BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF013B02

Length=498
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006358558.1|  PREDICTED: putative RNA polymerase II subuni...    118   2e-27   Solanum tuberosum [potatoes]
ref|XP_004230345.1|  PREDICTED: putative RNA polymerase II subuni...    115   1e-26   
ref|XP_009629199.1|  PREDICTED: putative RNA polymerase II subuni...    114   2e-26   Nicotiana tomentosiformis
ref|XP_009629198.1|  PREDICTED: putative RNA polymerase II subuni...    115   2e-26   
ref|XP_009629188.1|  PREDICTED: putative RNA polymerase II subuni...    115   2e-26   Nicotiana tomentosiformis
ref|XP_011087531.1|  PREDICTED: putative RNA polymerase II subuni...    114   4e-26   Sesamum indicum [beniseed]
ref|XP_011087530.1|  PREDICTED: putative RNA polymerase II subuni...    114   5e-26   Sesamum indicum [beniseed]
ref|XP_011087529.1|  PREDICTED: putative RNA polymerase II subuni...    114   5e-26   Sesamum indicum [beniseed]
ref|XP_009602823.1|  PREDICTED: putative RNA polymerase II subuni...    111   2e-25   Nicotiana tomentosiformis
ref|XP_009629194.1|  PREDICTED: putative RNA polymerase II subuni...    111   4e-25   Nicotiana tomentosiformis
ref|XP_009602820.1|  PREDICTED: putative RNA polymerase II subuni...    111   4e-25   Nicotiana tomentosiformis
emb|CAN62034.1|  hypothetical protein VITISV_014731                     107   1e-23   Vitis vinifera
ref|XP_002280625.1|  PREDICTED: putative RNA polymerase II subuni...    107   1e-23   Vitis vinifera
ref|XP_009771014.1|  PREDICTED: putative RNA polymerase II subuni...    106   3e-23   Nicotiana sylvestris
ref|XP_009771016.1|  PREDICTED: putative RNA polymerase II subuni...    105   3e-23   Nicotiana sylvestris
ref|XP_002321396.2|  hypothetical protein POPTR_0015s01330g             105   9e-23   
ref|XP_003519102.1|  PREDICTED: putative RNA polymerase II subuni...    103   3e-22   Glycine max [soybeans]
gb|KHN23219.1|  Putative RNA polymerase II subunit B1 CTD phospha...    103   3e-22   Glycine soja [wild soybean]
ref|XP_006575272.1|  PREDICTED: putative RNA polymerase II subuni...    103   4e-22   Glycine max [soybeans]
ref|XP_011044667.1|  PREDICTED: putative RNA polymerase II subuni...    103   4e-22   Populus euphratica
ref|XP_011044665.1|  PREDICTED: putative RNA polymerase II subuni...    103   4e-22   Populus euphratica
ref|XP_002521936.1|  conserved hypothetical protein                     102   4e-22   Ricinus communis
ref|XP_007016928.1|  F2P16.20-like protein isoform 3                    103   4e-22   
ref|XP_007016931.1|  F2P16.20-like protein isoform 6                    102   5e-22   
ref|XP_010674526.1|  PREDICTED: putative RNA polymerase II subuni...    102   8e-22   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP15205.1|  unnamed protein product                                102   9e-22   Coffea canephora [robusta coffee]
ref|XP_007016926.1|  F2P16.20 protein, putative isoform 1               101   1e-21   
ref|XP_003537129.1|  PREDICTED: putative RNA polymerase II subuni...    101   2e-21   Glycine max [soybeans]
ref|XP_007016930.1|  F2P16.20-like protein isoform 5                    101   2e-21   
ref|XP_007016927.1|  F2P16.20-like protein isoform 2                    101   2e-21   
ref|XP_007145767.1|  hypothetical protein PHAVU_007G265900g             100   3e-21   Phaseolus vulgaris [French bean]
gb|KDP37902.1|  hypothetical protein JCGZ_05341                         100   4e-21   Jatropha curcas
ref|XP_008454119.1|  PREDICTED: putative RNA polymerase II subuni...  99.4    7e-21   Cucumis melo [Oriental melon]
ref|XP_007016929.1|  F2P16.20 protein, putative isoform 4             98.6    1e-20   
ref|XP_002874325.1|  hypothetical protein ARALYDRAFT_326902           99.0    2e-20   
gb|KEH41826.1|  RNA polymerase II subunit B1 CTD phosphatase RPAP...  97.1    5e-20   Medicago truncatula
gb|EYU19406.1|  hypothetical protein MIMGU_mgv1a003240mg              95.9    1e-19   Erythranthe guttata [common monkey flower]
gb|KJB31664.1|  hypothetical protein B456_005G200700                  95.9    1e-19   Gossypium raimondii
ref|XP_004152151.1|  PREDICTED: putative RNA polymerase II subuni...  95.5    1e-19   Cucumis sativus [cucumbers]
ref|XP_004157008.1|  PREDICTED: putative RNA polymerase II subuni...  95.5    2e-19   
gb|KHG00855.1|  hypothetical protein F383_23706                       95.5    2e-19   Gossypium arboreum [tree cotton]
ref|XP_010421540.1|  PREDICTED: putative RNA polymerase II subuni...  95.5    2e-19   Camelina sativa [gold-of-pleasure]
gb|KHG00854.1|  hypothetical protein F383_23706                       95.1    2e-19   Gossypium arboreum [tree cotton]
ref|XP_006290171.1|  hypothetical protein CARUB_v10003849mg           95.1    3e-19   
ref|XP_010551019.1|  PREDICTED: putative RNA polymerase II subuni...  94.4    6e-19   Tarenaya hassleriana [spider flower]
ref|XP_010493937.1|  PREDICTED: putative RNA polymerase II subuni...  94.4    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010456737.1|  PREDICTED: putative RNA polymerase II subuni...  93.6    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007208433.1|  hypothetical protein PRUPE_ppa002134mg           93.2    1e-18   Prunus persica
gb|KFK26439.1|  hypothetical protein AALP_AA8G248600                  92.8    2e-18   Arabis alpina [alpine rockcress]
ref|XP_004497627.1|  PREDICTED: putative RNA polymerase II subuni...  92.0    2e-18   Cicer arietinum [garbanzo]
ref|XP_006841578.1|  hypothetical protein AMTR_s00003p00194360        91.7    3e-18   Amborella trichopoda
ref|XP_006394906.1|  hypothetical protein EUTSA_v10003721mg           91.7    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010097327.1|  hypothetical protein L484_006008                 91.7    4e-18   Morus notabilis
ref|XP_008246291.1|  PREDICTED: putative RNA polymerase II subuni...  91.3    6e-18   Prunus mume [ume]
gb|KHG28494.1|  hypothetical protein F383_15905                       85.5    1e-17   Gossypium arboreum [tree cotton]
ref|XP_010271590.1|  PREDICTED: putative RNA polymerase II subuni...  90.1    1e-17   Nelumbo nucifera [Indian lotus]
gb|ABR17753.1|  unknown                                               89.4    2e-17   Picea sitchensis
ref|XP_006480289.1|  PREDICTED: putative RNA polymerase II subuni...  89.4    3e-17   Citrus sinensis [apfelsine]
gb|EPS64466.1|  hypothetical protein M569_10314                       89.0    3e-17   Genlisea aurea
ref|NP_974839.1|  uncharacterized protein                             87.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78156.1|  BnaA09g33510D                                        83.6    2e-16   
gb|AAB61054.1|  contains similarity to myosin heavy chain             86.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY05542.1|  BnaA02g31490D                                        85.1    8e-16   
ref|XP_004302308.1|  PREDICTED: putative RNA polymerase II subuni...  83.2    3e-15   Fragaria vesca subsp. vesca
ref|XP_009129907.1|  PREDICTED: putative RNA polymerase II subuni...  83.6    3e-15   Brassica rapa
ref|XP_009366054.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  83.2    3e-15   
emb|CDY25002.1|  BnaC02g40060D                                        83.2    4e-15   Brassica napus [oilseed rape]
