNEDKTIVVAVN  75


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGITPLYMGWGLDGSVWFSS  159



>gb|KJB48988.1| hypothetical protein B456_008G096300 [Gossypium raimondii]
Length=524

 Score =   121 bits (303),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  +CYL+HQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHQNCYLSHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_009759010.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X1 [Nicotiana sylvestris]
Length=581

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 69/75 (92%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC DNSQAKRSRIIELSRRLRHRGPDWSGLH   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHSHDDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVV VN
Sbjct  61   QPLYNEDKTIVVAVN  75


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGITPLYMGWGLDGSVWFSS  159



>ref|XP_010266657.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Nelumbo 
nucifera]
 ref|XP_010266658.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Nelumbo 
nucifera]
 ref|XP_010266659.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Nelumbo 
nucifera]
Length=590

 Score =   121 bits (304),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNS AKRSRIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSHAKRSRIIELSRRLRHRGPDWSGIHCHEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI+VTVN
Sbjct  61   QPLYNEDKTIIVTVN  75


 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARD IGITPLYMGWGLDGS+W AS
Sbjct  131  KSFIAARDPIGITPLYMGWGLDGSIWFAS  159



>gb|KJB48986.1| hypothetical protein B456_008G096300 [Gossypium raimondii]
Length=568

 Score =   121 bits (303),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  +CYL+HQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHQNCYLSHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>gb|KJB48987.1| hypothetical protein B456_008G096300 [Gossypium raimondii]
Length=569

 Score =   121 bits (303),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  +CYL+HQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCHQNCYLSHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_002531258.1| asparagine synthetase, putative [Ricinus communis]
 gb|EEF31122.1| asparagine synthetase, putative [Ricinus communis]
Length=575

 Score =   121 bits (303),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D SQAKRSRIIELSRRLRHRGPDWSGLHC   CYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGCIDTSQAKRSRIIELSRRLRHRGPDWSGLHCHEGCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYLGWGLDGSVWFAS  159



>ref|XP_004237391.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Solanum 
lycopersicum]
Length=559

 Score =   120 bits (302),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+FGCTDNS AKRSR+IELSRRLRHRGPDWSGLH   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAIFGCTDNSHAKRSRVIELSRRLRHRGPDWSGLHSHEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVV VN
Sbjct  61   QPLYNEDKTIVVAVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W +S
Sbjct  131  KSFIAARDAIGITPLYMGWGLDGSIWFSS  159



>ref|NP_001031864.1| asparagine synthetase 3 [Arabidopsis thaliana]
 gb|AED91512.1| asparagine synthetase 3 [Arabidopsis thaliana]
Length=577

 Score =   121 bits (303),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI VTVN
Sbjct  61   QPLYNEDKTIAVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  130  KSFIAARDAIGITPLYIGWGLDGSVWFAS  158



>ref|NP_196586.1| asparagine synthetase 3 [Arabidopsis thaliana]
 sp|Q9LFU1.1|ASNS3_ARATH RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 3; 
AltName: Full=Glutamine-dependent asparagine synthetase 3 
[Arabidopsis thaliana]
 emb|CAB96680.1| asparagine synthetase ASN3 [Arabidopsis thaliana]
 gb|AAO41976.1| putative asparagine synthetase ASN3 [Arabidopsis thaliana]
 gb|AAO50547.1| putative asparagine synthetase ASN3 [Arabidopsis thaliana]
 gb|AED91511.1| asparagine synthetase 3 [Arabidopsis thaliana]
Length=578

 Score =   121 bits (303),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI VTVN
Sbjct  61   QPLYNEDKTIAVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>gb|AAC72836.1| asparagine synthetase [Arabidopsis thaliana]
Length=578

 Score =   121 bits (303),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI VTVN
Sbjct  61   QPLYNEDKTIAVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_006355345.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Solanum tuberosum]
Length=559

 Score =   120 bits (302),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+FGCTDNS AKRSRIIELSRRLRHRGPDWSGLH   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAIFGCTDNSHAKRSRIIELSRRLRHRGPDWSGLHSHEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVV VN
Sbjct  61   QPLYNEDKTIVVAVN  75


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W +S
Sbjct  131  KSFIAARDAIGITPLYMGWGLDGSIWFSS  159



>ref|XP_002864935.1| hypothetical protein ARALYDRAFT_496723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41194.1| hypothetical protein ARALYDRAFT_496723 [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+ VTVN
Sbjct  61   QPLYNEDKTVAVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|NP_851272.1| asparagine synthetase 2 [Arabidopsis thaliana]
 sp|Q9LV77.1|ASNS2_ARATH RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 2; 
AltName: Full=Glutamine-dependent asparagine synthetase 2 
[Arabidopsis thaliana]
 gb|AAK32927.1|AF367340_1 AT5g65010/MXK3_25 [Arabidopsis thaliana]
 dbj|BAA97313.1| asparagine synthetase [Arabidopsis thaliana]
 gb|AAM70575.1| AT5g65010/MXK3_25 [Arabidopsis thaliana]
 gb|AED97984.1| asparagine synthetase 2 [Arabidopsis thaliana]
Length=578

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+ VTVN
Sbjct  61   QPLYNEDKTVAVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>gb|AAC72837.1| asparagine synthetase [Arabidopsis thaliana]
Length=578

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+ VTVN
Sbjct  61   QPLYNEDKTVAVTVN  75


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|NP_201306.2| asparagine synthetase 2 [Arabidopsis thaliana]
 gb|AED97985.1| asparagine synthetase 2 [Arabidopsis thaliana]
Length=579

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+ VTVN
Sbjct  61   QPLYNEDKTVAVTVN  75


 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_003552061.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Glycine 
max]
 emb|CAJ43590.1| asparagine synthetase, type III [Glycine max]
 gb|KHN31371.1| Asparagine synthetase [glutamine-hydrolyzing] [Glycine soja]
Length=569

 Score =   120 bits (301),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQ KR+RIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQTKRARIIELSRRLRHRGPDWSGIHCYEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWG DGS W AS
Sbjct  131  KSFIAARDAIGITPLYLGWGHDGSTWFAS  159



>ref|XP_010269254.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Nelumbo nucifera]
Length=136

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGIL V GC DNSQAKRSRIIELSRRL HRGPDWSG++C  DCYL HQRLAI+DPTSGD
Sbjct  1    MCGILVVLGCVDNSQAKRSRIIELSRRLHHRGPDWSGIYCHEDCYLLHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75



>ref|XP_002873446.1| hypothetical protein ARALYDRAFT_908981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49705.1| hypothetical protein ARALYDRAFT_908981 [Arabidopsis lyrata subsp. 
lyrata]
Length=578

 Score =   120 bits (301),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCFEDCYLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI VTVN
Sbjct  61   QPLYNEDKTIAVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_010444467.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Camelina sativa]
Length=581

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DN+QAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  16   MCGILAVLGCIDNTQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  75

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+KTIVVTVN
Sbjct  76   QPLYNENKTIVVTVN  90


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIG+ PLY+GWGLDGSVW AS
Sbjct  146  KSFIAARDAIGVIPLYIGWGLDGSVWFAS  174



>ref|XP_010462467.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Camelina 
sativa]
Length=583

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DN+QAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNTQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+KTIVVTVN
Sbjct  61   QPLYNENKTIVVTVN  75


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSFIAARDAIGVIPLYIGWGVDGSVWFAS  159



>ref|XP_010484304.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
isoform X2 [Camelina sativa]
Length=584

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DN+QAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNTQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+KTIVVTVN
Sbjct  61   QPLYNENKTIVVTVN  75


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSFIAARDAIGVIPLYIGWGVDGSVWFAS  159



>ref|XP_010484303.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
isoform X1 [Camelina sativa]
Length=589

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DN+QAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNTQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+KTIVVTVN
Sbjct  61   QPLYNENKTIVVTVN  75


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSFIAARDAIGVIPLYIGWGVDGSVWFAS  159



>ref|XP_003538618.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Glycine max]
 gb|KHN44342.1| Asparagine synthetase [glutamine-hydrolyzing] [Glycine soja]
Length=566

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKR+RIIELSRRLRHRGPDWSG+ C  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRARIIELSRRLRHRGPDWSGIDCYEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWG DGS W AS
Sbjct  131  KSFIAARDAIGITPLYLGWGHDGSTWFAS  159



>ref|XP_006280142.1| hypothetical protein CARUB_v10026039mg [Capsella rubella]
 gb|EOA13040.1| hypothetical protein CARUB_v10026039mg [Capsella rubella]
Length=660

 Score =   120 bits (301),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 68/75 (91%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DN+QAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDPTSGD
Sbjct  85   MCGILAVLGCIDNTQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD  144

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI VTVN
Sbjct  145  QPLYNEDKTIAVTVN  159


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLY+GWGLDGSVW AS
Sbjct  215  KSFIAARDAIGIIPLYIGWGLDGSVWFAS  243



>emb|CDY14529.1| BnaC03g49300D [Brassica napus]
Length=565

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 71/96 (74%), Positives = 77/96 (80%), Gaps = 3/96 (3%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLH   DCYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHSHEDCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVNVSLLPGMLL---VLRHFIWAG  472
            QPLYN+DKT+VVTVN  +    +L   +  H  W G
Sbjct  61   QPLYNQDKTVVVTVNGEIYNHKILREKLKSHQFWTG  96


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSFIAARDAIGVIPLYIGWGVDGSVWFAS  159



>gb|KFK28186.1| hypothetical protein AALP_AA8G483400 [Arabis alpina]
Length=577

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  +CYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCYENCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+ VTVN
Sbjct  61   QPLYNEDKTVAVTVN  75


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWG+DGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGVDGSVWFAS  159



>ref|XP_010907409.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Elaeis guineensis]
Length=590

 Score =   119 bits (297),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI+VTVN
Sbjct  61   QPLYNEDKTIIVTVN  75


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F AARDAIG+TPLY+GWGLDGS+W +S
Sbjct  133  FFAARDAIGVTPLYIGWGLDGSIWISS  159



>ref|XP_006394086.1| hypothetical protein EUTSA_v10003890mg [Eutrema salsugineum]
 gb|ESQ31372.1| hypothetical protein EUTSA_v10003890mg [Eutrema salsugineum]
Length=586

 Score =   119 bits (297),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  +CYLAH+RLAIIDPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCYENCYLAHERLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+ VTVN
Sbjct  61   QPLYNEDKTVAVTVN  75


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_008440595.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Cucumis 
melo]
Length=584

