BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF012O23

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             110   1e-26   
gb|ACU19312.1|  unknown                                                 107   2e-26   Glycine max [soybeans]
ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          109   4e-26   Vitis vinifera
ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   6e-26   Nicotiana sylvestris
gb|KHM99334.1|  CAAX prenyl protease 1 like                             108   6e-26   Glycine soja [wild soybean]
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             108   6e-26   Phaseolus vulgaris [French bean]
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   7e-26   Glycine max [soybeans]
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg             108   9e-26   
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   1e-25   Solanum lycopersicum
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          107   1e-25   Sesamum indicum [beniseed]
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          107   1e-25   Glycine max [soybeans]
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          107   2e-25   Nicotiana tomentosiformis
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          107   2e-25   Solanum tuberosum [potatoes]
gb|KJB41393.1|  hypothetical protein B456_007G102500                    107   3e-25   Gossypium raimondii
gb|KJB41392.1|  hypothetical protein B456_007G102500                    106   3e-25   Gossypium raimondii
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                    106   3e-25   Gossypium arboreum [tree cotton]
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog          106   5e-25   Cucumis melo [Oriental melon]
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog          106   5e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO86290.1|  hypothetical protein CISIN_1g014430mg                   104   6e-25   Citrus sinensis [apfelsine]
emb|CDY48517.1|  BnaA09g00060D                                          105   8e-25   Brassica napus [oilseed rape]
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog          105   8e-25   Brassica rapa
emb|CDY07191.1|  BnaCnng02060D                                          105   9e-25   
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                105   9e-25   Erythranthe guttata [common monkey flower]
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog          105   9e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog          105   1e-24   Elaeis guineensis
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    105   1e-24   Brassica rapa
gb|KDO86289.1|  hypothetical protein CISIN_1g014430mg                   104   1e-24   Citrus sinensis [apfelsine]
emb|CDX74353.1|  BnaA03g26940D                                          105   1e-24   
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          105   1e-24   Elaeis guineensis
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          105   1e-24   Nicotiana tomentosiformis
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    105   1e-24   Brassica rapa
gb|KDO86287.1|  hypothetical protein CISIN_1g014430mg                   104   2e-24   Citrus sinensis [apfelsine]
gb|KDO86288.1|  hypothetical protein CISIN_1g014430mg                   104   2e-24   Citrus sinensis [apfelsine]
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          104   2e-24   Prunus mume [ume]
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          104   2e-24   Citrus sinensis [apfelsine]
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog          104   2e-24   Cucumis sativus [cucumbers]
ref|XP_003624056.1|  CAAX prenyl protease-like protein                  104   2e-24   Medicago truncatula
ref|XP_002302601.1|  CAAX protease family protein                       104   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog          104   2e-24   
emb|CDP08773.1|  unnamed protein product                                104   3e-24   Coffea canephora [robusta coffee]
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    103   4e-24   Nicotiana sylvestris
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog          103   5e-24   Phoenix dactylifera
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                    103   5e-24   Arabis alpina [alpine rockcress]
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    103   5e-24   Nicotiana sylvestris
emb|CDX91888.1|  BnaC03g31900D                                          103   5e-24   
ref|XP_007218054.1|  hypothetical protein PRUPE_ppa006168mg             102   5e-24   
gb|KJB41394.1|  hypothetical protein B456_007G102500                    102   6e-24   Gossypium raimondii
ref|XP_002320821.1|  CAAX protease family protein                       102   8e-24   Populus trichocarpa [western balsam poplar]
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             102   8e-24   Prunus persica
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          102   8e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog          102   1e-23   Populus euphratica
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog          102   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog          101   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          101   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog          101   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog          101   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog          101   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002511907.1|  caax prenyl protease ste24, putative               100   4e-23   Ricinus communis
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   4e-23   Phoenix dactylifera
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   7e-23   
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   7e-23   Pyrus x bretschneideri [bai li]
ref|NP_001047739.1|  Os02g0680400                                       100   7e-23   
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   8e-23   Oryza brachyantha
ref|XP_007051723.1|  Peptidase family M48 family protein                100   8e-23   
gb|EEC73787.1|  hypothetical protein OsI_08473                          100   9e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                      99.8    1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease   99.8    1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874990.1|  ATSTE24                                          99.8    1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg           99.8    1e-22   Capsella rubella
gb|AAL07084.1|  putative CAAX prenyl protease                         99.8    1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.8    1e-22   Fragaria vesca subsp. vesca
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    2e-22   Tarenaya hassleriana [spider flower]
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700        99.0    2e-22   Amborella trichopoda
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850        98.6    3e-22   Sorghum bicolor [broomcorn]
ref|NP_001131195.1|  uncharacterized protein LOC100192503             96.7    1e-21   Zea mays [maize]
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    2e-21   Fragaria vesca subsp. vesca
gb|AFW63375.1|  CAAX prenyl protease 1                                97.4    3e-21   