emb|CDX80586.1|  BnaC07g28580D                                        81.3    1e-14   
ref|XP_008388442.1|  PREDICTED: putative RNA polymerase II subuni...  79.7    4e-14   
ref|XP_009335520.1|  PREDICTED: putative RNA polymerase II subuni...  79.3    7e-14   Pyrus x bretschneideri [bai li]
ref|XP_008781193.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  79.0    8e-14   Phoenix dactylifera
ref|XP_010921353.1|  PREDICTED: putative RNA polymerase II subuni...  78.2    2e-13   
ref|XP_010921354.1|  PREDICTED: putative RNA polymerase II subuni...  77.8    2e-13   
ref|XP_010921352.1|  PREDICTED: putative RNA polymerase II subuni...  77.8    2e-13   Elaeis guineensis
ref|XP_010042212.1|  PREDICTED: putative RNA polymerase II subuni...  76.6    5e-13   Eucalyptus grandis [rose gum]
ref|XP_009389521.1|  PREDICTED: putative RNA polymerase II subuni...  73.6    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054566.2|  Os05g0134300                                     69.7    1e-11   
sp|Q6AVZ9.1|RPAP2_ORYSJ  RecName: Full=Putative RNA polymerase II...  68.2    4e-10   Oryza sativa Japonica Group [Japonica rice]
sp|A2Y040.1|RPAP2_ORYSI  RecName: Full=Putative RNA polymerase II...  66.6    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002453603.1|  hypothetical protein SORBIDRAFT_04g008880        61.2    1e-08   Sorghum bicolor [broomcorn]
ref|XP_001782029.1|  predicted protein                                60.5    1e-07   
dbj|BAJ96888.1|  predicted protein                                    58.5    6e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437040.1|  hypothetical protein SORBIDRAFT_10g019650        53.1    4e-06   
ref|XP_002990357.1|  hypothetical protein SELMODRAFT_447998           55.1    6e-06   Selaginella moellendorffii
ref|XP_002979385.1|  hypothetical protein SELMODRAFT_444189           55.1    6e-06   Selaginella moellendorffii
ref|XP_010891878.1|  PREDICTED: putative RNA polymerase II subuni...  53.9    1e-05   Esox lucius
gb|KFP17480.1|  Putative RNA polymerase II subunit B1 CTD phospha...  52.8    3e-05   Egretta garzetta
ref|XP_010643225.1|  PREDICTED: putative RNA polymerase II subuni...  52.8    4e-05   Fukomys damarensis [Damara mole rat]
ref|XP_003569080.1|  PREDICTED: putative RNA polymerase II subuni...  51.6    9e-05   Brachypodium distachyon [annual false brome]
ref|XP_008650656.1|  PREDICTED: uncharacterized protein LOC103631550  50.8    1e-04   
emb|CAJ38817.1|  hypothetical protein                                 51.2    1e-04   Platynereis dumerilii
ref|XP_009466637.1|  PREDICTED: putative RNA polymerase II subuni...  50.8    1e-04   Nipponia nippon
ref|XP_010580941.1|  PREDICTED: putative RNA polymerase II subuni...  50.4    2e-04   Haliaeetus leucocephalus
ref|XP_002440538.1|  hypothetical protein SORBIDRAFT_09g002730        50.4    2e-04   Sorghum bicolor [broomcorn]
gb|KFR00386.1|  Putative RNA polymerase II subunit B1 CTD phospha...  50.4    2e-04   Nipponia nippon
gb|KFQ07254.1|  Putative RNA polymerase II subunit B1 CTD phospha...  50.4    2e-04   Haliaeetus albicilla
ref|XP_010580937.1|  PREDICTED: putative RNA polymerase II subuni...  50.4    2e-04   Haliaeetus leucocephalus
ref|XP_010580936.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    2e-04   Haliaeetus leucocephalus
gb|EOA96367.1|  RNA polymerase II-associated protein 2                50.1    2e-04   Anas platyrhynchos [duck]
ref|XP_010161825.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    2e-04   
ref|XP_010580938.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    2e-04   Haliaeetus leucocephalus
ref|XP_005026619.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    2e-04   
gb|KGL93104.1|  Putative RNA polymerase II subunit B1 CTD phospha...  50.1    2e-04   Charadrius vociferus
gb|KFO69587.1|  Putative RNA polymerase II subunit B1 CTD phospha...  50.1    2e-04   Cuculus canorus
ref|XP_009883195.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    3e-04   Charadrius vociferus
gb|KFZ54164.1|  Putative RNA polymerase II subunit B1 CTD phospha...  50.1    3e-04   Antrostomus carolinensis
emb|CAF96376.1|  unnamed protein product                              50.1    3e-04   Tetraodon nigroviridis
ref|XP_009554783.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    3e-04   Cuculus canorus
gb|KFQ74312.1|  Putative RNA polymerase II subunit B1 CTD phospha...  50.1    3e-04   Phaethon lepturus
ref|XP_010284714.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    3e-04   Phaethon lepturus
ref|XP_009921125.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    3e-04   Haliaeetus albicilla
ref|XP_009921124.1|  PREDICTED: putative RNA polymerase II subuni...  50.1    3e-04   Haliaeetus albicilla
ref|XP_009921126.1|  PREDICTED: putative RNA polymerase II subuni...  49.7    3e-04   Haliaeetus albicilla
ref|XP_006278788.1|  PREDICTED: putative RNA polymerase II subuni...  49.7    4e-04   
gb|KFV38843.1|  Putative RNA polymerase II subunit B1 CTD phospha...  49.3    4e-04   Tyto alba [Schleiereule]
ref|XP_009968966.1|  PREDICTED: putative RNA polymerase II subuni...  49.3    4e-04   Tyto alba [Schleiereule]
gb|KFV85220.1|  Putative RNA polymerase II subunit B1 CTD phospha...  49.3    5e-04   Struthio camelus australis
gb|KFU96429.1|  Putative RNA polymerase II subunit B1 CTD phospha...  48.9    5e-04   Chaetura pelagica
ref|XP_010643220.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    5e-04   Fukomys damarensis [Damara mole rat]
ref|XP_009680871.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    5e-04   Struthio camelus australis
ref|XP_010005058.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    5e-04   Chaetura pelagica
ref|XP_010308897.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    6e-04   Balearica regulorum gibbericeps
ref|XP_010643223.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    6e-04   Fukomys damarensis [Damara mole rat]
ref|XP_010643219.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    6e-04   Fukomys damarensis [Damara mole rat]
gb|KFO84345.1|  Putative RNA polymerase II subunit B1 CTD phospha...  48.9    6e-04   Buceros rhinoceros silvestris
gb|KFO14911.1|  Putative RNA polymerase II subunit B1 CTD phospha...  48.9    6e-04   Balearica regulorum gibbericeps
ref|XP_422341.3|  PREDICTED: putative RNA polymerase II subunit B...  48.9    6e-04   Gallus gallus [bantam]
ref|XP_010643224.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    7e-04   Fukomys damarensis [Damara mole rat]
ref|XP_004936662.1|  PREDICTED: putative RNA polymerase II subuni...  48.9    7e-04   
gb|KFQ87403.1|  Putative RNA polymerase II subunit B1 CTD phospha...  48.9    7e-04   Phoenicopterus ruber ruber
ref|XP_004936663.1|  PREDICTED: putative RNA polymerase II subuni...  48.5    7e-04   
ref|XP_010221201.1|  PREDICTED: putative RNA polymerase II subuni...  48.5    8e-04   Tinamus guttatus
ref|XP_006021886.1|  PREDICTED: putative RNA polymerase II subuni...  48.5    8e-04   Alligator sinensis
gb|KGL82916.1|  Putative RNA polymerase II subunit B1 CTD phospha...  48.5    8e-04   Tinamus guttatus
ref|XP_010144144.1|  PREDICTED: putative RNA polymerase II subuni...  48.5    9e-04   Buceros rhinoceros silvestris