 Score =   119 bits (297),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D+SQAKRSRIIELSRRLRHRGPDWSGLHC  +CYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDSSQAKRSRIIELSRRLRHRGPDWSGLHCFENCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W AS
Sbjct  131  KTFIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_004143467.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Cucumis sativus]
 ref|XP_004162303.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Cucumis sativus]
 gb|KGN48750.1| hypothetical protein Csa_6G500420 [Cucumis sativus]
Length=584

 Score =   119 bits (297),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D+SQAKRSRIIELSRRLRHRGPDWSGLHC  +CYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDSSQAKRSRIIELSRRLRHRGPDWSGLHCFENCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWGLDGS+W AS
Sbjct  131  KTFIAARDAIGITPLYMGWGLDGSIWFAS  159



>ref|XP_010917498.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Elaeis 
guineensis]
Length=629

 Score =   119 bits (298),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  188  AAMCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTS  367
            AAMCGILAV GC D S A+RSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAI+DPTS
Sbjct  38   AAMCGILAVLGCADTSLARRSRIIELSRRLRHRGPDWSGLHCHQDCYLAHQRLAIVDPTS  97

Query  368  GDQPLYNEDKTIVVTVN  418
            GDQPLYNED++IVVTVN
Sbjct  98   GDQPLYNEDQSIVVTVN  114


 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARD IGITPLYMGWGLDGSVW AS
Sbjct  170  KSFIAARDPIGITPLYMGWGLDGSVWFAS  198



>ref|XP_010547614.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Tarenaya 
hassleriana]
 ref|XP_010547616.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Tarenaya 
hassleriana]
Length=563

 Score =   118 bits (296),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D+SQAKRSRIIELSRRLRHRGPDWSGLHC  DC+LAH+RLAI+DPTSGD
Sbjct  1    MCGILAVLGCIDSSQAKRSRIIELSRRLRHRGPDWSGLHCYDDCFLAHERLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  133  KSFIAARDAIGITPLYIGWGLDGSVWFAS  161



>ref|XP_006287293.1| hypothetical protein CARUB_v10000487mg, partial [Capsella rubella]
 gb|EOA20191.1| hypothetical protein CARUB_v10000487mg, partial [Capsella rubella]
Length=615

 Score =   119 bits (297),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRII+LSRRLRHRGPDWSGLHC  DCY+AH+RLAIIDPTSGD
Sbjct  38   MCGILAVLGCGDNSQAKRSRIIQLSRRLRHRGPDWSGLHCYEDCYVAHERLAIIDPTSGD  97

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VV VN
Sbjct  98   QPLYNEDKTVVVAVN  112


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIA RDAIG+ PLY+GWGLDGSVW AS
Sbjct  168  KSFIAVRDAIGVIPLYIGWGLDGSVWFAS  196



>emb|CAN82675.1| hypothetical protein VITISV_034450 [Vitis vinifera]
Length=636

 Score =   118 bits (296),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCHQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVV  409
            QPLYNEDKT+VV
Sbjct  61   QPLYNEDKTVVV  72


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARD IGITPLY+GWGLDGS+W AS
Sbjct  138  KSFIAARDGIGITPLYIGWGLDGSIWFAS  166



>ref|XP_010922574.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Elaeis 
guineensis]
Length=589

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQYGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI+VTVN
Sbjct  61   QPLYNEDKTIIVTVN  75


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+TPLY+GWG+DGS+W +S
Sbjct  133  FLVARDAIGVTPLYIGWGIDGSIWISS  159



>ref|XP_010415168.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Camelina sativa]
 ref|XP_010483209.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Camelina sativa]
Length=132

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  191  AMCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSG  370
             MCGILAV GC D++QAKRSRIIELSRRLRHRGPDWSGLHC  DCYLAH RLAIIDPT G
Sbjct  15   TMCGILAVLGCIDSTQAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHGRLAIIDPTYG  74

Query  371  DQPLYNEDKTIVVTVNVSLLPGMLL  445
            +QPLYNEDKTIVVTVN  +    +L
Sbjct  75   EQPLYNEDKTIVVTVNGEIYNHKVL  99



>ref|XP_008805175.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Phoenix 
dactylifera]
Length=589

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQYGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+TPLY+GWGLDGS+W +S
Sbjct  133  FLVARDAIGVTPLYLGWGLDGSIWISS  159



>sp|O24338.3|ASNS_SANAU RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase [Sandersonia 
aurantiaca]
 gb|AAB71532.1| asparagine synthetase [Sandersonia aurantiaca]
Length=525

 Score =   117 bits (292),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL   GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLDHHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI+VTVN
Sbjct  61   QPLYNEDKTIIVTVN  75


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+AARDAIG+TPLY+GWGLDGSVW +S
Sbjct  133  FVAARDAIGVTPLYIGWGLDGSVWISS  159



>gb|AAF02776.1|AF190729_1 asparagine synthetase [Helianthus annuus]
Length=558

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D SQAKR+RI+ELS RLRHRGPDWSGLH + DCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCVDCSQAKRARILELSSRLRHRGPDWSGLHSEEDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+I+VTVN
Sbjct  61   QPLYNEDKSIIVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSYIAARDAIGITPLYIGWGLDGSVWFAS  159



>ref|XP_003601953.1| Asparagine synthetase [Medicago truncatula]
 gb|AES72204.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=570

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  DNSQAKR+RIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVVDNSQAKRARIIELSRRLRHRGPDWSGLHCHQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN DKT++VTVN
Sbjct  61   QPLYNYDKTVIVTVN  75


 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWG DGS+W AS
Sbjct  131  KSFIAARDAIGITPLYLGWGHDGSIWFAS  159



>emb|CAA73762.1| asparagine synthetase 1 [Pisum sativum]
Length=84

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75



>ref|XP_009417634.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Musa 
acuminata subsp. malaccensis]
Length=591

 Score =   117 bits (292),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D S AKRSRIIELSRRL+HRGPDWSGLHC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCADTSLAKRSRIIELSRRLQHRGPDWSGLHCFEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLY+GWGLDGSVW AS
Sbjct  131  KSFIAARDAIGITPLYVGWGLDGSVWFAS  159



>gb|KJB35223.1| hypothetical protein B456_006G105200 [Gossypium raimondii]
Length=511

 Score =   115 bits (289),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FVVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_008812468.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Phoenix 
dactylifera]
Length=590

 Score =   116 bits (291),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D S A+RSR+IELSRRLRHRGPDWSGLHC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCADTSLARRSRVIELSRRLRHRGPDWSGLHCYQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARD IGITPLYMGWGLDGSVW AS
Sbjct  131  KSFIAARDPIGITPLYMGWGLDGSVWFAS  159



>ref|XP_009792170.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Nicotiana sylvestris]
Length=590

 Score =   116 bits (291),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FLVARDAIGITSLYIGWGLDGSVWISS  159



>ref|XP_009616367.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Nicotiana tomentosiformis]
Length=590

 Score =   116 bits (291),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FLVARDAIGITSLYIGWGLDGSVWISS  159



>emb|CDX78372.1| BnaA03g02840D [Brassica napus]
Length=580

 Score =   116 bits (290),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQA RSRII+LSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDP SGD
Sbjct  1    MCGILAVLGCVDNSQATRSRIIKLSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLY+EDKT+VVTVN
Sbjct  61   QPLYSEDKTVVVTVN  75


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWGLDGSVW AS
Sbjct  133  KSYIAVRDAIGVIPLYIGWGLDGSVWFAS  161



>emb|CDX81165.1| BnaC03g04190D [Brassica napus]
Length=580

 Score =   116 bits (290),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQA RSRII+LSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDP SGD
Sbjct  1    MCGILAVLGCVDNSQATRSRIIKLSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLY+EDKT+VVTVN
Sbjct  61   QPLYSEDKTVVVTVN  75


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWGLDGSVW AS
Sbjct  133  KSYIAVRDAIGVIPLYIGWGLDGSVWFAS  161



>ref|XP_009131148.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Brassica rapa]
Length=580

 Score =   116 bits (290),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQA RSRII+LSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDP SGD
Sbjct  1    MCGILAVLGCVDNSQATRSRIIKLSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLY+EDKT+VVTVN
Sbjct  61   QPLYSEDKTVVVTVN  75


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWGLDGSVW AS
Sbjct  133  KSYIAVRDAIGVIPLYIGWGLDGSVWFAS  161



>ref|XP_007146780.1| hypothetical protein PHAVU_006G069300g [Phaseolus vulgaris]
 gb|ESW18774.1| hypothetical protein PHAVU_006G069300g [Phaseolus vulgaris]
Length=579

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTI VTVN
Sbjct  61   QPLFNEDKTIAVTVN  75


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>dbj|BAM93579.1| asparagine synthase [Vigna unguiculata]
Length=579

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTI VTVN
Sbjct  61   QPLFNEDKTIAVTVN  75


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>emb|CAB57292.1| asparagine synthetase (type-I) [Phaseolus vulgaris]
Length=579

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTI VTVN
Sbjct  61   QPLFNEDKTIAVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_008792949.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Phoenix dactylifera]
Length=590

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQFGDCFLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTMVVTVN  75


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGLDGSVW +S
Sbjct  133  FIAARDAIGITPLYIGWGLDGSVWISS  159



>ref|XP_010422871.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 isoform 
X2 [Camelina sativa]
Length=538

 Score =   115 bits (288),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCY+AH+RLAI+DP SGD
Sbjct  1    MCGILAVLGCADNSQAKRSRIIELSRRLRHRGPDWSGLHCFEDCYVAHERLAIVDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN DKTIVVTVN
Sbjct  61   QPLYNGDKTIVVTVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSYIAVRDAIGVNPLYIGWGVDGSVWFAS  159



>gb|AAZ66934.1| 117M18_15 [Brassica rapa]
Length=608

 Score =   116 bits (290),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQA RSRII+LSRRLRHRGPDWSGLHC  DCYLAH+RLAIIDP SGD
Sbjct  1    MCGILAVLGCVDNSQATRSRIIKLSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLY+EDKT+VVTVN
Sbjct  61   QPLYSEDKTVVVTVN  75


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWGLDGSVW AS
Sbjct  133  KSYIAVRDAIGVIPLYIGWGLDGSVWFAS  161



>gb|KJB08980.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=520

 Score =   115 bits (288),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++ VTVN
Sbjct  61   QPLFNEDKSVAVTVN  75


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+  LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVASLYIGWGLDGSVWISS  159



>ref|XP_009402383.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Musa 
acuminata subsp. malaccensis]
Length=591