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog        95.9    4e-21   
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog        95.5    4e-21   Setaria italica
ref|XP_001780822.1|  predicted protein                                95.1    7e-21   
ref|XP_001783632.1|  predicted protein                                93.2    3e-20   
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2     93.2    3e-20   
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1     93.2    4e-20   Zea mays [maize]
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein              92.0    1e-19   
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog        91.3    1e-19   Fragaria vesca subsp. vesca
gb|AIC32889.1|  STE24                                                 89.7    6e-19   Puccinellia tenuiflora
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog        88.2    2e-18   Brachypodium distachyon [annual false brome]
emb|CAL26913.1|  CAAX peptidase                                       86.3    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAB80941.1|  putative CAAX prenyl protease                        83.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600           82.8    2e-16   Selaginella moellendorffii
gb|KDP28583.1|  hypothetical protein JCGZ_14354                       82.0    4e-16   Jatropha curcas
gb|KEH18809.1|  CAAX prenyl protease-like protein                     80.9    1e-15   Medicago truncatula
ref|NP_001152504.1|  CAAX prenyl protease 1                           79.3    4e-15   Zea mays [maize]
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                   76.6    4e-14   Eucalyptus grandis [rose gum]
ref|XP_003622452.1|  CAAX prenyl protease-like protein                62.8    5e-10   
gb|EJY68063.1|  Zn-dependent protease with chaperone function         59.7    7e-08   Oxytricha trifallax
gb|EJY66600.1|  CAAX prenyl protease-like protein                     55.8    7e-07   Oxytricha trifallax
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672            55.5    1e-06   Volvox carteri f. nagariensis
gb|KHN29321.1|  CAAX prenyl protease 1 like                           53.5    3e-06   Glycine soja [wild soybean]
gb|AAB61028.1|  A_IG002N01.21 gene product                            53.1    5e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDO33073.1|  hypothetical protein SPRG_01888                       53.5    5e-06   Saprolegnia parasitica CBS 223.65
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864           52.4    1e-05   Phytophthora sojae
gb|KFY38041.1|  hypothetical protein V494_04536                       52.4    1e-05   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFZ20107.1|  hypothetical protein V502_03363                       52.0    1e-05   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_008611054.1|  hypothetical protein SDRG_07015                  52.0    2e-05   Saprolegnia diclina VS20
gb|KFY87676.1|  hypothetical protein V500_06835                       51.6    3e-05   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFY09356.1|  hypothetical protein V492_05514                       51.2    4e-05   Pseudogymnoascus sp. VKM F-4246
gb|KFZ02509.1|  hypothetical protein V501_09542                       51.2    4e-05   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY76197.1|  hypothetical protein V499_04041                       51.2    4e-05   Pseudogymnoascus sp. VKM F-103
ref|XP_005848523.1|  hypothetical protein CHLNCDRAFT_22375            50.4    4e-05   Chlorella variabilis
gb|KFY59517.1|  hypothetical protein V496_05652                       50.4    5e-05   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KFX89268.1|  hypothetical protein V490_07139                       50.4    5e-05   Pseudogymnoascus sp. VKM F-3557
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                   50.1    6e-05   
gb|ELR10214.1|  STE24 endopeptidase                                   50.4    6e-05   Pseudogymnoascus destructans 20631-21
emb|CCX14243.1|  Similar to CAAX prenyl protease 1; acc. no. P47154   50.1    7e-05   Pyronema omphalodes CBS 100304
ref|XP_011121081.1|  hypothetical protein AOL_s00076g226              49.7    9e-05   Arthrobotrys oligospora ATCC 24927
gb|KFY04966.1|  hypothetical protein V491_09229                       49.7    1e-04   Pseudogymnoascus sp. VKM F-3775
ref|XP_011115562.1|  hypothetical protein H072_10056                  48.9    2e-04   
gb|KFY19341.1|  hypothetical protein V493_08005                       48.9    2e-04   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|ESZ94952.1|  putative CAAX prenyl protease 1                       48.5    3e-04   Sclerotinia borealis F-4128
ref|XP_001559859.1|  hypothetical protein BC1G_01418                  48.5    3e-04   Botrytis cinerea B05.10
emb|CEG66514.1|  hypothetical protein RMATCC62417_03079               48.1    3e-04   Rhizopus microsporus
ref|XP_001593172.1|  hypothetical protein SS1G_06094                  48.1    3e-04   Sclerotinia sclerotiorum 1980 UF-70
gb|EPB83925.1|  hypothetical protein HMPREF1544_09315                 48.1    3e-04   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007917686.1|  putative caax prenyl protease 1 protein          48.1    3e-04   Phaeoacremonium minimum UCRPA7
emb|CBJ27157.1|  CaaX prenyl protease Ste24                           48.1    4e-04   Ectocarpus siliculosus
gb|EGE06070.1|  CAAX prenyl protease                                  47.8    4e-04   Trichophyton equinum CBS 127.97
ref|XP_003023010.1|  hypothetical protein TRV_02831                   48.1    4e-04   Trichophyton verrucosum HKI 0517
emb|CEJ00851.1|  hypothetical protein RMCBS344292_14897               47.8    4e-04   Rhizopus microsporus
ref|XP_003012809.1|  hypothetical protein ARB_01060                   48.1    4e-04   Trichophyton benhamiae CBS 112371
gb|AAK48913.1|  Afc1 protein                                          47.8    4e-04   Physarum polycephalum
gb|EGD96703.1|  CaaX prenyl protease                                  47.8    4e-04   Trichophyton tonsurans CBS 112818
ref|XP_003236858.1|  CaaX prenyl protease                             47.4    5e-04   Trichophyton rubrum CBS 118892
dbj|GAN04268.1|  metallopeptidase                                     47.4    5e-04   Mucor ambiguus
gb|KFM64976.1|  CAAX prenyl protease 1-like protein                   47.4    5e-04   Stegodyphus mimosarum
ref|XP_505269.2|  YALI0F11033p                                        47.4    6e-04   Yarrowia lipolytica CLIB122
emb|CCJ30223.1|  unnamed protein product                              47.0    6e-04   Pneumocystis jirovecii
gb|EZF34879.1|  hypothetical protein H101_01566                       46.6    8e-04   Trichophyton interdigitale H6
ref|XP_002584079.1|  hypothetical protein UREG_04768                  47.0    8e-04   Uncinocarpus reesii 1704
ref|XP_002843395.1|  CAAX prenyl protease 1                           47.0    8e-04   Microsporum canis CBS 113480
ref|XP_003172087.1|  CAAX prenyl protease 1                           47.0    8e-04   Nannizzia gypsea CBS 118893
ref|XP_001239931.1|  hypothetical protein CIMG_09552                  47.0    9e-04   Coccidioides immitis RS
ref|XP_004226161.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  47.0    9e-04   Ciona intestinalis [sea vase]
ref|XP_003067440.1|  CAAX prenyl protease, putative                   46.6    9e-04   Coccidioides posadasii C735 delta SOWgp