>ref|XP_006358558.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Solanum tuberosum]
Length=662

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K EA  VKDAVHKLQLCLL+GI+DEN+L+AAGSL+ RSDYQDVVTER+I NMCGYPLC
Sbjct  1    MAKGEAVAVKDAVHKLQLCLLEGIKDENQLIAAGSLLSRSDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_004230345.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Solanum lycopersicum]
Length=660

 Score =   115 bits (289),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K EA  VKDAVHKLQLCLL+GI+DE++L+AAGSL+ RSDYQDVVTER+I NMCGYPLC
Sbjct  1    MAKGEAVAVKDAVHKLQLCLLEGIKDESQLIAAGSLLSRSDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_009629199.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X4 [Nicotiana tomentosiformis]
Length=592

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  KPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCG  465
            K S M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCG
Sbjct  13   KSSLMANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCG  72

Query  466  YPLCSNFLPSD  498
            YPLCSN LPS+
Sbjct  73   YPLCSNSLPSE  83



>ref|XP_009629198.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Nicotiana tomentosiformis]
Length=656

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  KPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCG  465
            K S M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCG
Sbjct  13   KSSLMANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCG  72

Query  466  YPLCSNFLPSD  498
            YPLCSN LPS+
Sbjct  73   YPLCSNSLPSE  83



>ref|XP_009629188.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629189.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629190.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629192.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629193.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=680

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  KPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCG  465
            K S M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCG
Sbjct  13   KSSLMANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCG  72

Query  466  YPLCSNFLPSD  498
            YPLCSN LPS+
Sbjct  73   YPLCSNSLPSE  83



>ref|XP_011087531.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
 ref|XP_011087533.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
Length=655

 Score =   114 bits (285),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  TVKDAVHKLQL LL+GI +EN+L AAGSL+CRSDYQDVVTERTI+NMCGYPLC
Sbjct  1    MKKDEVLTVKDAVHKLQLSLLEGINNENQLSAAGSLICRSDYQDVVTERTIINMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_011087530.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Sesamum indicum]
Length=687

 Score =   114 bits (285),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  TVKDAVHKLQL LL+GI +EN+L AAGSL+CRSDYQDVVTERTI+NMCGYPLC
Sbjct  45   MKKDEVLTVKDAVHKLQLSLLEGINNENQLSAAGSLICRSDYQDVVTERTIINMCGYPLC  104

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  105  SNSLPSE  111



>ref|XP_011087529.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Sesamum indicum]
Length=699

 Score =   114 bits (285),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  TVKDAVHKLQL LL+GI +EN+L AAGSL+CRSDYQDVVTERTI+NMCGYPLC
Sbjct  45   MKKDEVLTVKDAVHKLQLSLLEGINNENQLSAAGSLICRSDYQDVVTERTIINMCGYPLC  104

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  105  SNSLPSE  111



>ref|XP_009602823.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=576

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTERTI NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERTIANMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNCLPSE  67



>ref|XP_009629194.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629195.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629196.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629197.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=664

 Score =   111 bits (278),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_009602820.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602821.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=664

 Score =   111 bits (278),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTERTI NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERTIANMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNCLPSE  67



>emb|CAN62034.1| hypothetical protein VITISV_014731 [Vitis vinifera]
Length=659

 Score =   107 bits (267),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   +   VKDAVHKLQL LL+GIQ+EN+L AAGSLM RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAGDQPIAVKDAVHKLQLFLLEGIQNENQLFAAGSLMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_002280625.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659731.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659732.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 emb|CBI39649.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   +   VKDAVHKLQL LL+GIQ+EN+L AAGSLM RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAGDQPIAVKDAVHKLQLFLLEGIQNENQLFAAGSLMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_009771014.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
 ref|XP_009771015.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
Length=664

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQL LL+GI+DEN+L AAGSL+ R DYQDVVTER+I NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLYLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_009771016.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana sylvestris]
Length=576

 Score =   105 bits (263),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQL LL+GI+DEN+L AAGSL+ R DYQDVVTER+I NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLYLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPS+
Sbjct  61   SNSLPSE  67



>ref|XP_002321396.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
 gb|EEF05523.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
Length=696

 Score =   105 bits (261),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++T VKD ++KLQL LLDGIQ+E++LLAAGS+M  SDY+DVVTERTI N+CGYPLC
Sbjct  1    MAKDQSTVVKDTIYKLQLSLLDGIQNEDQLLAAGSIMSHSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSD  498
             N LPSD
Sbjct  61   GNSLPSD  67



>ref|XP_003519102.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Glycine max]
Length=706

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I NMCGYPLC
Sbjct  1    MAKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPSD
Sbjct  61   SNALPSD  67



>gb|KHN23219.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I NMCGYPLC
Sbjct  1    MAKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPSD
Sbjct  61   SNALPSD  67



>ref|XP_006575272.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Glycine max]
Length=716

 Score =   103 bits (256),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I NMCGYPLC
Sbjct  1    MAKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNMCGYPLC  60

Query  478  SNFLPSD  498
            SN LPSD
Sbjct  61   SNALPSD  67



>ref|XP_011044667.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Populus euphratica]
Length=722

 Score =   103 bits (256),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K + T VKD ++KLQL LL+GIQ+E++L AAGS+M RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAKDQLTVVKDTIYKLQLSLLEGIQNEDQLFAAGSIMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSD  498
             N LPSD
Sbjct  61   GNSLPSD  67



>ref|XP_011044665.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
 ref|XP_011044666.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
Length=733

 Score =   103 bits (256),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K + T VKD ++KLQL LL+GIQ+E++L AAGS+M RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAKDQLTVVKDTIYKLQLSLLEGIQNEDQLFAAGSIMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSD  498
             N LPSD
Sbjct  61   GNSLPSD  67



>ref|XP_002521936.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40460.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   102 bits (255),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E+ +VKD V+KLQL LL+GI++E++LLAAGSLM RSDY+DVV ER+I N+CGYPLC
Sbjct  1    MAKEESVSVKDTVYKLQLSLLEGIENEDQLLAAGSLMSRSDYEDVVVERSISNLCGYPLC  60

Query  478  SNFLPSD  498
            +N LPSD
Sbjct  61   NNSLPSD  67



>ref|XP_007016928.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
 gb|EOY34547.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
Length=703

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +1

Query  205  VRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENK  384
             +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +
Sbjct  24   AKFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQ  83