 Score =   115 bits (289),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D SQAKR R++ELSRRL+HRGPDWSGLH  GDCYL HQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDESQAKRVRVLELSRRLKHRGPDWSGLHQYGDCYLTHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+TPLY+GWGLDGSVW +S
Sbjct  133  FIAARDAIGVTPLYIGWGLDGSVWISS  159



>ref|XP_011080785.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Sesamum 
indicum]
 ref|XP_011080786.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Sesamum 
indicum]
Length=586

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIGIT LY+GWGLDGSVW AS
Sbjct  133  FLVARDAIGITSLYIGWGLDGSVWIAS  159



>gb|EYU45708.1| hypothetical protein MIMGU_mgv1a003412mg [Erythranthe guttata]
Length=586

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FLVARDAIGITSLYIGWGLDGSIWISS  159



>ref|XP_010422870.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 isoform 
X1 [Camelina sativa]
Length=567

 Score =   115 bits (288),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCY+AH+RLAI+DP SGD
Sbjct  1    MCGILAVLGCADNSQAKRSRIIELSRRLRHRGPDWSGLHCFEDCYVAHERLAIVDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN DKTIVVTVN
Sbjct  61   QPLYNGDKTIVVTVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSYIAVRDAIGVNPLYIGWGVDGSVWFAS  159



>gb|KJB35221.1| hypothetical protein B456_006G105200 [Gossypium raimondii]
Length=583

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75



>gb|AFH57273.1| asparagine synthetase [Gossypium hirsutum]
Length=583

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FVVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_009338945.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Pyrus 
x bretschneideri]
Length=586

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDA+GIT LY+GW LDGSVW +S
Sbjct  133  FIVARDAVGITSLYIGWSLDGSVWISS  159



>ref|XP_009353891.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Pyrus x bretschneideri]
 ref|XP_009353897.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Pyrus x bretschneideri]
Length=586

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GW LDGSVW +S
Sbjct  133  FIVARDAIGITSLYIGWSLDGSVWISS  159



>ref|XP_008384782.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Malus 
domestica]
Length=586

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GW LDGSVW +S
Sbjct  133  FIVARDAIGITSLYIGWSLDGSVWISS  159



>ref|XP_008221198.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Prunus 
mume]
Length=588

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GW LDGSVW AS
Sbjct  133  FIVARDAIGITSLYIGWSLDGSVWIAS  159



>ref|XP_007208013.1| hypothetical protein PRUPE_ppa003265mg [Prunus persica]
 gb|EMJ09212.1| hypothetical protein PRUPE_ppa003265mg [Prunus persica]
 gb|AHM02305.1| asparagine synthetase [Prunus persica]
Length=588

 Score =   115 bits (289),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GW LDGSVW AS
Sbjct  133  FIVARDAIGITSLYIGWSLDGSVWIAS  159



>ref|XP_010453051.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Camelina sativa]
Length=579

 Score =   115 bits (288),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCY+AH+RLAI+DP SGD
Sbjct  1    MCGILAVLGCADNSQAKRSRIIELSRRLRHRGPDWSGLHCFEDCYVAHERLAIVDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN DKTIVVTVN
Sbjct  61   QPLYNGDKTIVVTVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWG+DGSVW AS
Sbjct  131  KSYIAVRDAIGVNPLYIGWGVDGSVWFAS  159



>gb|KJB08981.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=584

 Score =   115 bits (288),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++ VTVN
Sbjct  61   QPLFNEDKSVAVTVN  75


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+  LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVASLYIGWGLDGSVWISS  159



>gb|KJB35226.1| hypothetical protein B456_006G105400 [Gossypium raimondii]
Length=584

 Score =   115 bits (287),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++VVTVN
Sbjct  61   QPLFNEDKSVVVTVN  75



>gb|KJB08976.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=608

 Score =   115 bits (288),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++ VTVN
Sbjct  61   QPLFNEDKSVAVTVN  75


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+  LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVASLYIGWGLDGSVWISS  159



>ref|XP_008805038.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Phoenix dactylifera]
Length=621

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 16/119 (13%)
 Frame = +2

Query  65   ASTSISFQPISSLP*VLFR-QHIDTHVQIT*eregererergAAMCGILAVFGCTDNSQA  241
            +S ++ F PI+  P    R + +DT  ++               MCGILAV GC+D+SQA
Sbjct  3    SSQTLRFSPINRAPPAAPRSRDLDTSSKV---------------MCGILAVLGCSDDSQA  47

Query  242  KrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGDQPLYNEDKTIVVTVN  418
            KR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAIIDP SGDQPLYNE+K I+VTVN
Sbjct  48   KRVRVLELSRRLKHRGPDWSGLHQLGDCFLAHQRLAIIDPASGDQPLYNEEKNIIVTVN  106


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+TPLY+GWGLDGS+W +S
Sbjct  164  FLVARDAIGVTPLYIGWGLDGSIWISS  190



>ref|XP_007016070.1| Glutamine-dependent asparagine synthase 1 [Theobroma cacao]
 gb|EOY33689.1| Glutamine-dependent asparagine synthase 1 [Theobroma cacao]
Length=584

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++VVTVN
Sbjct  61   QPLFNEDKSVVVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYFGWGLDGSVWISS  159



>ref|XP_010491681.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Camelina sativa]
Length=580

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRSRIIELSRRLRHRGPDWSGLHC  DCY+AH+RLAI+DP SGD
Sbjct  1    MCGILAVLGCADNSQAKRSRIIELSRRLRHRGPDWSGLHCFEDCYVAHERLAIVDPISGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYN DKTIVV+VN
Sbjct  61   QPLYNGDKTIVVSVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + +IA RDAIG+ PLY+GWG+DGSVW AS
Sbjct  132  KSYIAVRDAIGVNPLYIGWGIDGSVWFAS  160



>ref|XP_008465262.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis melo]
Length=586

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+   DCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHKDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FVVARDAIGITSLYIGWGLDGSVWISS  159



>sp|P49092.2|ASNS1_LOTJA RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 1; 
AltName: Full=Glutamine-dependent asparagine synthetase 1 
[Lotus japonicus]
 emb|CAA61589.1| asparagine synthase (glutamine-hydrolysing) [Lotus japonicus]
Length=586

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D +QAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDFTQAKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>gb|AAO38524.1| asparagine synthetase [Securigera parviflora]
Length=586

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED++I+VTVN
Sbjct  61   QPLFNEDQSIIVTVN  75


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>ref|XP_010685525.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Beta vulgaris subsp. vulgaris]
Length=588

 Score =   114 bits (284),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKRS ++ELSRRL+HRGPDWSG++  GDCYL+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRSHVLELSRRLKHRGPDWSGIYQHGDCYLSHQRLAIIDPGSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+KTIVVTVN
Sbjct  61   QPLYNENKTIVVTVN  75


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  131  KSFIVARDAIGITSLYIGWGLDGSVWISS  159



>dbj|BAO45866.1| asparagine synthetase [Acacia mangium]
Length=588

 Score =   114 bits (284),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQ+KR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQSKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+N DK+IVVTVN
Sbjct  61   QPLFNTDKSIVVTVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_010253782.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nelumbo 
nucifera]
Length=589

 Score =   114 bits (284),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAIIDP+SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIIDPSSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK IVVTVN
Sbjct  61   QPLFNEDKKIVVTVN  75


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSTWISS  159



>gb|KHG05830.1| hypothetical protein F383_10738 [Gossypium arboreum]
Length=479

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 5/75 (7%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC DNSQAKRS+     R     GPDWSGLHC  +CYL+HQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCIDNSQAKRSQRRLRHR-----GPDWSGLHCHQNCYLSHQRLAIVDPTSGD  55

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  56   QPLYNEDKTVVVTVN  70



>sp|O24661.3|ASNS_TRIVS RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase [Triphysaria 
versicolor]
 gb|AAD05033.1| asparagine synthetase [Triphysaria versicolor]
 gb|AAD05034.1| asparagine synthetase [Triphysaria versicolor]
 gb|AAD05035.1| asparagine synthetase [Triphysaria versicolor]
Length=586

 Score =   114 bits (284),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSG+H  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGIHHHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK I VTVN
Sbjct  61   QPLFNEDKRIAVTVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDA GIT LY+GWGLDGSVW +S
Sbjct  133  FIAARDAFGITSLYIGWGLDGSVWISS  159



>ref|XP_010690144.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690145.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=588

 Score =   113 bits (283),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 65/96 (68%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKRS ++ELSRRL+HRGPDWSG++  GDCYL+HQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRSHVLELSRRLKHRGPDWSGIYQHGDCYLSHQRLAIVDPDSGD  60

Query  374  QPLYNEDKTIVVTVNVSLLPGMLLVLR---HFIWAG  472
            QPLYNE+KTIVVTVN  +     L  R   H  W G
Sbjct  61   QPLYNENKTIVVTVNGEIYNHEELRKRLSNHKFWTG  96


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGLDGSVW +S
Sbjct  133  FIAARDAIGITPLYIGWGLDGSVWISS  159



>emb|CBI15932.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   113 bits (283),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE++ IVVTVN
Sbjct  61   QPLYNENQAIVVTVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSVWISS  159



>ref|NP_001268166.1| asparagine synthetase [glutamine-hydrolyzing]-like [Vitis vinifera]
 gb|AEO72339.1| asparagine synthetase 1 [Vitis vinifera]
Length=583

 Score =   113 bits (283),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE++ IVVTVN
Sbjct  61   QPLYNENQAIVVTVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSVWISS  159



>gb|AAU89392.1| glutamine-dependent asparagine synthetase [Triticum aestivum]
Length=585

 Score =   113 bits (283),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D++Q KR R++ELSRRL+HRGPDWSG+H  GDCYL+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCADDTQGKRVRVLELSRRLKHRGPDWSGMHQVGDCYLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+TPLY+GWG+DGSVW +S
Sbjct  133  FIAARDAIGVTPLYIGWGIDGSVWISS  159



>gb|AAK49456.1|AF307145_1 glutamine-dependent asparagine synthetase 1 [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ98806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   113 bits (283),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D++Q KR R++ELSRRL+HRGPDWSG+H  GDCYL+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCADDTQGKRVRVLELSRRLKHRGPDWSGMHQVGDCYLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+TPLY+GWG+DGSVW +S
Sbjct  133  FIAARDAIGVTPLYVGWGIDGSVWISS  159



>gb|EMT27682.1| Asparagine glutamine-hydrolyzing synthetase [Aegilops tauschii]
Length=590