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  34   RSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS  213
            RS ++S      N+AM FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVIS
Sbjct  25   RSSNISADSTNSNAAMVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVIS  84

Query  214  QEKFEKSRAYSIDKSDFHFVHE  279
            QEKFEKSR YS+DKS FHFVHE
Sbjct  85   QEKFEKSRGYSLDKSHFHFVHE  106



>gb|ACU19312.1| unknown [Glycine max]
Length=202

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMYIFETYLD+RQHAALKLPTLP+ L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+EAV+GFMILMYIFETYLD+RQHAA KLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   YFHFIHE  67



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDMRQHKALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
            +FHF+HE
Sbjct  61   NFHFIHE  67



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  73   SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  252
            +AMA PYME VVGFMI+MYIFETYLD+RQHAA KLPTLPK LVGVISQEKFEKSRAYS+D
Sbjct  69   AAMAIPYMETVVGFMIVMYIFETYLDLRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLD  128

Query  253  KSDFHFVHE  279
            KS FHFVHE
Sbjct  129  KSYFHFVHE  137



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+EAVVGFMILMYIFE+YLD+RQHAA KLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVVGFMILMYIFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   YFHFIHE  67



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMIL+Y+FETYLD+RQH ALKLPTLP+PLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYLFETYLDLRQHTALKLPTLPRPLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+EAV+GFMILMYIFETYLD+RQHAA KLPTLPK LVGVISQEKF+KSRAYS+DKS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFKKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   YFHFIHE  67



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+EAVVGFMILMY+FE+YLD+RQHAA KLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVVGFMILMYLFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   YFHFIHE  67



>gb|KJB41393.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=391

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPY+EAVVGFMILMY FETYLD+RQHAA KLPTLPKPL+GVISQEKFEKSRAYS+DKS
Sbjct  1    MTFPYLEAVVGFMILMYFFETYLDLRQHAAHKLPTLPKPLLGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   GFHFVHE  67



>gb|KDO86290.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=274

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score =   105 bits (262),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   105 bits (262),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVG MIL+YIFE YLD RQHAALKLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGVMILVYIFECYLDKRQHAALKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
            +FHFVHE
Sbjct  61   NFHFVHE  67



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score =   105 bits (262),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYME+VVGFMILMYIFETYLDIRQH +LKLP LPKPL GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMESVVGFMILMYIFETYLDIRQHRSLKLPNLPKPLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   HFHFIHE  67



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+GFMILMYIFETYLDIRQHAALKLP LPKPL GV+SQEKFEKSRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPRLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|KDO86289.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=304

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+GFMILMYIFETYLDIRQHAALKLP+LPKPL GV+SQEKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPSLPKPLEGVVSQEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   QFHFVHE  67



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVISQEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVISQEKFKKSQAYSLDKS  60

Query  259  DFHFVHE  279
            +FHFVHE
Sbjct  61   NFHFVHE  67



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|KDO86287.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=399

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|KDO86288.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=367

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   HFHFIHE  67



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY FETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMYIFE+YLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFESYLDLRQHKALKLPTLPKSLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVH  276
             FHFVH
Sbjct  61   HFHFVH  66



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILMY FETYLD+RQHAALKLP+LPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYFFETYLDLRQHAALKLPSLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             F+FVHE
Sbjct  61   YFNFVHE  67



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY FETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP+MEAVV FMILMY+FE+YLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFMEAVVCFMILMYLFESYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
            +FHFVHE
Sbjct  61   NFHFVHE  67



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVI QEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  259  DFHFVHE  279
            +FHFVHE
Sbjct  61   NFHFVHE  67



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+GFMILMYI ETYLDIRQHAALKLP+LPKPL GV+SQEKFEKSRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MYIFE+YLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFESYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVI QEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  259  DFHFVHE  279
            +FHFVHE
Sbjct  61   NFHFVHE  67



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFM++MY+FETYLD+RQH ALKLPTLPK LVGVISQ+KFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMVVMYVFETYLDLRQHTALKLPTLPKTLVGVISQDKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_007218054.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19253.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=351

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVI QEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   HFHFIHE  67



>gb|KJB41394.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=362

 Score =   102 bits (255),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 60/67 (90%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMIL+Y FETYLD+RQ AALKLP LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQRAALKLPILPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             F+FVHE
Sbjct  61   HFNFVHE  67



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVI QEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   HFHFIHE  67