Query  385  LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            LLA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+
Sbjct  84   LLASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSE  121



>ref|XP_007016931.1| F2P16.20-like protein isoform 6 [Theobroma cacao]
 gb|EOY34550.1| F2P16.20-like protein isoform 6 [Theobroma cacao]
Length=515

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +1

Query  208  RFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKL  387
            +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +L
Sbjct  25   KFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQL  84

Query  388  LAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            LA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+
Sbjct  85   LASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSE  121



>ref|XP_010674526.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010674527.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
Length=730

 Score =   102 bits (254),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K   TTV + VHKLQL LL+GI+D+N+L AAGSLM RSDY+DVVTER+I N+CGYPLC
Sbjct  1    MEKDRITTVSEVVHKLQLALLNGIEDDNQLFAAGSLMSRSDYEDVVTERSIANLCGYPLC  60

Query  478  SNFLP  492
            SN LP
Sbjct  61   SNSLP  65



>emb|CDP15205.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   102 bits (254),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K     +KDAVH+LQL LL+GIQDENKL AAGS+M +SDYQDVVTER+I N+CGYPLC
Sbjct  1    MAKDHVIAIKDAVHRLQLSLLEGIQDENKLFAAGSVMSQSDYQDVVTERSITNLCGYPLC  60

Query  478  SNFLP  492
             N LP
Sbjct  61   GNSLP  65



>ref|XP_007016926.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34545.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
Length=739

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +1

Query  208  RFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKL  387
            +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +L
Sbjct  25   KFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQL  84

Query  388  LAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            LA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+
Sbjct  85   LASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSE  121



>ref|XP_003537129.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Glycine max]
 gb|KHN37760.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I N+CGYPLC
Sbjct  1    MEKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNVCGYPLC  60

Query  478  SNFLPSD  498
            SN LPSD
Sbjct  61   SNALPSD  67



>ref|XP_007016930.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
 gb|EOY34549.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
Length=708

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +1

Query  208  RFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKL  387
            +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +L
Sbjct  25   KFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQL  84

Query  388  LAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            LA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+
Sbjct  85   LASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSE  121



>ref|XP_007016927.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
 gb|EOY34546.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
Length=679

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +1

Query  208  RFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKL  387
            +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +L
Sbjct  25   KFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQL  84

Query  388  LAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            LA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+
Sbjct  85   LASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSE  121



>ref|XP_007145767.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
 gb|ESW17761.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
Length=706

 Score =   100 bits (249),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +A +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I N+CGYPLC
Sbjct  1    MAKDKAVSVKDAVFKLQMLLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNVCGYPLC  60

Query  478  SNFLPSD  498
             N LPS+
Sbjct  61   CNALPSE  67



>gb|KDP37902.1| hypothetical protein JCGZ_05341 [Jatropha curcas]
Length=654

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++ +VKD VHKLQL LL+GI++E++L  AGSLM RSDY+DVVTER+I N+CGYPLC
Sbjct  1    MAKDQSISVKDTVHKLQLSLLEGIKNEDQLFTAGSLMSRSDYEDVVTERSIANLCGYPLC  60

Query  478  SNFLPSD  498
            +N LP D
Sbjct  61   NNSLPLD  67



>ref|XP_008454119.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
 ref|XP_008454120.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
Length=661

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++  +KD V+KLQL L +GIQ+EN+L AAGSLM RSDY+DVVTER+I N+CGYPLC
Sbjct  1    MAKNQSALIKDTVYKLQLALYEGIQNENQLFAAGSLMSRSDYEDVVTERSIANLCGYPLC  60

Query  478  SNFLPSD  498
             + LPSD
Sbjct  61   HSNLPSD  67



>ref|XP_007016929.1| F2P16.20 protein, putative isoform 4 [Theobroma cacao]
 gb|EOY34548.1| F2P16.20 protein, putative isoform 4 [Theobroma cacao]
Length=607

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++ +V +AVHK+QL LLDGI+DE +LLA+GSL+ RSDY+DVVTERTI N CGYPLC
Sbjct  1    MAKEQSISVSEAVHKIQLHLLDGIRDEKQLLASGSLISRSDYEDVVTERTISNTCGYPLC  60

Query  478  SNFLPSD  498
            +N LPS+
Sbjct  61   ANPLPSE  67



>ref|XP_002874325.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50584.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
Length=1147

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +1

Query  274  LNFRKP--SRMTKT-EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTER  444
            + FR P   +M K  EA  + DAVHKLQL +LDGI D+N+L AAG L+ R DY+DVVTER
Sbjct  326  IQFRFPFDGKMAKDDEAIAINDAVHKLQLAMLDGINDQNQLFAAGKLISRLDYEDVVTER  385

Query  445  TIVNMCGYPLCSNFLPSD  498
            TI  +CGYPLC  FLPSD
Sbjct  386  TIAKLCGYPLCRRFLPSD  403



>gb|KEH41826.1| RNA polymerase II subunit B1 CTD phosphatase RPAP2, putative 
[Medicago truncatula]
Length=702

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +   VKDAV KLQL LLDGIQ E++L AAGSL+ +SDY+DVVTER+I N+CGYPLC
Sbjct  1    MEKNQPVFVKDAVLKLQLALLDGIQKEDQLFAAGSLISKSDYEDVVTERSITNLCGYPLC  60

Query  478  SNFLPSD  498
             N LP+D
Sbjct  61   RNALPTD  67



>gb|EYU19406.1| hypothetical protein MIMGU_mgv1a003240mg [Erythranthe guttata]
Length=597

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            VKDAVHKLQL LL+GI+ E++L+AAGSL+ +SDYQDVVTERTI ++CGYPLC N LPS+
Sbjct  9    VKDAVHKLQLSLLEGIKHESQLIAAGSLISQSDYQDVVTERTIAHVCGYPLCVNSLPSE  67



>gb|KJB31664.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31665.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31666.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31667.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31668.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
Length=708

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  SRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            S M K ++ +V +AVHK+QL LLDGI+DE +L+++GSL+ RSDY+DVVTER+I N CGYP
Sbjct  6    SSMAKDQSISVSEAVHKIQLHLLDGIRDEKQLISSGSLISRSDYEDVVTERSISNTCGYP  65

Query  472  LCSNFLPSD  498
            LC N LPS+
Sbjct  66   LCQNPLPSE  74



>ref|XP_004152151.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
 gb|KGN52984.1| hypothetical protein Csa_4G009360 [Cucumis sativus]
Length=662

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++  +KD V+KLQL L +GI++EN+L AAGSLM RSDY+DVVTER+I ++CGYPLC
Sbjct  1    MAKNQSVLIKDTVYKLQLALYEGIKNENQLFAAGSLMSRSDYEDVVTERSIADLCGYPLC  60

Query  478  SNFLPSD  498
             + LPSD
Sbjct  61   HSNLPSD  67



>ref|XP_004157008.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
Length=632

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++  +KD V+KLQL L +GI++EN+L AAGSLM RSDY+DVVTER+I ++CGYPLC
Sbjct  1    MAKNQSVLIKDTVYKLQLALYEGIKNENQLFAAGSLMSRSDYEDVVTERSIADLCGYPLC  60

Query  478  SNFLPSD  498
             + LPSD
Sbjct  61   HSNLPSD  67



>gb|KHG00855.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=708

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  SRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            S M K ++ +V +AVHK+QL LLDGI+DE +L+++GSL+ RSDY+DV+TER+I N CGYP
Sbjct  6    SSMAKDQSISVSEAVHKIQLHLLDGIRDEKQLISSGSLISRSDYEDVITERSISNTCGYP  65