 Score =   113 bits (283),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D++Q KR R++ELSRRL+HRGPDWSG+H  GDCYL+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCADDTQGKRVRVLELSRRLKHRGPDWSGMHQVGDCYLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+TPLY+GWG+DGSVW +S
Sbjct  133  FIAARDAIGVTPLYIGWGIDGSVWISS  159



>gb|KJB35222.1| hypothetical protein B456_006G105200 [Gossypium raimondii]
Length=445

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75



>ref|NP_001235721.1| asparagine synthetase 2 [Glycine max]
 gb|AAC49613.1| asparagine synthetase 2 [Glycine max]
Length=581

 Score =   113 bits (282),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_003519256.1| PREDICTED: asparagine synthetase, root [glutamine-hydrolyzing]-like 
[Glycine max]
Length=582

 Score =   113 bits (282),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>gb|KEH34318.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=511

 Score =   112 bits (280),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>ref|XP_004294298.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Fragaria 
vesca subsp. vesca]
Length=586

 Score =   113 bits (282),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GDC+L+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCFLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LYMGW LDGS+W +S
Sbjct  133  FIVARDAIGITSLYMGWSLDGSIWISS  159



>ref|XP_010515041.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Camelina sativa]
Length=584

 Score =   112 bits (281),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGSVW +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSVWISS  159



>ref|XP_010503333.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Camelina 
sativa]
Length=585

 Score =   112 bits (281),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGSVW +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSVWISS  159



>ref|XP_006290806.1| hypothetical protein CARUB_v10016913mg [Capsella rubella]
 gb|EOA23704.1| hypothetical protein CARUB_v10016913mg [Capsella rubella]
Length=585

 Score =   112 bits (281),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGSVW +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSVWISS  159



>ref|XP_007142192.1| hypothetical protein PHAVU_008G259900g [Phaseolus vulgaris]
 gb|ESW14186.1| hypothetical protein PHAVU_008G259900g [Phaseolus vulgaris]
Length=575

 Score =   112 bits (281),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDHSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75



>dbj|BAA96251.1| asparagine synthetase [Astragalus sinicus]
Length=584

 Score =   112 bits (281),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D S+AKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCADASRAKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVTSLYIGWGLDGSVWISS  159



>gb|KJB08978.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
 gb|KJB08979.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=392

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++ VTVN
Sbjct  61   QPLFNEDKSVAVTVN  75



>gb|AGV54350.1| asparagine synthetase [Phaseolus vulgaris]
Length=584

 Score =   112 bits (281),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDHSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>gb|ABU95104.1| asparagine synthetase [Phaseolus vulgaris]
Length=584

 Score =   112 bits (281),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDHSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>emb|CAA08913.1| asparagine synthetase type II [Phaseolus vulgaris]
Length=584

 Score =   112 bits (281),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDHSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_002438207.1| hypothetical protein SORBIDRAFT_10g009590 [Sorghum bicolor]
 gb|EER89574.1| hypothetical protein SORBIDRAFT_10g009590 [Sorghum bicolor]
Length=591

 Score =   112 bits (281),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  + S AKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAIIDPTSGD
Sbjct  1    MCGILAVLGVAEVSLAKRSRIIELSRRLRHRGPDWSGLHCHQDCYLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + F+AARDAIGI PLYMGWGLDGSVW AS
Sbjct  131  KSFMAARDAIGICPLYMGWGLDGSVWFAS  159



>ref|XP_002526709.1| asparagine synthetase, putative [Ricinus communis]
 gb|EEF35671.1| asparagine synthetase, putative [Ricinus communis]
Length=591

 Score =   112 bits (281),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDSYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKAIVVTVN  75



>sp|P31752.2|ASNS_ASPOF RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
Short=AS [Asparagus officinalis]
 emb|CAA48141.1| asparagine synthase (glutamine-hydrolysing) [Asparagus officinalis]
Length=590

 Score =   112 bits (281),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL   GDC+L+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLCQHGDCFLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  418  CFIAARDAIGITPLYMGWGLDGSVWXAS  501
            CF+AARDA+GITPLY+GWGLDGSVW +S
Sbjct  132  CFVAARDAVGITPLYIGWGLDGSVWLSS  159



>emb|CAA67889.1| asparagine synthetase [Asparagus officinalis]
Length=590

 Score =   112 bits (281),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL   GDC+L+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLCQHGDCFLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK+IVVTVN
Sbjct  61   QPLYNEDKSIVVTVN  75


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  418  CFIAARDAIGITPLYMGWGLDGSVWXAS  501
            CF+AARDA+GITPLY+GWGLDGSVW +S
Sbjct  132  CFVAARDAVGITPLYIGWGLDGSVWLSS  159



>sp|P49094.2|ASNS_MAIZE RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase [Zea 
mays]
 emb|CAA58052.1| asparragine synthetase [Zea mays]
Length=586

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  + S AKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAIIDPTSGD
Sbjct  1    MCGILAVLGVVEVSLAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>gb|KDO66933.1| hypothetical protein CISIN_1g007799mg [Citrus sinensis]
Length=515

 Score =   112 bits (279),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSIWISS  159



>ref|NP_001235492.1| asparagine synthetase [Glycine max]
 gb|AAC09952.1| asparagine synthetase [Glycine max]
Length=579

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKT+VVTVN
Sbjct  61   QPLFNEDKTVVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|NP_001235738.1| asparagine synthetase 1 [Glycine max]
 gb|AAC49614.1| asparagine synthetase 1 [Glycine max]
Length=579

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKT+VVTVN
Sbjct  61   QPLFNEDKTVVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>gb|ABB04097.1| asparagine synthetase [Glycine max]
Length=579

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKT+VVTVN
Sbjct  61   QPLFNEDKTVVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_006602084.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X1 [Glycine max]
 ref|XP_006602085.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X2 [Glycine max]
 ref|XP_006602086.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X3 [Glycine max]
Length=579

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKT+VVTVN
Sbjct  61   QPLFNEDKTVVVTVN  75


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_003538303.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Glycine max]
Length=579

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKT+VVTVN
Sbjct  61   QPLFNEDKTVVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWISS  159



>gb|KDP45791.1| hypothetical protein JCGZ_17398 [Jatropha curcas]
Length=589

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+ QGD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQQGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK IVVTVN
Sbjct  61   QPLFNEDKAIVVTVN  75



>ref|XP_004984566.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Setaria italica]
Length=588

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGLHCHQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK++VVTVN
Sbjct  61   QPLYNEDKSVVVTVN  75


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>ref|NP_001278720.1| asparagine synthetase [glutamine-hydrolyzing] [Zea mays]
 gb|ACF80883.1| unknown [Zea mays]
 emb|CAR70072.1| asparagine synthetase [Zea mays]
 emb|CAR82078.1| asparagine synthetase [Zea mays]
 gb|AFW87613.1| asparagine synthetase [Zea mays]
Length=591

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  + S AKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAIIDPTSGD
Sbjct  1    MCGILAVLGVAEVSLAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>gb|AAC16325.1| asparagine synthetase [Elaeagnus umbellata]
Length=585

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+ GC+D+SQAKR R++ELSRRL+HRGPDWSGL   GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILALLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLFQFGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKT+VVTVN
Sbjct  61   QPLFNEDKTVVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSIWISS  159



>ref|XP_004173679.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like, 
partial [Cucumis sativus]
Length=73

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+   DCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHKDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVT  412
            QPLYNED+++VVT
Sbjct  61   QPLYNEDQSVVVT  73



>ref|XP_004490613.1| PREDICTED: asparagine synthetase, root [glutamine-hydrolyzing]-like 
[Cicer arietinum]
Length=585

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDPSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_004143163.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis sativus]
 gb|KGN47067.1| hypothetical protein Csa_6G183190 [Cucumis sativus]
Length=587

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+   DCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHKDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+++VVTVN
Sbjct  61   QPLYNEDQSVVVTVN  75


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FVVARDAIGITSLYIGWGLDGSVWISS  159



>ref|XP_004500279.1| PREDICTED: asparagine synthetase, nodule [glutamine-hydrolyzing]-like 
[Cicer arietinum]
Length=585

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FLVARDAIGVTSLYIGWGLDGSVWIAS  159



>gb|KEH34317.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=586

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>gb|AAB81011.1| asparagine synthetase [Medicago sativa]
Length=586

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>gb|AAB48058.1| asparagine synthetase [Medicago sativa]
Length=586

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>sp|P19251.3|ASNS1_PEA RecName: Full=Asparagine synthetase, nodule [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase 
[Pisum sativum]
 emb|CAA36429.1| unnamed protein product [Pisum sativum]
Length=586

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>emb|CAA96526.1| asparagine synthetase [Vicia faba]
Length=586

 Score =   112 bits (280),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>ref|NP_850663.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
 gb|AEE78266.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
Length=512

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FMVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_006828491.1| hypothetical protein AMTR_s00060p00168860 [Amborella trichopoda]
 gb|ERM95907.1| hypothetical protein AMTR_s00060p00168860 [Amborella trichopoda]
Length=592

 Score =   112 bits (279),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D SQ KRSR+IELSRRLRHRGPDWSGLHC  + YLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGCSDTSQIKRSRVIELSRRLRHRGPDWSGLHCYENFYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI VTVN
Sbjct  61   QPLYNEDKTIAVTVN  75


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGITPLYMGWG DGS W AS
Sbjct  131  KSFIAARDAIGITPLYMGWGRDGSTWFAS  159



>gb|EPS59577.1| asparagine synthetase, partial [Genlisea aurea]
Length=73

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSG++  GDCYL+HQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGIYQHGDCYLSHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVT  412
            QPL+NEDK IVVT
Sbjct  61   QPLFNEDKKIVVT  73



>gb|AFW87612.1| hypothetical protein ZEAMMB73_955390 [Zea mays]
Length=316

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  + S AKRSRIIELSRRLRHRGPDWSGLHC  DCYLAHQRLAIIDPTSGD
Sbjct  1    MCGILAVLGVAEVSLAKRSRIIELSRRLRHRGPDWSGLHCHEDCYLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>gb|KDO66931.1| hypothetical protein CISIN_1g007799mg [Citrus sinensis]
Length=589

 Score =   112 bits (279),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSIWISS  159



>ref|XP_006488550.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Citrus sinensis]
Length=589

 Score =   112 bits (279),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSIWISS  159



>ref|XP_006425094.1| hypothetical protein CICLE_v10028078mg [Citrus clementina]
 gb|ESR38334.1| hypothetical protein CICLE_v10028078mg [Citrus clementina]
Length=589