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+EAV+GFMI MY FETYLDIRQHAALKL  LPKPL GVISQEKFE++RAYSIDKS
Sbjct  1    MAFPYLEAVLGFMIFMYFFETYLDIRQHAALKLTNLPKPLEGVISQEKFERARAYSIDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   GFHFIHE  67



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMIL+Y FETYLD+RQ AALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQLAALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             F+FVHE
Sbjct  61   HFNFVHE  67



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+EAV+GFMI MY+FETYLDIRQHAALKLP LPKPL GVIS+EKFEK+RAYSIDKS
Sbjct  1    MAFPYLEAVLGFMIFMYLFETYLDIRQHAALKLPNLPKPLEGVISREKFEKARAYSIDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   YFHFIHE  67



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYME VVGFMI+MYIFETYLD+RQHAALKLPTLPK LVG+I QEKFEKSRAYS+DKS
Sbjct  1    MAFPYMETVVGFMIMMYIFETYLDLRQHAALKLPTLPKTLVGLIGQEKFEKSRAYSLDKS  60

Query  259  DFHFVH  276
             FHFV 
Sbjct  61   YFHFVQ  66



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAVVGFMILM+ FETYLD+RQHAA KLPTLPKPL GVI QEKF+KSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   RFHFLHE  67



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYMEAV+GFM+LMYIFE+YLD+RQH ALKLPTLPK L GVISQEKF+KSRAYS+DKS
Sbjct  1    MAFPYMEAVLGFMVLMYIFESYLDMRQHCALKLPTLPKTLEGVISQEKFKKSRAYSLDKS  60

Query  259  DFHFVHE  279
             F+FVHE
Sbjct  61   HFNFVHE  67



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+GFMILMYI ETYLDIRQHAALKLP+LPKPL GV+ QEKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVGQEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP++EAV+GFMI +Y FETYLD+RQHAA KLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   RFHFVHE  67



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP++EAV+GFMI +Y FETYLD+RQHAA KLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   RFHFVHE  67



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   KFHFIHE  67



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   KFHFIHE  67



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAF YMEAVV FMILMY FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFLYMEAVVCFMILMYFFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMILMYIFETYLDIRQH ALK PTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKEPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHF+HE
Sbjct  61   KFHFIHE  67



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP++EAV+GFMILMY FETYLD+RQHAALKLPTLP+ L GVISQEKFEKSRAY +++S
Sbjct  1    MAFPFLEAVIGFMILMYNFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYCLERS  60

Query  259  DFHFVHE  279
            +FHFVH+
Sbjct  61   NFHFVHD  67



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPYME VVGFMI+MYI E YLD+RQH+ALKLPTLPK L+GVISQEKFEKSRAYS++KS
Sbjct  1    MAFPYMETVVGFMIMMYILEMYLDLRQHSALKLPTLPKTLIGVISQEKFEKSRAYSLEKS  60

Query  259  DFHFVHE  279
             FHFV+E
Sbjct  61   YFHFVYE  67



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PYME+VVGFM+LMYIFETYLD+RQHAALKLPTLP+PL GV+SQ+KFEKS+AYS+DKS
Sbjct  1    MALPYMESVVGFMVLMYIFETYLDLRQHAALKLPTLPRPLHGVVSQDKFEKSQAYSLDKS  60

Query  259  DFHFVH  276
             FHF+H
Sbjct  61   HFHFIH  66



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMI MYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  82   AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  261
            +FP++E+V+GFMILMY FETYLD RQH+ALKLPTLPK L GVISQEKFEKSRAYS++KS 
Sbjct  4    SFPFLESVIGFMILMYFFETYLDTRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLEKSH  63

Query  262  FHFVHE  279
            FHFVHE
Sbjct  64   FHFVHE  69



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMI MYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  204  MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  263

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  264  YFHFVHE  270



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  91   YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  270
            YMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVI+QEKFEKSRAYS+DKS FHF
Sbjct  11   YMEAVVGFMILMYIFETYLDLRQHVALKLPTLPKSLKGVINQEKFEKSRAYSLDKSHFHF  70

Query  271  VH  276
            +H
Sbjct  71   IH  72



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPL+GVIS EKF++SR YS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFKRSRDYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   HFHFVHE  67



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  73   SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  252
            S   FPY+EAVVGFM+ MY+FETYLD+RQHAALKLPTLP PLVG++S EKFEK++AYS++
Sbjct  3    SPAPFPYLEAVVGFMVFMYLFETYLDMRQHAALKLPTLPAPLVGIVSMEKFEKAQAYSLE  62

Query  253  KSDFHFVH  276
            KS FHFVH
Sbjct  63   KSRFHFVH  70



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  73   SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  252
            ++  FPY+EAVVGFM+ MY+ ETYLDIRQH ALKL  LP PL G++SQEKFEK++AYS+D
Sbjct  3    ASAPFPYLEAVVGFMLFMYMLETYLDIRQHGALKLSNLPAPLKGIVSQEKFEKAQAYSLD  62

Query  253  KSDFHFVH  276
            KS FHFVH
Sbjct  63   KSRFHFVH  70



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA  Y+EAV+ FMILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA  Y+EAV+ FMILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
             FHFVHE
Sbjct  61   YFHFVHE  67



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  46   VSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKF  225
            +  +L L +  ++     A  GFMILMY FETYLD+RQHAALKLPTLPK LVGVISQEKF
Sbjct  2    LPCFLLLFDGTLSGTPTHANTGFMILMYFFETYLDLRQHAALKLPTLPKTLVGVISQEKF  61