Query  472  LCSNFLPSD  498
            LC N LPS+
Sbjct  66   LCQNPLPSE  74



>ref|XP_010421540.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=890

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            + DAVHKLQL +LDGI D+N+L AAG L+ R DY+DVVTERTI  +CGYPLC  FLPSD
Sbjct  63   INDAVHKLQLAMLDGITDQNQLFAAGKLISRLDYEDVVTERTIAKLCGYPLCQRFLPSD  121



>gb|KHG00854.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=729

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  292  SRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            S M K ++ +V +AVHK+QL LLDGI+DE +L+++GSL+ RSDY+DV+TER+I N CGYP
Sbjct  6    SSMAKDQSISVSEAVHKIQLHLLDGIRDEKQLISSGSLISRSDYEDVITERSISNTCGYP  65

Query  472  LCSNFLPSD  498
            LC N LPS+
Sbjct  66   LCQNPLPSE  74



>ref|XP_006290171.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
 gb|EOA23069.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
Length=743

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 7/87 (8%)
 Frame = +1

Query  259  SSHQILNFRKPSRMT-------KTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRS  417
            SS  +L+  KP + +         +   + DAVHKLQL +L+GI D+N+L AAG L+ R 
Sbjct  8    SSPNLLSGSKPIKSSLHHTLRPNNQVIAINDAVHKLQLAMLEGITDQNQLFAAGKLISRL  67

Query  418  DYQDVVTERTIVNMCGYPLCSNFLPSD  498
            DY+DVVTERTI  +CGYPLC  FLPSD
Sbjct  68   DYEDVVTERTIAKLCGYPLCQRFLPSD  94



>ref|XP_010551019.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Tarenaya hassleriana]
Length=719

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M+K +   + +AV KLQL LLDGI D+ +L AAGSLM RSDY+DVVTERTI  +CGYPLC
Sbjct  1    MSKDQEIAINEAVRKLQLALLDGITDQKQLFAAGSLMSRSDYEDVVTERTIAKLCGYPLC  60

Query  478  SNFLPSD  498
             + LPS+
Sbjct  61   GSSLPSE  67



>ref|XP_010493937.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=879

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +1

Query  277  NFRKPSRMTKT----EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTER  444
            N ++  +  KT    +   + DAVHKLQL +LDGI ++N+L AAG L+ R DY+DVVTER
Sbjct  44   NVKEGKKREKTPIDDQVIAINDAVHKLQLAMLDGITEQNQLFAAGKLISRLDYEDVVTER  103

Query  445  TIVNMCGYPLCSNFLPSD  498
            TI  +CGYPLC  FLPSD
Sbjct  104  TIAKLCGYPLCQRFLPSD  121



>ref|XP_010456737.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog, partial [Camelina sativa]
Length=622

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            + DAVHKLQL +LDGI ++N+L AAG L+ R DY+DVVTERTI  +CGYPLC  FLPSD
Sbjct  63   INDAVHKLQLAMLDGITEQNQLFAAGKLISRLDYEDVVTERTIAKLCGYPLCQRFLPSD  121



>ref|XP_007208433.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
 gb|EMJ09632.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
Length=711

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V+KLQL LL+GI+ ++ L  AGS++ RSDY DVVTERTI N+CGYPLCSN LPSD
Sbjct  14   SVKDTVYKLQLALLEGIKTQDHLYLAGSIISRSDYNDVVTERTIANLCGYPLCSNALPSD  73



>gb|KFK26439.1| hypothetical protein AALP_AA8G248600 [Arabis alpina]
Length=791

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M+K +   V DAVHKLQL +LDGI D+ +L AAG++M RSDY+DVVTERTI  +CG+PLC
Sbjct  1    MSKDQVIAVNDAVHKLQLAMLDGITDQKQLFAAGTVMSRSDYEDVVTERTIAKLCGFPLC  60

Query  478  SNFLPSD  498
               LPS+
Sbjct  61   RTSLPSE  67



>ref|XP_004497627.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cicer arietinum]
Length=666

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQL LL+GIQ E++L AAGSL+ RSDY+DVVTER+I  +C YPLC
Sbjct  1    MEKDQPISVKDAVFKLQLALLEGIQSEDQLFAAGSLISRSDYEDVVTERSITEVCSYPLC  60

Query  478  SNFLPSD  498
             N LPS+
Sbjct  61   CNALPSE  67



>ref|XP_006841578.1| hypothetical protein AMTR_s00003p00194360 [Amborella trichopoda]
 gb|ERN03253.1| hypothetical protein AMTR_s00003p00194360 [Amborella trichopoda]
Length=591

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M      ++KDA++K+Q  LLDGI  EN+LLAA +L+ RSDY DVVTERTI N+CGYPLC
Sbjct  1    MAMNSIPSLKDAIYKIQTYLLDGISKENQLLAAANLISRSDYDDVVTERTITNLCGYPLC  60

Query  478  SNFLPSD  498
            + +LP D
Sbjct  61   NKYLPCD  67



>ref|XP_006394906.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
 gb|ESQ32192.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
Length=720

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  304  KTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN  483
            + +A  + DAVHK+QL +LDGI D+ +L AAG+LM R DY+DVVTERTI  +CGYPLC  
Sbjct  4    RDQAIAINDAVHKIQLAMLDGITDQKQLFAAGTLMSRLDYEDVVTERTIAKLCGYPLCRA  63

Query  484  FLPSD  498
             LPSD
Sbjct  64   SLPSD  68



>ref|XP_010097327.1| hypothetical protein L484_006008 [Morus notabilis]
 gb|EXB67559.1| hypothetical protein L484_006008 [Morus notabilis]
Length=695

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V++LQL LL G+  E++L AAGS+M RSDY DVVTER+I N+CGYPLC N LPSD
Sbjct  10   SVKDTVYRLQLSLLQGLHGEDQLFAAGSIMSRSDYNDVVTERSIANLCGYPLCPNPLPSD  69



>ref|XP_008246291.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Prunus mume]
Length=711

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V+KLQL LL+GI+ ++ L  AGS++ RSDY DVVTERTI N+CGYPLCSN LPS+
Sbjct  14   SVKDTVYKLQLALLEGIKTQDHLYLAGSIISRSDYNDVVTERTIANLCGYPLCSNALPSE  73



>gb|KHG28494.1| hypothetical protein F383_15905 [Gossypium arboreum]
Length=151

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++ +  +AVHK+QL LLDGI+DE +L ++GSL+ +S Y+DVVTER+I N+C YPLC
Sbjct  1    MAKDQSISGLEAVHKIQLHLLDGIRDEKQLFSSGSLISQSGYEDVVTERSISNICSYPLC  60

Query  478  SNFLPSD  498
             N LPS+
Sbjct  61   RNPLPSE  67



>ref|XP_010271590.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
 ref|XP_010271591.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
Length=650

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M + +  +VKDAVHKLQL LL+GI +E++L AAGSLM RSDY+DVVTER I  +CGYPLC
Sbjct  1    MVEHQPLSVKDAVHKLQLSLLEGICNEDQLFAAGSLMSRSDYEDVVTERHITKVCGYPLC  60