 Score =   112 bits (279),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSIWISS  159



>gb|KJB35224.1| hypothetical protein B456_006G105200 [Gossypium raimondii]
Length=582

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRR    GPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRQHR-GPDWSGLYQHGDCYLAHQRLAIIDPASGD  59

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  60   QPLFNEDKSIVVTVN  74



>ref|XP_009416292.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=578

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR+R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSRAKRARVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+TIVVT N
Sbjct  61   QPLYNEDETIVVTAN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGL+GSVW +S
Sbjct  133  FIAARDAIGITPLYIGWGLEGSVWISS  159



>ref|XP_009416293.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=580

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR+R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSRAKRARVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+TIVVT N
Sbjct  61   QPLYNEDETIVVTAN  75


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGL+GSVW +S
Sbjct  133  FIAARDAIGITPLYIGWGLEGSVWISS  159



>ref|XP_009416291.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=580

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+S+AKR+R++ELSRRL+HRGPDWSGL+  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSRAKRARVLELSRRLKHRGPDWSGLYQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+TIVVT N
Sbjct  61   QPLYNEDETIVVTAN  75


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGL+GSVW +S
Sbjct  133  FIAARDAIGITPLYIGWGLEGSVWISS  159



>ref|XP_010426174.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Camelina 
sativa]
Length=585

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAH+RLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHERLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGSVW +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSVWISS  159



>ref|NP_190318.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
 sp|P49078.2|ASNS1_ARATH RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 1; 
AltName: Full=Glutamine-dependent asparagine synthetase 1; 
AltName: Full=Protein DARK INDUCIBLE 6 [Arabidopsis thaliana]
 gb|AAL31889.1|AF419557_1 AT3g47340/T21L8_90 [Arabidopsis thaliana]
 gb|AAA74359.1| glutamine-dependent asparagine synthetase [Arabidopsis thaliana]
 emb|CAB51206.1| glutamine-dependent asparagine synthetase [Arabidopsis thaliana]
 gb|AAL60035.1| putative glutamine-dependent asparagine synthetase [Arabidopsis 
thaliana]
 gb|AAM20242.1| putative glutamine-dependent asparagine synthetase [Arabidopsis 
thaliana]
 gb|AEE78264.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
Length=584

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FMVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_002877554.1| hypothetical protein ARALYDRAFT_905953 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53813.1| hypothetical protein ARALYDRAFT_905953 [Arabidopsis lyrata subsp. 
lyrata]
Length=584

 Score =   111 bits (278),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FMVARDAIGVTSLYIGWGLDGSVWISS  159



>gb|AAL93300.1|AF488726_1 asparagine synthetase [Securigera parviflora]
Length=456

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED++I+VTVN
Sbjct  61   QPLFNEDQSIIVTVN  75


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>ref|XP_003615712.1| Asparagine synthetase [Medicago truncatula]
 gb|AES98670.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=516

 Score =   110 bits (276),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D ++AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDPTRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_004144212.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis sativus]
 ref|XP_004158264.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis sativus]
Length=587

 Score =   111 bits (277),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+   DCYL+HQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHADCYLSHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+K+IVVTVN
Sbjct  61   QPLYNENKSIVVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+T LY+GWG DGSVW +S
Sbjct  133  FIAARDAIGVTSLYIGWGRDGSVWISS  159



>gb|KFK32648.1| hypothetical protein AALP_AA6G270400 [Arabis alpina]
Length=584

 Score =   111 bits (277),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSG++  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGIYQHGDNYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGS+W +S
Sbjct  133  FMVARDAIGVTSLYIGWGLDGSLWISS  159



>ref|XP_006404395.1| hypothetical protein EUTSA_v10010235mg [Eutrema salsugineum]
 gb|ESQ45848.1| hypothetical protein EUTSA_v10010235mg [Eutrema salsugineum]
Length=584

 Score =   111 bits (277),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSG++  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGIYQNGDNYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGS+W +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSLWISS  159



>gb|AEE81749.1| asparagine synthetase [Morus alba var. multicaulis]
Length=586

 Score =   110 bits (276),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQ KR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQGKRFRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED T+ VTVN
Sbjct  61   QPLFNEDNTVAVTVN  75


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+TPLY+GWGLDGS+W +S
Sbjct  133  FIAARDAIGVTPLYIGWGLDGSIWISS  159



>gb|KDO66936.1| hypothetical protein CISIN_1g007799mg [Citrus sinensis]
Length=420

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSIWISS  159



>gb|KHG19876.1| Asparagine synthetase [glutamine-hydrolyzing] -like protein [Gossypium 
arboreum]
Length=561

 Score =   110 bits (276),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQ KR+R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLA++DP SGD
Sbjct  1    MCGILAVLGCSDDSQTKRARVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAVVDPNSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++ VTVN
Sbjct  61   QPLFNEDKSVAVTVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSIWVSS  159



>ref|XP_010535370.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Tarenaya 
hassleriana]
Length=578

 Score =   110 bits (276),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSG++  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGIYQSGDAYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+AARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  FMAARDAIGVTSLYIGWGLDGSVWISS  159



>ref|NP_001057340.1| Os06g0265000 [Oryza sativa Japonica Group]
 sp|Q43011.3|ASNS2_ORYSJ RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 2; 
AltName: Full=Glutamine-dependent asparagine synthetase 2 
[Oryza sativa Japonica Group]
 gb|AAB03991.1| asparagine synthetase [Oryza sativa Japonica Group]
 dbj|BAA18951.1| asparagine synthetase [Oryza sativa Japonica Group]
 dbj|BAD54377.1| asparagine synthetase [Oryza sativa Japonica Group]
 dbj|BAF19254.1| Os06g0265000 [Oryza sativa Japonica Group]
 dbj|BAG94512.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80360.1| hypothetical protein OsI_22459 [Oryza sativa Indica Group]
 gb|EEE65484.1| hypothetical protein OsJ_20899 [Oryza sativa Japonica Group]
 gb|AGT42317.1| asparagine synthetase [Oryza sativa Japonica Group]
Length=591

 Score =   110 bits (276),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGIHCYQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK++VVTVN
Sbjct  61   QPLYNEDKSVVVTVN  75


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>ref|XP_003615711.1| Asparagine synthetase [Medicago truncatula]
 gb|AES98669.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=584

 Score =   110 bits (276),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D ++AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDPTRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|NP_850664.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
 gb|AEE78265.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
Length=456

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSGL+  GD YLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  61   QPLFNEDKTIVVTVN  75



>ref|XP_008445536.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Cucumis melo]
 ref|XP_008445537.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Cucumis melo]
Length=587

 Score =   110 bits (275),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+   DCYL+HQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHKDCYLSHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+K+IVVTVN
Sbjct  61   QPLYNENKSIVVTVN  75


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+T LY+GWG DGSVW +S
Sbjct  133  FIAARDAIGVTSLYIGWGRDGSVWISS  159



>emb|CAA73763.1| asparagine synthetase 2 [Pisum sativum]
Length=84

 Score =   102 bits (255),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D S+AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDPSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVNVSL  427
            QPL+NED   +VTVN  L
Sbjct  61   QPLFNEDNPSIVTVNGEL  78



>gb|KEH34319.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=465

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>ref|XP_006425093.1| hypothetical protein CICLE_v10028078mg [Citrus clementina]
 gb|ESR38333.1| hypothetical protein CICLE_v10028078mg [Citrus clementina]
Length=493

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75



>gb|KDO66934.1| hypothetical protein CISIN_1g007799mg [Citrus sinensis]
 gb|KDO66935.1| hypothetical protein CISIN_1g007799mg [Citrus sinensis]
Length=493

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK IVVTVN
Sbjct  61   QPLYNEDKKIVVTVN  75


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSIWISS  159



>ref|XP_009150235.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Brassica rapa]
Length=608

 Score =   110 bits (274),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GCTD+SQAKR R++ELSRRLRHRGPDWSG++  GD YLAH+RLAI+DP SGD
Sbjct  23   MCGILAVLGCTDDSQAKRVRVLELSRRLRHRGPDWSGIYQHGDNYLAHERLAIVDPDSGD  82

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDKTIVVTVN
Sbjct  83   QPLFNEDKTIVVTVN  97


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  155  FMVARDAIGVTSLYIGWGLDGSVWISS  181



>ref|XP_009622719.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana 
tomentosiformis]
Length=590

 Score =   109 bits (273),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+ GC D+SQAKR R++ELSRRL+HRGPDWSG++  GD YLAHQRLAIIDPTSGD
Sbjct  1    MCGILALLGCPDDSQAKRVRVLELSRRLKHRGPDWSGIYQHGDFYLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+N+DKTIVVTVN
Sbjct  61   QPLFNQDKTIVVTVN  75


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+AARDAIGITPLY+GWGLDGSVW +S
Sbjct  133  FLAARDAIGITPLYIGWGLDGSVWISS  159



>gb|AAF02775.1|AF190728_1 asparagine synthetase [Helianthus annuus]
Length=591

 Score =   109 bits (273),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YL+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDNYLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED+TIVVTVN
Sbjct  61   QPLFNEDQTIVVTVN  75


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +IAARDAIGIT LY+GWGLDGSVW +S
Sbjct  135  YIAARDAIGITSLYIGWGLDGSVWISS  161



>gb|AAM94340.1| asparagine synthetase [Striga hermonthica]
Length=571

 Score =   109 bits (273),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G ++NSQAKRSRIIELSRRLRHRGPDWSGLH   +CYLAHQRLAIIDPTSGD
Sbjct  1    MCGILAVLGVSENSQAKRSRIIELSRRLRHRGPDWSGLHNHQNCYLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+KT+ VTVN
Sbjct  61   QPLYNEEKTVFVTVN  75


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGLDGS W AS
Sbjct  133  FIAARDAIGITPLYIGWGLDGSTWFAS  159



>ref|XP_006655987.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Oryza brachyantha]
Length=591

 Score =   109 bits (273),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFG  + S AKR+RIIELSRRLRHRGPDWSG+HC  DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVFGVAEVSLAKRARIIELSRRLRHRGPDWSGIHCYQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+K++VVTVN
Sbjct  61   QPLYNEEKSVVVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>gb|ABK26163.1| unknown [Picea sitchensis]
Length=155

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA  GC D SQAKR+RI+ELSRRLRHRGPDWSG+   G+C+LAHQRLAI+DPTSG+
Sbjct  1    MCGILAALGCIDVSQAKRARILELSRRLRHRGPDWSGISHHGNCFLAHQRLAIVDPTSGN  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+TIVVTVN
Sbjct  61   QPLYNEDRTIVVTVN  75