Query  226  EKSRAYSIDKSDFHFVHE  279
            EKSRAYS+DKS FHFVHE
Sbjct  62   EKSRAYSLDKSHFHFVHE  79



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFP+++ VVG MILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAY +++S
Sbjct  1    MAFPFLDVVVGSMILMYIFETYLDLRQHSALKLPTLPKTLEGVISQEKFEKSRAYRLERS  60

Query  259  DFHFVHE  279
             FHFV E
Sbjct  61   HFHFVCE  67



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMIL YIFETYL+IRQH ALKLPTLPK L GVIS EKFEK+RAYS+DKS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAGVISGEKFEKARAYSLDKS  60

Query  259  DFHFVHE  279
            +F+FV E
Sbjct  61   NFNFVRE  67



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMIL+YIFETYL+IRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILLYIFETYLNIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  259  DFHFVHE  279
            +F+FV E
Sbjct  61   NFNFVRE  67



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA PY+EAV+ FMIL YIFETYL+IRQH ALKLPTLPK L  VIS EKFE++RAYS+DKS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAKVISHEKFEQARAYSLDKS  60

Query  259  DFHFVHE  279
            +F+FV E
Sbjct  61   NFNFVRE  67



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAY    +
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYRDIIT  60

Query  259  D-------FHFVHE  279
            +       FHFVHE
Sbjct  61   ENFNICSYFHFVHE  74



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+E+VVGFMI MY  E+YL +RQ+ ALKLPTLP  L GV+SQEKFEKSRAY+I+KS
Sbjct  1    MAFPYLESVVGFMIFMYFVESYLHLRQYRALKLPTLPPTLEGVVSQEKFEKSRAYTIEKS  60

Query  259  DFHFVH  276
             F F+H
Sbjct  61   RFQFIH  66



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            M FPY+EAV+  MIL+YIFETYL +R+HA LKLPTLPK L GV+SQEKFEKSRAYS+DKS
Sbjct  1    MEFPYLEAVLVVMILIYIFETYLALREHATLKLPTLPKALEGVVSQEKFEKSRAYSLDKS  60

Query  259  DFHFVH  276
             F FVH
Sbjct  61   RFGFVH  66



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  258
            MAFPY+EAV+GF ILMY FETYL++RQ  A KL TLPK L GVIS++ F+K+R+YS+D S
Sbjct  1    MAFPYLEAVIGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSLDHS  60

Query  259  DFHFVHE  279
             FHFV +
Sbjct  61   RFHFVCQ  67



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  115  MILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHE  279
            MILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS FHFVHE
Sbjct  1    MILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKSYFHFVHE  55



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  115  MILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHE  279
            MILM+ FETYLD+RQHAA KLPTLPKPL GVI QEKF+KSRAYS+DKS FHF+HE
Sbjct  1    MILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKSRFHFLHE  55



>ref|XP_003622452.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=195

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = +1

Query  82   AFPYMEAVV----GFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSI  249
              P  +AV+    GF ILMY FETYL++RQ  A KL TLPK L GVIS++ F+K+R+YS+
Sbjct  53   GLPQPKAVLVANDGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSL  112

Query  250  DKSDFHFVHE  279
            D S FHFV +
Sbjct  113  DHSRFHFVCQ  122



>gb|EJY68063.1| Zn-dependent protease with chaperone function [Oxytricha trifallax]
Length=1433

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  19    SVIDLRSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkpl  198
             S+I  + L +S       S   FPY+ AV+ F IL+Y+FE YL+ RQ+       +PK +
Sbjct  968   SIIQPQDLKISHPQVFDTSKQVFPYIYAVLAFEILVYLFEQYLNWRQYKKYCEKEMPKEI  1027

Query  199   VGVISQEKFEKSRAYSIDKSDFHFV  273
               +++ E+FEKS+A++ DK +F F+
Sbjct  1028  TTIVTMEQFEKSQAHNKDKMEFEFL  1052



>gb|EJY66600.1| CAAX prenyl protease-like protein [Oxytricha trifallax]
Length=484

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +1

Query  19   SVIDLRSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkpl  198
            S+I  + L +S       S   FPY+ AV+ F IL+Y+FE YL+ RQ+       +PK +
Sbjct  8    SIIQPQDLQISHPQIFDTSKQVFPYIYAVLAFEILVYLFEQYLNWRQYKKYCEKEMPKEI  67

Query  199  VGVISQEKFEKSRAYSIDKSDFHFV  273
              +++ E+FEKS+A++ DK +F  +
Sbjct  68   TTIVTIEQFEKSQAHNKDKMEFELL  92



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  88   PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFH  267
            PY+   VGF + +Y+F TYLD+RQ  AL+ P+ P+ L G+ S E + K+RAY++DK  F 
Sbjct  19   PYLHLYVGFTVAVYLFHTYLDVRQLRALRRPSPPEALAGLFSPELYAKTRAYNLDKWSFS  78

Query  268  FVH  276
            F H
Sbjct  79   FAH  81



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  202  GVISQEKFEKSRAYSIDKSDFHFVHE  279
            GVISQEKFEKSRAYS+DKS FHFVHE
Sbjct  31   GVISQEKFEKSRAYSLDKSHFHFVHE  56



>gb|AAB61028.1| A_IG002N01.21 gene product [Arabidopsis thaliana]
Length=316

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAA  168
            MA P+ME VVGFMI+MYIFETYLD+RQ  A
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTA  30