Query  478  SNFL  489
             N L
Sbjct  61   KNPL  64



>gb|ABR17753.1| unknown [Picea sitchensis]
Length=668

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            A +VKDAV+K+Q  LLDG++ E +L AA +L+ +SDY+DVVTERTIVN+CGYPLCSN LP
Sbjct  2    APSVKDAVYKIQTTLLDGVKTEAQLHAAANLLSKSDYEDVVTERTIVNLCGYPLCSNKLP  61

Query  493  S  495
            +
Sbjct  62   A  62



>ref|XP_006480289.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Citrus sinensis]
Length=768

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            V DAVHKLQL LL+GI+ E +LLAAG+L+ +SDY DVVTER+I ++CGYPLCSN LP
Sbjct  6    VNDAVHKLQLALLEGIEAEKQLLAAGTLISKSDYNDVVTERSIADLCGYPLCSNPLP  62



>gb|EPS64466.1| hypothetical protein M569_10314, partial [Genlisea aurea]
Length=597

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  T+K+AV++LQ  LL+G ++EN+L AAGSLM R DYQD+VTER I  +CGYPLC
Sbjct  1    MAKDEILTMKEAVYRLQTSLLEGAKNENQLSAAGSLMSRGDYQDLVTERVIAKICGYPLC  60

Query  478  SNFLPSD  498
            SN L S+
Sbjct  61   SNNLNSE  67



>ref|NP_974839.1| uncharacterized protein [Arabidopsis thaliana]
 sp|F4K1B1.1|RPAP2_ARATH RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Arabidopsis thaliana]
 gb|AED93598.1| uncharacterized protein AT5G26760 [Arabidopsis thaliana]
Length=735

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            EA  + DAVHKLQL +L+   D+N+L AA  LM RSDY+DVVTER I  +CGY LC  FL
Sbjct  6    EAIAINDAVHKLQLYMLENTTDQNQLFAARKLMSRSDYEDVVTERAIAKLCGYTLCQRFL  65

Query  490  PSD  498
            PSD
Sbjct  66   PSD  68



>emb|CDX78156.1| BnaA09g33510D [Brassica napus]
Length=262

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +A  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  6    QAIAINDAVHKIQLSLLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSPL  65

Query  490  PSD  498
            PSD
Sbjct  66   PSD  68



>gb|AAB61054.1| contains similarity to myosin heavy chain [Arabidopsis thaliana]
Length=1133

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  295  RMTK-TEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            +M K  EA  + DAVHKLQL +L+   D+N+L AA  LM RSDY+DVVTER I  +CGY 
Sbjct  335  KMAKDNEAIAINDAVHKLQLYMLENTTDQNQLFAARKLMSRSDYEDVVTERAIAKLCGYT  394

Query  472  LCSNFLPSD  498
            LC  FLPSD
Sbjct  395  LCQRFLPSD  403



>emb|CDY05542.1| BnaA02g31490D [Brassica napus]
Length=827

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            EA  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  6    EAIAINDAVHKIQLALLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSRL  65

Query  490  PSD  498
            PSD
Sbjct  66   PSD  68



>ref|XP_004302308.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Fragaria vesca subsp. vesca]
Length=692

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            + +V DAV+KLQL LLD ++  ++L  AGS++ RSDY DVVTER+I ++CGYPLCSN LP
Sbjct  10   SKSVNDAVYKLQLALLDSVKTLDRLYLAGSIISRSDYTDVVTERSIADLCGYPLCSNALP  69

Query  493  SD  498
             +
Sbjct  70   PE  71



>ref|XP_009129907.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brassica rapa]
Length=852

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +A  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  28   QAIAINDAVHKIQLALLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSPL  87

Query  490  PSD  498
            PSD
Sbjct  88   PSD  90



>ref|XP_009366054.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Pyrus x bretschneideri]
Length=704

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V+KLQL LLDG++  + L  AGS++ RSDY DVVTERTI + CGYPLC N LP +
Sbjct  15   SVKDTVYKLQLALLDGVKTLDHLYLAGSIISRSDYNDVVTERTIADHCGYPLCPNALPPE  74



>emb|CDY25002.1| BnaC02g40060D [Brassica napus]
Length=772

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +A  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  29   QAIAINDAVHKIQLSLLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSPL  88

Query  490  PSD  498
            PSD
Sbjct  89   PSD  91



>emb|CDX80586.1| BnaC07g28580D [Brassica napus]
Length=607

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPL  474
            M K +  T+ DAVHKLQL +LD I D+  L AAG+L+ RSDY+DV+TERTI  +CGYPL
Sbjct  1    MAKDQLITINDAVHKLQLAMLDRITDQKHLFAAGTLIYRSDYEDVITERTIAKLCGYPL  59



>ref|XP_008388442.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Malus domestica]
Length=706

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V+KLQL LL+G++  ++L  AGS++ RSDY DVVTERTI + CGYPLC + LP +
Sbjct  16   SVKDTVYKLQLALLEGVKTLDQLYLAGSIISRSDYSDVVTERTIADHCGYPLCPSALPPE  75



>ref|XP_009335520.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Pyrus x bretschneideri]
Length=705

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VK+ V+KLQL LLDG++  ++L  AGS++ RSDY DVVTERTI + CGYPLC + LP +
Sbjct  15   SVKETVYKLQLALLDGVKTLDQLYLAGSIISRSDYGDVVTERTIADHCGYPLCPHALPPE  74



>ref|XP_008781193.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Phoenix dactylifera]
Length=689

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGI-QDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + T+ DAVH++Q+ L DG    E +L AAG+L+ RSDY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTISDAVHQIQIALFDGAASSEGQLFAAGALLSRSDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSD  498
            P D
Sbjct  67   PQD  69



>ref|XP_010921353.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Elaeis guineensis]
Length=664

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDG-IQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + TV +A+H++Q+ LLDG    E +L AAG+L+ R DY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTVANAIHRIQIALLDGATSSERQLFAAGALLSRPDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSD  498
            P D
Sbjct  67   PHD  69



>ref|XP_010921354.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Elaeis guineensis]
Length=593

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDG-IQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + TV +A+H++Q+ LLDG    E +L AAG+L+ R DY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTVANAIHRIQIALLDGATSSERQLFAAGALLSRPDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSD  498
            P D
Sbjct  67   PHD  69



>ref|XP_010921352.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Elaeis guineensis]
Length=681

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDG-IQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + TV +A+H++Q+ LLDG    E +L AAG+L+ R DY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTVANAIHRIQIALLDGATSSERQLFAAGALLSRPDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSD  498
            P D
Sbjct  67   PHD  69



>ref|XP_010042212.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Eucalyptus grandis]
 gb|KCW84978.1| hypothetical protein EUGRSUZ_B01798 [Eucalyptus grandis]
Length=672

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +1

Query  298  MTKTE--ATTVKDAVHKLQLCLLDGIQ-DENKLLAAGSLMCRSDYQDVVTERTIVNMCGY  468
            M K E    +VKDAV++LQ  LLDG    E +LLAAG+++ R DY+DVV ER+I  +CGY
Sbjct  1    MVKLEEAPVSVKDAVYRLQHLLLDGAAAGEAQLLAAGAILSRRDYEDVVAERSIAGLCGY  60

Query  469  PLCSNFLPSD  498
            PLC+  LP+D
Sbjct  61   PLCATPLPAD  70



>ref|XP_009389521.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Musa acuminata subsp. malaccensis]
Length=668