>sp|P49093.2|ASNS2_LOTJA RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 2; 
AltName: Full=Glutamine-dependent asparagine synthetase 2 
[Lotus japonicus]
 emb|CAA61590.1| asparagine synthase (glutamine-hydrolysing) [Lotus japonicus]
Length=586

 Score =   109 bits (272),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGLH  GD +LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLHQHGDNFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED++I+VTVN
Sbjct  61   QPLFNEDQSIIVTVN  75


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+G+GLDGSVW AS
Sbjct  133  FLVARDAIGVTSLYIGYGLDGSVWIAS  159



>dbj|BAA96252.1| asparagine synthetase [Astragalus sinicus]
Length=586

 Score =   109 bits (272),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGLH  GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLHQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+N++K+I+VTVN
Sbjct  61   QPLFNQEKSIIVTVN  75


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FLVARDAIGVTSLYIGWGLDGSVWIAS  159



>gb|ACJ83289.1| unknown [Medicago truncatula]
Length=210

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR RI+ELSRRL+HRGPDWSGL   GD YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRILELSRRLKHRGPDWSGLRQHGDNYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+I+VTVN
Sbjct  61   QPLFNEDKSIIVTVN  75


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW AS
Sbjct  133  FIVARDAIGVTSLYIGWGLDGSVWIAS  159



>ref|XP_009766230.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana 
sylvestris]
Length=590

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+ GC+D+SQAKR R++ELSRRL+HRGPDWSG++  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILALLGCSDDSQAKRVRVLELSRRLKHRGPDWSGIYQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+N+DKTIVVTVN
Sbjct  61   QPLFNQDKTIVVTVN  75


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
              F+AARDAIGITPLY+GWGLDGSVW +S
Sbjct  131  NSFLAARDAIGITPLYIGWGLDGSVWISS  159



>gb|KHN46143.1| Asparagine synthetase, root [glutamine-hydrolyzing] [Glycine 
soja]
Length=582

 Score =   108 bits (270),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhr-GPDWSGLHCQGDCYLAHQRLAIIDPTSG  370
            MCGILAV GC+D+S+AKR R++ELSRR     GPDWSGLH  GDC+LAHQRLAI+DP SG
Sbjct  1    MCGILAVLGCSDDSRAKRVRVLELSRRQLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASG  60

Query  371  DQPLYNEDKTIVVTVN  418
            DQPL+NEDK+++VTVN
Sbjct  61   DQPLFNEDKSVIVTVN  76


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  134  FIVARDAIGVTSLYIGWGLDGSVWISS  160



>gb|KHN40086.1| Asparagine synthetase [glutamine-hydrolyzing] 1 [Glycine soja]
Length=582

 Score =   108 bits (270),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhr-GPDWSGLHCQGDCYLAHQRLAIIDPTSG  370
            MCGILAV GC+D+S+AKR R++ELSRR     GPDWSGLH  GDC+LAHQRLAI+DP SG
Sbjct  1    MCGILAVLGCSDDSRAKRVRVLELSRRQLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASG  60

Query  371  DQPLYNEDKTIVVTVN  418
            DQPL+NEDK+++VTVN
Sbjct  61   DQPLFNEDKSVIVTVN  76


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  134  FIVARDAIGVTSLYIGWGLDGSVWISS  160



>gb|EPS71106.1| asparagine synthetase, partial [Genlisea aurea]
Length=553

 Score =   108 bits (270),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  DN+  KRSRIIELS R+RHRGPDWSGLH   +CYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGIADNADVKRSRIIELSERMRHRGPDWSGLHHHENCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGLDGS W AS
Sbjct  133  FIAARDAIGITPLYIGWGLDGSTWFAS  159



>gb|AAL91002.1| asparagine synthetase [Securigera parviflora]
Length=583

 Score =   108 bits (270),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV  C +NSQAKR R++ELSRRL+HRGPDWSGLH  GDCYLAHQRLAI+DP SGD
Sbjct  1    MCGILAVL-CAENSQAKRVRVLELSRRLKHRGPDWSGLHQHGDCYLAHQRLAIVDPASGD  59

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  60   QPLFNEDKSLIVTVN  74


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  132  FIVARDAIGVTSLYIGWGLDGSVWISS  158



>ref|XP_003579059.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Brachypodium distachyon]
Length=585

 Score =   108 bits (270),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D++Q KR+ ++ELSRRL+HRGPDWSG+H   DCYL+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCADDTQGKRAHVLELSRRLKHRGPDWSGMHQVDDCYLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK++ VTVN
Sbjct  61   QPLYNEDKSVAVTVN  75


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIG+TPLY+GWG+DGSVW +S
Sbjct  131  RSFIAARDAIGVTPLYIGWGIDGSVWISS  159



>gb|AAF74755.1| asparagine synthetase [Helianthus annuus]
Length=589

 Score =   108 bits (270),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+ GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YL+HQRLA+IDP SGD
Sbjct  1    MCGILALLGCSDDSQAKRFRVLELSRRLKHRGPDWSGLYQHGDNYLSHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+T+VVTVN
Sbjct  61   QPLYNEDETVVVTVN  75



>gb|KJB83674.1| hypothetical protein B456_013G259500 [Gossypium raimondii]
 gb|KJB83675.1| hypothetical protein B456_013G259500 [Gossypium raimondii]
Length=583

 Score =   108 bits (269),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSD-SQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAIIDPASGD  59

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++ VTVN
Sbjct  60   QPLFNEDKSVAVTVN  74


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+T LY+GWGLDGSVW AS
Sbjct  132  YIVARDAIGVTSLYIGWGLDGSVWIAS  158



>gb|ACJ85706.1| unknown [Medicago truncatula]
Length=385

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D ++AKR R++ELSRRL+HRGPDWSGLH  GDC+LAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDPTRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+++VTVN
Sbjct  61   QPLFNEDKSVIVTVN  75



>gb|KHN05227.1| Asparagine synthetase [glutamine-hydrolyzing] 2 [Glycine soja]
 gb|KHN19843.1| Asparagine synthetase [glutamine-hydrolyzing] 2 [Glycine soja]
Length=580

 Score =   108 bits (269),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhr-GPDWSGLHCQGDCYLAHQRLAIIDPTSG  370
            MCGILAV GC+D+SQAKR R++ELSRR     GPDWSGLH  GD YLAHQRLAI+DP SG
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRQLKHRGPDWSGLHQYGDNYLAHQRLAIVDPASG  60

Query  371  DQPLYNEDKTIVVTVN  418
            DQPL+NEDKT+VVTVN
Sbjct  61   DQPLFNEDKTVVVTVN  76


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  134  FIVARDAIGVTSLYIGWGLDGSVWISS  160



>gb|ADK13052.1| asparagine synthetase [Pinus pinaster]
Length=590

 Score =   108 bits (269),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA  GC D SQAKR+RI+ELSRRLRHRGPDWSG+   G+C+LAHQRLAI+DPTSG+
Sbjct  1    MCGILAALGCIDVSQAKRARILELSRRLRHRGPDWSGISHHGNCFLAHQRLAIVDPTSGN  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY GWG+DGS+W AS
Sbjct  133  FIAARDAIGITPLYTGWGIDGSIWFAS  159



>gb|KGN47585.1| hypothetical protein Csa_6G362920 [Cucumis sativus]
Length=536

 Score =   107 bits (267),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+ +SQAKR R++ELSRRL+HRGPDWSGL+   DCYL+HQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSVDSQAKRVRVLELSRRLKHRGPDWSGLYQHADCYLSHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNE+K+IVVTVN
Sbjct  61   QPLYNENKSIVVTVN  75


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+T LY+GWG DGSVW +S
Sbjct  133  FIAARDAIGVTSLYIGWGRDGSVWISS  159



>ref|XP_011024933.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 isoform 
X1 [Populus euphratica]
 ref|XP_011024934.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 isoform 
X2 [Populus euphratica]
Length=587

 Score =   107 bits (268),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL   GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLFQHGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED+ IVVTVN
Sbjct  61   QPLFNEDQAIVVTVN  75


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSVWISS  159



>ref|XP_010102790.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
 gb|EXB94103.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
Length=577

 Score =   107 bits (268),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 56/75 (75%), Gaps = 9/75 (12%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQ KR +           GPDWSGL+  GDCYLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQGKRLKHR---------GPDWSGLYQHGDCYLAHQRLAIIDPASGD  51

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED T+ VTVN
Sbjct  52   QPLFNEDNTVAVTVN  66


 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+TPLY+GWGLDGS+W +S
Sbjct  124  FIAARDAIGVTPLYIGWGLDGSIWISS  150



>ref|XP_011003961.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Populus euphratica]
Length=589

 Score =   107 bits (268),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQCGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED+ IVVTVN
Sbjct  61   QPLFNEDQAIVVTVN  75


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGITPLY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGITPLYIGWGLDGSVWISS  159



>ref|XP_002313246.2| asparagine synthetase family protein [Populus trichocarpa]
 gb|EEE87201.2| asparagine synthetase family protein [Populus trichocarpa]
Length=589

 Score =   107 bits (268),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+  GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQCGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED+ IVVTVN
Sbjct  61   QPLFNEDQAIVVTVN  75


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGITPLY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGITPLYIGWGLDGSVWISS  159



>ref|XP_011097578.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Sesamum 
indicum]
Length=568

 Score =   107 bits (267),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  DN Q KR RIIELSRRLRHRGPDWSGLH   +CYLAH+RLAI+DP SGD
Sbjct  1    MCGILAVLGIADNPQGKRPRIIELSRRLRHRGPDWSGLHHHNNCYLAHERLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY+GWGLDGS+W AS
Sbjct  133  FIAARDAIGITPLYIGWGLDGSIWFAS  159



>gb|ABR16560.1| unknown [Picea sitchensis]
Length=590

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA  GC D SQAKR+RI+ELSRRLRHRGPDWSG+   G+C+LAHQRLAI+DPTSG+
Sbjct  1    MCGILAALGCIDVSQAKRARILELSRRLRHRGPDWSGISHHGNCFLAHQRLAIVDPTSGN  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+TIVVTVN
Sbjct  61   QPLYNEDRTIVVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY GWGLDGS+W AS
Sbjct  133  FIAARDAIGITPLYTGWGLDGSIWFAS  159



>gb|KJB55713.1| hypothetical protein B456_009G0905002, partial [Gossypium raimondii]
Length=248