>gb|KDO33073.1| hypothetical protein SPRG_01888 [Saprolegnia parasitica CBS 223.65]
Length=453

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 17/79 (22%)
 Frame = +1

Query  88   PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVI-----------------SQ  216
            PY+E  + F++ +Y FETYLD RQHA L   +LP  L   I                 +Q
Sbjct  17   PYLEGTLVFVVAVYAFETYLDYRQHAKLHETSLPHALASAIAHIDDASDAKAPSLLAQTQ  76

Query  217  EKFEKSRAYSIDKSDFHFV  273
             KFEKSR YS+DKS F FV
Sbjct  77   AKFEKSRVYSLDKSRFGFV  95



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 52/106 (49%), Gaps = 23/106 (22%)
 Frame = +1

Query  25   IDLRSLSVSLYLQLG--NSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAl------klp  180
            ++L    V L+ + G   SA   PY +  + FM L+++FETYLD+RQH  L      K  
Sbjct  1    MELSWWEVPLFREPGWRPSASPVPYFQGALVFMTLVFLFETYLDLRQHRKLHDKQFPKPL  60

Query  181  tlpkplVGVISQE---------------KFEKSRAYSIDKSDFHFV  273
                  +G  SQ+               KF+KSRAY +DKS F FV
Sbjct  61   AEAIEGLGSYSQKEEEEEETTLLEATRTKFDKSRAYGLDKSTFGFV  106



>gb|KFY38041.1| hypothetical protein V494_04536 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=527

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  85   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  144

Query  265  HFV  273
             FV
Sbjct  145  SFV  147



>gb|KFZ20107.1| hypothetical protein V502_03363 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=458

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  265  HFV  273
             FV
Sbjct  76   SFV  78



>ref|XP_008611054.1| hypothetical protein SDRG_07015 [Saprolegnia diclina VS20]
 gb|EQC35304.1| hypothetical protein SDRG_07015 [Saprolegnia diclina VS20]
Length=453

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 42/79 (53%), Gaps = 17/79 (22%)
 Frame = +1

Query  88   PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVI-----------------SQ  216
            PY+E  + F+  +Y FETYLD RQHA L   +LP  L   I                 +Q
Sbjct  17   PYLEGTLVFVAAVYAFETYLDYRQHAKLHETSLPPALASAIAHIDDVSNEKEPSLLVQTQ  76

Query  217  EKFEKSRAYSIDKSDFHFV  273
             KFEKSR YS+DKS F FV
Sbjct  77   AKFEKSRLYSLDKSRFGFV  95



>gb|KFY87676.1| hypothetical protein V500_06835 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=679

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  237  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  296

Query  265  HFV  273
             FV
Sbjct  297  SFV  299



>gb|KFY09356.1| hypothetical protein V492_05514 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=698

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  256  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  315

Query  265  HFV  273
             FV
Sbjct  316  SFV  318



>gb|KFZ02509.1| hypothetical protein V501_09542 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=680

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  265  HFV  273
             FV
Sbjct  298  SFV  300



>gb|KFY76197.1| hypothetical protein V499_04041 [Pseudogymnoascus pannorum VKM 
F-103]
Length=680

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  265  HFV  273
             FV
Sbjct  298  SFV  300



>ref|XP_005848523.1| hypothetical protein CHLNCDRAFT_22375, partial [Chlorella variabilis]
 gb|EFN56421.1| hypothetical protein CHLNCDRAFT_22375, partial [Chlorella variabilis]
Length=372

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +1

Query  73   SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  252
            S   FP++EAV  F   +++  TYLD RQ  AL+LP  P  +  + S+E+FEK RAY+ D
Sbjct  4    SGDGFPWLEAVAVFNTAVFLVHTYLDTRQQHALRLPAPPPVVAHLYSKEEFEKKRAYNQD  63

Query  253  KSDFHFVH  276
            K  +  VH
Sbjct  64   KLRYSMVH  71



>gb|KFY59517.1| hypothetical protein V496_05652 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=458

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  265  HFV  273
             FV
Sbjct  76   SFV  78



>gb|KFX89268.1| hypothetical protein V490_07139 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFX89748.1| hypothetical protein O988_08517 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY43474.1| hypothetical protein V495_03913 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY52182.1| hypothetical protein V497_08611 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=458

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  265  HFV  273
             FV
Sbjct  76   SFV  78



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  79   MAFPYMEAVVGFMILMYIFETYLDIRQHAA  168
            MA PY+EAV+ FM L YIFETYL+IRQH A
Sbjct  1    MALPYLEAVLCFMTLNYIFETYLNIRQHRA  30



>gb|ELR10214.1| STE24 endopeptidase [Pseudogymnoascus destructans 20631-21]
Length=487

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  45   FPWKKLIVGFSLAQYLFESFLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  104

Query  265  HFV  273
             FV
Sbjct  105  SFV  107



>emb|CCX14243.1| Similar to CAAX prenyl protease 1; acc. no. P47154 [Pyronema 
omphalodes CBS 100304]
Length=438

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +1

Query  82   AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  261
             FP+   ++GF    Y+ ET+L  RQH  L+   +PK L GV+ +E ++KS+AY   KS+
Sbjct  15   GFPWKTLIIGFSASQYLLETWLSYRQHKKLQETKVPKALEGVVEKEVYDKSQAYGRAKSN  74