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGI-QDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            A TV DAV+++Q  LL+G  + E+ LL A +L+ RSDY+DVV E +I ++CGYPLC N L
Sbjct  7    AATVADAVYQIQQALLNGAARSEHHLLVAAALLSRSDYEDVVVELSIADVCGYPLCRNPL  66

Query  490  PSD  498
            PSD
Sbjct  67   PSD  69



>ref|NP_001054566.2| Os05g0134300 [Oryza sativa Japonica Group]
 dbj|BAF16480.2| Os05g0134300 [Oryza sativa Japonica Group]
Length=224

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 14/89 (16%)
 Frame = +1

Query  238  GPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGI--QDENKLLAAGSLMC  411
            GP+T T++  ++    KP        TTV  AVH++Q+ L DG     E  L AA SL+ 
Sbjct  2    GPTTATDTGARM----KP--------TTVASAVHRVQMALYDGAAASREPLLRAAASLLS  49

Query  412  RSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
              DY DVVTER+I + CGYP C N LPS+
Sbjct  50   GPDYADVVTERSIADACGYPACPNPLPSE  78



>sp|Q6AVZ9.1|RPAP2_ORYSJ RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Japonica Group]
 gb|AAT94046.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE62232.1| hypothetical protein OsJ_17019 [Oryza sativa Japonica Group]
Length=726

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 14/89 (16%)
 Frame = +1

Query  238  GPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGI--QDENKLLAAGSLMC  411
            GP+T T++  ++    KP        TTV  AVH++Q+ L DG     E  L AA SL+ 
Sbjct  2    GPTTATDTGARM----KP--------TTVASAVHRVQMALYDGAAASREPLLRAAASLLS  49

Query  412  RSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
              DY DVVTER+I + CGYP C N LPS+
Sbjct  50   GPDYADVVTERSIADACGYPACPNPLPSE  78



>sp|A2Y040.1|RPAP2_ORYSI RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Indica Group]
 gb|EAY96450.1| hypothetical protein OsI_18345 [Oryza sativa Indica Group]
Length=726

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 14/89 (16%)
 Frame = +1

Query  238  GPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGI--QDENKLLAAGSLMC  411
            GP+T T++  ++    KP        TTV  AVH++Q+ L DG     E  L AA SL+ 
Sbjct  2    GPTTATDAGARM----KP--------TTVASAVHRVQMALYDGAAASREPLLRAAASLLS  49

Query  412  RSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
              DY DVVTER+I + CGYP C N LPS+
Sbjct  50   GPDYADVVTERSIADACGYPACPNPLPSE  78



>ref|XP_002453603.1| hypothetical protein SORBIDRAFT_04g008880 [Sorghum bicolor]
 gb|EES06579.1| hypothetical protein SORBIDRAFT_04g008880 [Sorghum bicolor]
Length=251

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLL---AAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    N+ L    A +L+ R+DY DV+TERTI + CG P C + L
Sbjct  35   TVASAVLRIQIALLDGAAASNEALLHAVASALLSRADYDDVITERTIADACGNPACPDPL  94

Query  490  PS  495
            PS
Sbjct  95   PS  96



>ref|XP_001782029.1| predicted protein [Physcomitrella patens]
 gb|EDQ53172.1| predicted protein [Physcomitrella patens]
Length=863

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +K AV ++QL LLDG+  + +L AAG ++ +S+Y DVV ER I  +CGY  C+N L ++
Sbjct  28   MKKAVLEVQLILLDGVNTDEQLQAAGKILSQSEYSDVVEERFIAKVCGYTRCANSLDTE  86



>dbj|BAJ96888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGI--QDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            V  AV ++Q+ LLDG    DE  L AA  ++ R+DY DVVTER+I + CG+P C++ LP
Sbjct  19   VAGAVFRVQMALLDGAAASDEPLLHAAAGVLSRADYDDVVTERSIADACGHPACASPLP  77



>ref|XP_002437040.1| hypothetical protein SORBIDRAFT_10g019650 [Sorghum bicolor]
 gb|EER88407.1| hypothetical protein SORBIDRAFT_10g019650 [Sorghum bicolor]
Length=163

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +1

Query  292  SRMTKTEAT-TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRS---DYQDVVTERTIVNM  459
            S  T  EA+ TV  AV ++Q+ LLDG    N+ L   +        DY DVVTERTI + 
Sbjct  71   SPATAAEASRTVASAVLRIQMALLDGAAASNEALLHAAASALLSRADYDDVVTERTIADA  130

Query  460  CGYPLCSNFLPSD  498
            CG P C + LPS 
Sbjct  131  CGNPACPDPLPSS  143



>ref|XP_002990357.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
 gb|EFJ08626.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
Length=608

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  310  EATTV-KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNF  486
            EA  V K AV  +Q+ L +G++ + +L AA  L+ +S+Y DVVTER+    CG+PLC N 
Sbjct  106  EAVKVMKKAVFAIQMALYNGLRSDFQLKAATCLLTQSEYADVVTERSNDKQCGFPLCPNS  165

Query  487  L  489
            L
Sbjct  166  L  166



>ref|XP_002979385.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
 gb|EFJ19793.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
Length=608

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  310  EATTV-KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNF  486
            EA  V K AV  +Q+ L +G++ + +L AA  L+ +S+Y DVVTER+    CG+PLC N 
Sbjct  106  EAVKVMKKAVFAIQMALYNGLRSDFQLKAATCLLTQSEYADVVTERSNDKQCGFPLCPNS  165

Query  487  L  489
            L
Sbjct  166  L  166



>ref|XP_010891878.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Esox lucius]
Length=615

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = +1

Query  193  SVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQ  372
            S   V  S +A    G S    ++ ++    + +R+T  E   ++    ++   LLD   
Sbjct  3    SRKRVARSSKASKKDGKSVKAQTAAELARRTEATRVTFRERVQLEKRAVQVVERLLDNNV  62

Query  373  DENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +E+ L+    L+  + Y+DVV ER+IV +CGYP+CSN L
Sbjct  63   NEDLLVECARLITPTHYKDVVEERSIVKLCGYPICSNRL  101



>gb|KFP17480.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Egretta garzetta]
Length=569

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A  K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  12   KVAFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>ref|XP_010643225.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X5 [Fukomys damarensis]
Length=498

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 51/107 (48%), Gaps = 8/107 (7%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC   L
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKL  113



>ref|XP_003569080.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brachypodium distachyon]
Length=746

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  301  TKTEATTVKDAVHKLQLCLLDGIQDENK--LLAAGSLMCRSDYQDVVTERTIVNMCGY  468
            T      V  AV+++QL LLDG    N+  L AA +++ R+DY DVVTER+I + CG+
Sbjct  12   TTRTTMNVATAVYRVQLALLDGAAASNEPLLHAAAAVLSRADYDDVVTERSIADACGH  69



>ref|XP_008650656.1| PREDICTED: uncharacterized protein LOC103631550 [Zea mays]
Length=318

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLL---AAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    ++ L   AA +L+  +DY DVVTERTI + CG P C N L
Sbjct  164  TVASAVLRVQMALLDGAAVSSEALIHAAASALLSSADYDDVVTERTISDACGNPACPNPL  223

Query  490  PSD  498
            PS 
Sbjct  224  PSS  226



>emb|CAJ38817.1| hypothetical protein [Platynereis dumerilii]
Length=888

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            ++  H+L   LL+    E  L  AG L+  S YQDV  ER I  MCGYP+CSN +
Sbjct  33   EERAHRLVEQLLENPISEKFLTEAGKLITPSHYQDVTEERAITKMCGYPICSNVI  87