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRL+HRGPDWSGL+   D YLAHQRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLKHRGPDWSGLYQHRDSYLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK++ VTVN
Sbjct  61   QPLFNEDKSVAVTVN  75


 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
              FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  131  NSFIVARDAIGVTSLYIGWGLDGSVWISS  159



>emb|CDY51796.1| BnaC03g75390D [Brassica napus]
Length=225

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R       LRHRGPDWSG++  G  YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRTQTKKVILRHRGPDWSGIYQNGFNYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75



>gb|ABR16980.1| unknown [Picea sitchensis]
Length=591

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D SQAKR+R++ELSRRLRHRGPDWSGL+  G  +LAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCLDTSQAKRARVLELSRRLRHRGPDWSGLYHSGHSFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+ IVVTVN
Sbjct  61   QPLYNEDRQIVVTVN  75


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            Q FIAARDA GIT LY+GWGLDGSVW AS
Sbjct  131  QSFIAARDAFGITSLYIGWGLDGSVWFAS  159



>ref|XP_003568184.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Brachypodium 
distachyon]
Length=591

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSG+H   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGIHTYQDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK++VVTVN
Sbjct  61   QPLYNEDKSVVVTVN  75


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>dbj|BAB17726.1| asparagine synthetase [Raphanus sativus]
Length=585

 Score =   106 bits (265),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSG++  G  YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGIYQNGGNYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGS+W +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSLWVSS  159



>gb|AFZ85291.1| asparagine synthetase [Secale cereale x Triticum turgidum subsp. 
durum]
Length=587

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSG+H   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVGDVSLAKRSRIIELSRRLRHRGPDWSGIHSFEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>gb|EMT24348.1| Asparagine synthetase (glutamine-hydrolyzing) [Aegilops tauschii]
Length=588

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSG+H   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVGDVSLAKRSRIIELSRRLRHRGPDWSGIHSFEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75



>gb|EMT31774.1| Asparagine synthetase (glutamine-hydrolyzing) [Aegilops tauschii]
Length=589

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSG+H   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVGDVSLAKRSRIIELSRRLRHRGPDWSGIHSFEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSVWFSS  159



>dbj|BAK06280.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95102.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSG+H   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVGDVSLAKRSRIIELSRRLRHRGPDWSGIHSFEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT+VVTVN
Sbjct  61   QPLYNEDKTVVVTVN  75


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGSVW +S
Sbjct  131  KTFIAARDAIGICPLYMGWGLDGSVWFSS  159



>emb|CDX99060.1| BnaA06g17510D [Brassica napus]
Length=585

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R       LRHRGPDWSG++  G  YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRTQTKKVILRHRGPDWSGIYQNGFNYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGS+W +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSLWVSS  159



>emb|CAD43058.1| putative asparagine synthetase [Pinus sylvestris]
Length=593

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D SQAKR R++ELSRRLRHRGPDWSGL+  G  +LAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCLDASQAKRVRVLELSRRLRHRGPDWSGLYQSGHSFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+ IVVTVN
Sbjct  61   QPLYNEDRQIVVTVN  75


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            Q FIAARDA GITPLY+GWG DGSVW AS
Sbjct  131  QSFIAARDAFGITPLYIGWGFDGSVWFAS  159



>gb|ADU02856.1| asparagine synthetase [Pinus pinaster]
Length=593

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAVFGC D SQAKR R++ELSRRLRHRGPDWSGL+  G  +LAHQRLAI+DP SGD
Sbjct  1    MCGILAVFGCLDASQAKRVRVLELSRRLRHRGPDWSGLYQSGHSFLAHQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNED+ IVVTVN
Sbjct  61   QPLYNEDRQIVVTVN  75


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            Q FIAARDA GITPLY+GWG DGSVW AS
Sbjct  131  QSFIAARDAFGITPLYIGWGFDGSVWFAS  159



>gb|KCW85423.1| hypothetical protein EUGRSUZ_B02239 [Eucalyptus grandis]
Length=674

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 70/130 (54%), Positives = 83/130 (64%), Gaps = 14/130 (11%)
 Frame = +2

Query  29   AHSGRLSSQQPPASTSISFQPISSLP*VLFRQHIDTHVQIT*eregererergAAMCGIL  208
            A S  L++   P+S  +SF+   S     FR H    +               A MCGIL
Sbjct  45   APSRHLAAPNLPSSEVLSFRSPPSAASFFFRPHPRPSL--------------VARMCGIL  90

Query  209  AVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGDQPLYN  388
            AV G   +SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLA+IDP SGDQPL N
Sbjct  91   AVLGFAGDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAVIDPASGDQPLLN  150

Query  389  EDKTIVVTVN  418
            ED T+VVTVN
Sbjct  151  EDGTVVVTVN  160


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  218  FIVARDAIGITSLYIGWGLDGSVWISS  244



>dbj|BAJ84981.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G  D S AKRSRIIELSRRLRHRGPDWSG+H   DCYLAHQRLAI+DPTSGD
Sbjct  1    MCGILAVLGVGDVSLAKRSRIIELSRRLRHRGPDWSGIHSFEDCYLAHQRLAIVDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKT++VTVN
Sbjct  61   QPLYNEDKTVIVTVN  75


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            + FIAARDAIGI PLYMGWGLDGS+W +S
Sbjct  131  KSFIAARDAIGICPLYMGWGLDGSIWFSS  159



>ref|XP_006344055.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Solanum 
tuberosum]
Length=590

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+ GC+D+SQAKR R++ELSRRL+HRGPDWSG+   GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILALLGCSDDSQAKRVRVLELSRRLKHRGPDWSGIFQYGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK IVVTVN
Sbjct  61   QPLFNEDKKIVVTVN  75


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
              F+AARDAIGITPLY+GWGLDGSVW +S
Sbjct  131  NSFLAARDAIGITPLYIGWGLDGSVWISS  159



>ref|XP_004240406.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Solanum 
lycopersicum]
Length=590

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+ GC+D+SQAKR R++ELSRRL+HRGPDWSG+   GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILALLGCSDDSQAKRVRVLELSRRLKHRGPDWSGIFQYGDFYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK IVVTVN
Sbjct  61   QPLFNEDKKIVVTVN  75


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
              F+AARDAIGITPLY+GWGLDGSVW +S
Sbjct  131  NSFLAARDAIGITPLYIGWGLDGSVWISS  159



>ref|XP_009149924.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Brassica 
rapa]
Length=585

 Score =   105 bits (263),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSG++  G  YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGIYQNGFNYLAHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGS+W +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSLWVSS  159



>sp|P49091.2|ASNS_BRAOL RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase [Brassica 
oleracea]
 emb|CAA59138.1| asparagine synthase (glutamine-hydrolysing) [Brassica oleracea]
Length=586

 Score =   105 bits (262),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR R++ELSRRLRHRGPDWSG++  G  YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGIYQNGFNYLAHQRLAIIDPDSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK+IVVTVN
Sbjct  61   QPLFNEDKSIVVTVN  75


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDA+G+T LY+GWGLDGS+W +S
Sbjct  133  FMVARDAVGVTSLYIGWGLDGSLWVSS  159



>ref|XP_002299991.2| asparagine synthetase family protein [Populus trichocarpa]
 gb|EEE84796.2| asparagine synthetase family protein [Populus trichocarpa]
Length=578

 Score =   104 bits (259),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 9/75 (12%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D+SQAKR +           GPDWSGL   GD YLAHQRLAIIDP SGD
Sbjct  1    MCGILAVLGCSDDSQAKRLKHR---------GPDWSGLFQHGDFYLAHQRLAIIDPASGD  51

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED+ IVVTVN
Sbjct  52   QPLFNEDQAIVVTVN  66


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  124  FIVARDAIGITSLYIGWGLDGSVWISS  150



>emb|CDY21785.1| BnaA06g20540D [Brassica napus]
Length=591

 Score =   104 bits (259),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 6/81 (7%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriiels------rrlrhrGPDWSGLHCQGDCYLAHQRLAII  355
            MCGILAV GCTD+SQAKR R++ELS        LRHRGPDWSG++  GD YLAH+RLAI+
Sbjct  1    MCGILAVLGCTDDSQAKRVRVLELSRRQFFFSLLRHRGPDWSGIYQHGDNYLAHERLAIV  60

Query  356  DPTSGDQPLYNEDKTIVVTVN  418
            DP SGDQPL+NEDKTIVVTVN
Sbjct  61   DPDSGDQPLFNEDKTIVVTVN  81


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  139  FMVARDAIGVTSLYIGWGLDGSVWISS  165



>gb|KHN02080.1| Asparagine synthetase [glutamine-hydrolyzing] 2 [Glycine soja]
Length=592

 Score =   103 bits (258),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 63/88 (72%), Gaps = 13/88 (15%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAK-------------rsriielsrrlrhrGPDWSGLHCQGDCYLA  334
            MCGILAV GC+D+SQAK                ++  +  L+HRGPDWSGLH  GD YLA
Sbjct  1    MCGILAVLGCSDSSQAKRVRVLELSRRQCFSLCLLIYTHTLKHRGPDWSGLHQYGDNYLA  60

Query  335  HQRLAIIDPTSGDQPLYNEDKTIVVTVN  418
            HQRLAI+DP SGDQPL+NEDKT+VVTVN
Sbjct  61   HQRLAIVDPASGDQPLFNEDKTVVVTVN  88


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIG+T LY+GWGLDGSVW +S
Sbjct  146  FIVARDAIGVTSLYIGWGLDGSVWISS  172



>sp|P19252.3|ASNS2_PEA RecName: Full=Asparagine synthetase, root [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase 
[Pisum sativum]
 emb|CAA36430.1| unnamed protein product [Pisum sativum]
Length=583

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC+D S+AKR R++ELSRRL+HRGP+WSGLH  GDCYLA QRLAI+DP SGD
Sbjct  1    MCGILAVLGCSDPSRAKRVRVLELSRRLKHRGPEWSGLHQHGDCYLAQQRLAIVDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED   +VTVN
Sbjct  61   QPLFNEDNPSIVTVN  75


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            +I ARDAIG+T LY+GWGLDGSVW +S
Sbjct  133  YIVARDAIGVTSLYIGWGLDGSVWISS  159



>ref|XP_010043416.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Eucalyptus 
grandis]
Length=589

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G   +SQAKR R++ELSRRL+HRGPDWSGL+  GDCYLAHQRLA+IDP SGD
Sbjct  1    MCGILAVLGFAGDSQAKRVRVLELSRRLKHRGPDWSGLYQHGDCYLAHQRLAVIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL NED T+VVTVN
Sbjct  61   QPLLNEDGTVVVTVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  133  FIVARDAIGITSLYIGWGLDGSVWISS  159