Query  262  FHFV  273
            F FV
Sbjct  75   FSFV  78



>ref|XP_011121081.1| hypothetical protein AOL_s00076g226 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX50261.1| hypothetical protein AOL_s00076g226 [Arthrobotrys oligospora 
ATCC 24927]
Length=439

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + ++GF +  Y+FETYL  RQ+  L+   +P  L G + +E F+KS+AY   K+DF
Sbjct  16   FPWKKLILGFSVAQYLFETYLSARQYKVLRKDKIPNQLDGAVEKEVFDKSQAYGRAKADF  75

Query  265  HFV  273
             ++
Sbjct  76   GYI  78



>gb|KFY04966.1| hypothetical protein V491_09229 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=678

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  236  FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  295

Query  265  HFV  273
             FV
Sbjct  296  SFV  298



>ref|XP_011115562.1| hypothetical protein H072_10056 [Dactylellina haptotyla CBS 200.50]
 gb|EPS36425.1| hypothetical protein H072_10056 [Dactylellina haptotyla CBS 200.50]
Length=439

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+   ++GF +  Y+FETYL  RQ+  L+   +PK L G + Q+ F+KS+AY   K+DF
Sbjct  16   FPWKNLILGFSVAQYLFETYLSARQYKVLRGTRIPKQLEGSVEQDVFDKSQAYGRAKADF  75

Query  265  HFVH  276
             ++ 
Sbjct  76   GYLR  79



>gb|KFY19341.1| hypothetical protein V493_08005 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=458

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   SFV  78



>gb|ESZ94952.1| putative CAAX prenyl protease 1 [Sclerotinia borealis F-4157]
Length=462

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFEGFLSLRQYQVLKQTRPPKVLSNEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_001559859.1| hypothetical protein BC1G_01418 [Botrytis cinerea B05.10]
 emb|CCD46490.1| similar to CaaX prenyl protease [Botrytis cinerea T4]
 gb|EMR91295.1| putative caax prenyl protease 1 protein [Botrytis cinerea BcDW1]
Length=456

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFEGFLSLRQYQVLKQTRPPKVLSNEVSQEVFDKSQAYGRAKAQF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>emb|CEG66514.1| hypothetical protein RMATCC62417_03079 [Rhizopus microsporus]
Length=440

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  91   YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  270
            Y + V+ F  ++Y FE YL+ RQH    +   P  L  ++++E F+KS+AY++DKS F F
Sbjct  11   YKQFVIVFSCIVYAFEQYLNYRQHCRYLMRHRPDELADIVTEEDFKKSQAYNLDKSRFSF  70

Query  271  V  273
            +
Sbjct  71   I  71



>ref|XP_001593172.1| hypothetical protein SS1G_06094 [Sclerotinia sclerotiorum 1980]
 gb|EDO03613.1| hypothetical protein SS1G_06094 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=461

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLTQYLFEGFLSLRQYQILKQTRPPKVLSNEVSQEVFDKSQAYGRAKAQF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>gb|EPB83925.1| hypothetical protein HMPREF1544_09315 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=442

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  91   YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  270
            Y + V+GF +++Y+FE YL+ RQ+    +P  P  L  ++++E F+K++ Y+ DKS F F
Sbjct  13   YKQFVLGFTVIVYVFEQYLNYRQYTRYLMPKRPSELADIVTEEDFKKAQLYNYDKSRFAF  72

Query  271  V  273
            V
Sbjct  73   V  73



>ref|XP_007917686.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
 gb|EON97602.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
Length=462

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + ++GF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIIGFSVAQYVFEGFLSLRQYQVLKKAKPPKVLEQEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFVH  276
             FV+
Sbjct  76   EFVN  79



>emb|CBJ27157.1| CaaX prenyl protease Ste24 [Ectocarpus siliculosus]
Length=474

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 15/87 (17%)
 Frame = +1

Query  55   YLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------  213
            Y Q G      P++   VGF +L+Y+ ETYLD+RQH  LK  T P  L+ V+        
Sbjct  25   YRQEGAEKSDAPFLLFFVGFTLLVYLLETYLDLRQHRNLKAGTPPPTLLEVLKTVDEDNK  84

Query  214  --------QEKFEKSRAYSIDKSDFHF  270
                    + KF  S+AY +DKS FHF
Sbjct  85   GLEAVSKVESKFSASQAYGLDKSRFHF  111



>gb|EGE06070.1| CAAX prenyl protease [Trichophyton equinum CBS 127.97]
 gb|KDB23738.1| hypothetical protein H109_04418 [Trichophyton interdigitale MR816]
Length=457

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_003023010.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
 gb|EFE42392.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
Length=585

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  143  FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  202

Query  265  HFV  273
             FV
Sbjct  203  GFV  205



>emb|CEJ00851.1| hypothetical protein RMCBS344292_14897 [Rhizopus microsporus]
Length=440

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  91   YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  270
            Y + V+ F  ++Y FE YL+ RQH    +   P  L  ++++E F+KS+AY++DKS F F
Sbjct  11   YKQFVIVFSCIVYAFEQYLNYRQHCRYLMRHRPDELADIVTEEDFKKSQAYNLDKSRFGF  70

Query  271  V  273
            +
Sbjct  71   I  71



>ref|XP_003012809.1| hypothetical protein ARB_01060 [Arthroderma benhamiae CBS 112371]
 gb|EFE32169.1| hypothetical protein ARB_01060 [Arthroderma benhamiae CBS 112371]
Length=580