>ref|XP_009466637.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Nipponia nippon]
Length=621

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  108  KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  161



>ref|XP_010580941.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Haliaeetus leucocephalus]
Length=565

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  52   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  105



>ref|XP_002440538.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
 gb|EES18968.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
Length=746

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 3/61 (5%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRS---DYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    N+ L   +        DY DVVTERTI + CG P C N L
Sbjct  15   TVASAVLRIQMALLDGAAASNEALLHAAASALLSRADYDDVVTERTIADACGNPACPNPL  74

Query  490  P  492
            P
Sbjct  75   P  75



>gb|KFR00386.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Nipponia nippon]
Length=569

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>gb|KFQ07254.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Haliaeetus albicilla]
Length=569

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  70



>ref|XP_010580937.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Haliaeetus leucocephalus]
Length=614

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  52   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  105



>ref|XP_010580936.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Haliaeetus leucocephalus]
Length=625

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  52   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  105



>gb|EOA96367.1| RNA polymerase II-associated protein 2, partial [Anas platyrhynchos]
Length=575

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYP+C N L
Sbjct  16   KKALHIVEQLLEENITEEF-LLNSGKNITPSHYKDVVDERSIIKLCGYPICQNKL  69



>ref|XP_010161825.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Caprimulgus carolinensis]
Length=657

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  31   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  84



>ref|XP_010580938.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Haliaeetus leucocephalus]
Length=602

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  52   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  105



>ref|XP_005026619.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Anas platyrhynchos]
Length=604

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYP+C N L
Sbjct  38   KKALHIVEQLLEENITEEF-LLNSGKNITPSHYKDVVDERSIIKLCGYPICQNKL  91



>gb|KGL93104.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Charadrius vociferus]
Length=570

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>gb|KFO69587.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Cuculus canorus]
Length=569

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYPLC N L
Sbjct  17   KKALHIVEELLEEDITEEF-LLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL  70



>ref|XP_009883195.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Charadrius vociferus]
Length=608

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  49   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  102



>gb|KFZ54164.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Caprimulgus carolinensis]
Length=570

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>emb|CAF96376.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=502

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            LL+   DE  L+ A +LM  + Y+D + ER+I+ +CGYP+CSN L
Sbjct  26   LLEDSVDEEFLIDAANLMTSAHYKDAIEERSIIKLCGYPVCSNRL  70



>ref|XP_009554783.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Cuculus canorus]
Length=670

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYPLC N L
Sbjct  44   KKALHIVEELLEEDITEEF-LLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL  97



>gb|KFQ74312.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Phaethon lepturus]
Length=574

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCKNKL  70



>ref|XP_010284714.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Phaethon lepturus]
Length=615

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  31   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCKNKL  84



>ref|XP_009921125.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Haliaeetus albicilla]
Length=581

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  19   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  72



>ref|XP_009921124.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Haliaeetus albicilla]
Length=592

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  19   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  72



>ref|XP_009921126.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Haliaeetus albicilla]
Length=569

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  19   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL  72



>ref|XP_006278788.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Alligator mississippiensis]
Length=632

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL  G L+  S Y+D V ER+I+ +CGYPLC N L
Sbjct  48   KKALHIVEQLLEEDITEEF-LLNCGKLITPSHYKDAVDERSIIKLCGYPLCQNKL  101



>gb|KFV38843.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Tyto alba]
Length=504

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+N+CGYPLC N L
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIINLCGYPLCQNKL  70



>ref|XP_009968966.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Tyto alba]
Length=518

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+N+CGYPLC N L
Sbjct  31   KKALYIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIINLCGYPLCQNKL  84



>gb|KFV85220.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Struthio camelus australis]
Length=572

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>gb|KFU96429.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Chaetura pelagica]
Length=568

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>ref|XP_010643220.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Fukomys damarensis]
 ref|XP_010643222.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Fukomys damarensis]
Length=606

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 51/107 (48%), Gaps = 8/107 (7%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC   L
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKL  113



>ref|XP_009680871.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Struthio camelus australis]
Length=598

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  33   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIKLCGYPLCQNKL  86



>ref|XP_010005058.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Chaetura pelagica]
Length=609

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  41   KKALHIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL  94



>ref|XP_010308897.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Balearica regulorum gibbericeps]
Length=682

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  69   KKALHIVEQLLEENITEEF-FLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  122



>ref|XP_010643223.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Fukomys damarensis]
Length=562

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 51/107 (48%), Gaps = 8/107 (7%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC   L
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKL  113



>ref|XP_010643219.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Fukomys damarensis]
Length=617

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 51/107 (48%), Gaps = 8/107 (7%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC   L
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKL  113



>gb|KFO84345.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Buceros rhinoceros silvestris]
Length=562

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+  ++  L + I +E  LL++G  +  S Y+DVV ER+I+ +CGYPLC N L
Sbjct  17   KKALSIVEQLLEENITEEF-LLSSGKFITPSHYKDVVDERSIIKLCGYPLCQNKL  70



>gb|KFO14911.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Balearica regulorum gibbericeps]
Length=570

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALHIVEQLLEENITEEF-FLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>ref|XP_422341.3| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Gallus gallus]
Length=615

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYP+C N L
Sbjct  52   KKALHIVEQLLEENITEEF-LLNSGRCITPSHYKDIVDERSIIKLCGYPVCQNKL  105



>ref|XP_010643224.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Fukomys damarensis]
Length=560

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 51/107 (48%), Gaps = 8/107 (7%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC   L
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKL  113



>ref|XP_004936662.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Gallus gallus]
Length=626

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  TKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCS  480
            T+ +    K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYP+C 
Sbjct  44   TRKKIELEKKALHIVEQLLEENITEEF-LLNSGRCITPSHYKDIVDERSIIKLCGYPVCQ  102

Query  481  NFL  489
            N L
Sbjct  103  NKL  105



>gb|KFQ87403.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Phoenicopterus ruber ruber]
Length=574

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 4/54 (7%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K  LC+++ + +EN      L +G  +  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALCIVEQLLEENITEEFFLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL  70



>ref|XP_004936663.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X5 [Gallus gallus]
Length=594

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +1

Query  301  TKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCS  480
            T+ +    K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYP+C 
Sbjct  44   TRKKIELEKKALHIVEQLLEENITEEF-LLNSGRCITPSHYKDIVDERSIIKLCGYPVCQ  102

Query  481  NFL  489
            N L
Sbjct  103  NKL  105



>ref|XP_010221201.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Tinamus guttatus]
Length=578

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  37   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIRLCGYPLCQNKL  90



>ref|XP_006021886.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Alligator sinensis]
Length=611

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+H ++  L + I +E  L+  G L+  S Y+D V ER+I+ +CGYPLC N L
Sbjct  48   KKALHIVEQLLEEDITEEF-LMNCGKLITPSHYKDAVDERSIIKLCGYPLCQNKL  101



>gb|KGL82916.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Tinamus guttatus]
Length=586

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L
Sbjct  17   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIRLCGYPLCQNKL  70



>ref|XP_010144144.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Buceros rhinoceros silvestris]
Length=628

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            K A+  ++  L + I +E  LL++G  +  S Y+DVV ER+I+ +CGYPLC N L
Sbjct  31   KKALSIVEQLLEENITEEF-LLSSGKFITPSHYKDVVDERSIIKLCGYPLCQNKL  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695