>ref|XP_010264605.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Nelumbo 
nucifera]
Length=589

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV G +D+SQAKR R++ELSRRL+HRGPDWSG++  G  +LAHQRLAIIDPTSGD
Sbjct  1    MCGILAVLGSSDDSQAKRVRVLELSRRLKHRGPDWSGIYQHGGNFLAHQRLAIIDPTSGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NEDK IVVTVN
Sbjct  61   QPLFNEDKKIVVTVN  75


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  415  QCFIAARDAIGITPLYMGWGLDGSVWXAS  501
              FI ARDAIGIT LY+GWGLDGS+W +S
Sbjct  131  NSFIVARDAIGITSLYIGWGLDGSIWVSS  159



>gb|AHA44834.1| asparagine synthetase [Larix kaempferi]
Length=589

 Score =   102 bits (254),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA  GC D SQ KR+RI+ELSRRLRHRGPDWSG+   G+ +LAHQRLAI+DPTSG+
Sbjct  1    MCGILAALGCIDVSQTKRARILELSRRLRHRGPDWSGISHHGNSFLAHQRLAIVDPTSGN  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTIVVTVN
Sbjct  61   QPLYNEDKTIVVTVN  75


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIGITPLY GWGLDGS+W AS
Sbjct  133  FIAARDAIGITPLYTGWGLDGSIWFAS  159



>dbj|BAJ88564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   102 bits (253),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D SQ KR  ++ELSRRL+HRGPDWSGLH   D YL HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCGDESQGKRVHVLELSRRLKHRGPDWSGLHQVADNYLCHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK++ V VN
Sbjct  61   QPLYNEDKSVAVAVN  75


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+T LY+GWG+DGSVW +S
Sbjct  133  FIAARDAIGVTSLYIGWGIDGSVWISS  159



>dbj|BAJ87368.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   102 bits (253),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D SQ KR  ++ELSRRL+HRGPDWSGLH   D YL HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCGDESQGKRVHVLELSRRLKHRGPDWSGLHQVADNYLCHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK++ V VN
Sbjct  61   QPLYNEDKSVAVAVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+T LY+GWG+DGSVW +S
Sbjct  133  FIAARDAIGVTSLYIGWGIDGSVWISS  159



>gb|AAO39048.1| asparagine synthetase 2 [Hordeum vulgare]
Length=581

 Score =   102 bits (253),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC D SQ KR  ++ELSRRL+HRGPDWSGLH   D YL HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCGDESQGKRVHVLELSRRLKHRGPDWSGLHQVADNYLCHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDK++ V VN
Sbjct  61   QPLYNEDKSVAVAVN  75


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FIAARDAIG+T LY+GWG+DGSVW +S
Sbjct  133  FIAARDAIGVTSLYIGWGIDGSVWISS  159



>emb|CDX77846.1| BnaC03g53730D [Brassica napus]
Length=592

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 6/81 (7%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriiels------rrlrhrGPDWSGLHCQGDCYLAHQRLAII  355
            MCGILAV GCTD+SQAKR R++ELS        LRHRGPDWSG++   D YLAH+RLAI+
Sbjct  1    MCGILAVLGCTDDSQAKRVRVLELSRRQFFFSLLRHRGPDWSGIYQHEDNYLAHERLAIV  60

Query  356  DPTSGDQPLYNEDKTIVVTVN  418
            DP SGDQPL+NEDKTIVVTVN
Sbjct  61   DPDSGDQPLFNEDKTIVVTVN  81


 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+ ARDAIG+T LY+GWGLDGSVW +S
Sbjct  139  FMVARDAIGVTSLYIGWGLDGSVWISS  165



>tpg|DAA59148.1| TPA: hypothetical protein ZEAMMB73_422165 [Zea mays]
Length=615

 Score =   100 bits (249),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +2

Query  191  AMCGILAVFGCTDNSQ--AKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPT  364
            +MCGILAV GC D ++  +KRSR++ELSRRL+HRGPDWSGL   GDCYL+HQRLAIIDP 
Sbjct  9    SMCGILAVLGCADEAKGSSKRSRVLELSRRLKHRGPDWSGLRQVGDCYLSHQRLAIIDPA  68

Query  365  SGDQPLYNEDKTIVVTVN  418
            SGDQPLYNED+++VV VN
Sbjct  69   SGDQPLYNEDQSVVVAVN  86


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+AARDAIG+TPLY+GWG+DGSVW +S
Sbjct  152  FMAARDAIGVTPLYIGWGVDGSVWISS  178



>ref|XP_004962101.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Setaria italica]
Length=606

 Score =   100 bits (248),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 3/78 (4%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQ---AKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPT  364
            MCGILAV GC D +     KR+R++ELSRRL+HRGPDWSGL   GDCYL+HQRLAIIDP 
Sbjct  1    MCGILAVLGCADEASLQGKKRARVLELSRRLKHRGPDWSGLRQVGDCYLSHQRLAIIDPA  60

Query  365  SGDQPLYNEDKTIVVTVN  418
            SGDQPLYNED+++VVTVN
Sbjct  61   SGDQPLYNEDESVVVTVN  78


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 1/31 (3%)
 Frame = +1

Query  409  HGQCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            HG+ F+AARDAIG+TPLY+GWG+DGSVW +S
Sbjct  135  HGR-FMAARDAIGVTPLYIGWGIDGSVWISS  164



>ref|NP_001241726.1| asparagine synthetase [Zea mays]
 gb|ACG25442.1| asparagine synthetase [Zea mays]
Length=604

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQ--AKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTS  367
            MCGILAV GC D ++  +KRSR++ELSRRL+HRGPDWSGL   GDCYL+HQRLAIIDP S
Sbjct  1    MCGILAVLGCADEAKGSSKRSRVLELSRRLKHRGPDWSGLRQVGDCYLSHQRLAIIDPAS  60

Query  368  GDQPLYNEDKTIVVTVN  418
            GDQPLYNED+++VV VN
Sbjct  61   GDQPLYNEDQSVVVAVN  77


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+AARDAIG+TPLY+GWG+DGSVW +S
Sbjct  143  FMAARDAIGVTPLYIGWGVDGSVWISS  169



>ref|NP_001131013.1| asparagine synthetase2 [Zea mays]
 emb|CAR70073.1| asparagine synthetase [Zea mays]
 emb|CAR82079.1| asparagine synthetase [Zea mays]
 gb|ACN28039.1| unknown [Zea mays]
 gb|ACN28874.1| unknown [Zea mays]
 gb|ACR34235.1| unknown [Zea mays]
 tpg|DAA59147.1| TPA: asparagine synthetase [Zea mays]
Length=606

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQ--AKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTS  367
            MCGILAV GC D ++  +KRSR++ELSRRL+HRGPDWSGL   GDCYL+HQRLAIIDP S
Sbjct  1    MCGILAVLGCADEAKGSSKRSRVLELSRRLKHRGPDWSGLRQVGDCYLSHQRLAIIDPAS  60

Query  368  GDQPLYNEDKTIVVTVN  418
            GDQPLYNED+++VV VN
Sbjct  61   GDQPLYNEDQSVVVAVN  77


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            F+AARDAIG+TPLY+GWG+DGSVW +S
Sbjct  143  FMAARDAIGVTPLYIGWGVDGSVWISS  169



>emb|CDP09210.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 59/92 (64%), Positives = 66/92 (72%), Gaps = 17/92 (18%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriiels-----------------rrlrhrGPDWSGLHCQGD  322
            MCGILAV GC+D+SQAKR R++ELS                   L+HRGPDWSGL+  GD
Sbjct  1    MCGILAVLGCSDDSQAKRVRVLELSRRQFFILFFFFYFPPLILTLKHRGPDWSGLYQHGD  60

Query  323  CYLAHQRLAIIDPTSGDQPLYNEDKTIVVTVN  418
             YLAHQRLAIIDP SGDQPL+NEDK IVVTVN
Sbjct  61   FYLAHQRLAIIDPASGDQPLFNEDKRIVVTVN  92


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  421  FIAARDAIGITPLYMGWGLDGSVWXAS  501
            FI ARDAIGIT LY+GWGLDGSVW +S
Sbjct  150  FIVARDAIGITSLYIGWGLDGSVWISS  176



>ref|XP_006843600.1| hypothetical protein AMTR_s00007p00134530 [Amborella trichopoda]
 gb|ERN05275.1| hypothetical protein AMTR_s00007p00134530 [Amborella trichopoda]
Length=590

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV GC + SQAKR R++ELSRRL+HRGPDWSG++ +   YL+HQRLAIIDP SGD
Sbjct  1    MCGILAVLGCIEGSQAKRVRVLELSRRLKHRGPDWSGIYQKAGFYLSHQRLAIIDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED++IVVTVN
Sbjct  61   QPLFNEDRSIVVTVN  75


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  409  HGQCFIAARDAIGITPLYMGWGLDGSVWXAS  501
            H   FI ARDAIGIT LY+GWG DGSVW +S
Sbjct  129  HDNSFIVARDAIGITSLYIGWGFDGSVWVSS  159



>emb|CBU30418.1| asparagine synthase [Polytomella sp. Pringsheim 198.80]
Length=566

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILA+   TD+S A R++++ LSRR RHRGPDWSGLH  G+ +LAH+RLAI+DP SGD
Sbjct  1    MCGILAILNSTDDSAAMRAKVLALSRRQRHRGPDWSGLHQTGNHFLAHERLAIMDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPLYNEDKTI+VTVN
Sbjct  61   QPLYNEDKTIIVTVN  75



>ref|XP_001702113.1| asparagine synthase [Chlamydomonas reinhardtii]
 gb|EDO97202.1| asparagine synthase [Chlamydomonas reinhardtii]
Length=578

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  194  MCGILAVFGCTDNSQAKrsriielsrrlrhrGPDWSGLHCQGDCYLAHQRLAIIDPTSGD  373
            MCGILAV   TD+SQA RSR++ LSRR RHRGPDWSG+H  G+ +LAH+RLAI+DP SGD
Sbjct  1    MCGILAVLNTTDDSQAMRSRVLALSRRQRHRGPDWSGMHQFGNNFLAHERLAIMDPASGD  60

Query  374  QPLYNEDKTIVVTVN  418
            QPL+NED+TIVVTVN
Sbjct  61   QPLFNEDRTIVVTVN  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300