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  151  FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  210

Query  265  HFV  273
             FV
Sbjct  211  GFV  213



>gb|AAK48913.1| Afc1 protein [Physarum polycephalum]
Length=419

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +1

Query  103  VVGFMILMYIFETYLDIRQHA--AlklptlpkplVGVISQEKFEKSRAYSIDKSD  261
            ++GF+   Y+ ETYLDIRQH    +K+         +I+QE+F KS+AY +DKS+
Sbjct  3    ILGFVTFSYLLETYLDIRQHNNYKVKVLPEKIKKYNIITQEEFAKSQAYGLDKSN  57



>gb|EGD96703.1| CaaX prenyl protease [Trichophyton tonsurans CBS 112818]
Length=431

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_003236858.1| CaaX prenyl protease [Trichophyton rubrum CBS 118892]
 gb|EGD85309.1| hypothetical protein TERG_01583 [Trichophyton rubrum CBS 118892]
 gb|EZF13842.1| hypothetical protein H100_06223 [Trichophyton rubrum MR850]
 gb|EZF39575.1| hypothetical protein H102_06190 [Trichophyton rubrum CBS 100081]
 gb|EZF50099.1| hypothetical protein H103_06215 [Trichophyton rubrum CBS 288.86]
 gb|EZF60731.1| hypothetical protein H104_06202 [Trichophyton rubrum CBS 289.86]
 gb|EZF71568.1| hypothetical protein H105_06229 [Trichophyton soudanense CBS 
452.61]
 gb|EZF82058.1| hypothetical protein H110_06211 [Trichophyton rubrum MR1448]
 gb|EZF92801.1| hypothetical protein H113_06258 [Trichophyton rubrum MR1459]
 gb|EZG03811.1| hypothetical protein H106_06053 [Trichophyton rubrum CBS 735.88]
 gb|EZG14381.1| hypothetical protein H107_06355 [Trichophyton rubrum CBS 202.88]
 gb|KDB31307.1| hypothetical protein H112_06208 [Trichophyton rubrum D6]
Length=459

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  17   FPWKKIIVGFSLGQYLLEGFLSLRQYKILQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  76

Query  265  HFV  273
             FV
Sbjct  77   GFV  79



>dbj|GAN04268.1| metallopeptidase [Mucor ambiguus]
Length=442

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  91   YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  270
            Y + V GF I++Y+FE YL+ RQ+    +P  P  L  ++++E F+K++ Y+ DKS F F
Sbjct  13   YKQFVEGFTIIVYVFEQYLNYRQYTRYLMPKRPSELADIVTEEDFKKAQLYNYDKSRFSF  72

Query  271  V  273
            V
Sbjct  73   V  73



>gb|KFM64976.1| CAAX prenyl protease 1-like protein, partial [Stegodyphus mimosarum]
Length=465

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  94   MEAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHF  270
            M A++ F  ++YI+E YL  RQH  ++  T   P + GV+ Q  + K+R Y++DKS F F
Sbjct  35   MTAIIAFTWVVYIWEAYLSYRQHVVMQKVTSVPPELAGVMDQTTYNKARLYNLDKSRFSF  94

Query  271  V  273
            V
Sbjct  95   V  95



>ref|XP_505269.2| YALI0F11033p [Yarrowia lipolytica]
 emb|CAG78076.2| YALI0F11033p [Yarrowia lipolytica CLIB122]
Length=450

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  88   PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFH  267
            P+ + +VG  I  Y+ E+YL+ RQ+   K   +P  L G++SQEK  +S  YS+ K  F 
Sbjct  13   PWRQIIVGTAIGDYLLESYLNYRQYQVYKRTEVPASLQGIVSQEKLTESNDYSMAKMRFS  72

Query  268  FVH  276
            FVH
Sbjct  73   FVH  75



>emb|CCJ30223.1| unnamed protein product [Pneumocystis jirovecii]
Length=419

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +1

Query  82   AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  261
             FP+ + VV F+I  Y FE +L +RQ+  LK    P  L  +I QE F+KS+ YS  K+ 
Sbjct  15   GFPWKKLVVSFIIAQYTFEQFLMLRQYKKLKEKKPPITLENIIDQETFDKSQTYSRVKTK  74

Query  262  FHFVHE  279
            F F+ E
Sbjct  75   FGFIVE  80



>gb|EZF34879.1| hypothetical protein H101_01566, partial [Trichophyton interdigitale 
H6]
Length=315

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKVLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_002584079.1| hypothetical protein UREG_04768 [Uncinocarpus reesii 1704]
 gb|EEP79926.1| hypothetical protein UREG_04768 [Uncinocarpus reesii 1704]
Length=456

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
             P+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQE FEKS+AY   K+ F
Sbjct  16   LPWKKIIVGFSLGQYLLEGFLSLRQYKVLQQKRPPKVLEGEVSQEVFEKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_002843395.1| CAAX prenyl protease 1 [Arthroderma otae CBS 113480]
 gb|EEQ34359.1| CAAX prenyl protease 1 [Arthroderma otae CBS 113480]
Length=457

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKFLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_003172087.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
 gb|EFR01676.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
Length=457

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+   +PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYKFLQATKVPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_001239931.1| hypothetical protein CIMG_09552 [Coccidioides immitis RS]
 gb|EAS28348.1| CaaX prenyl protease [Coccidioides immitis RS]
Length=455

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYRILQQKKPPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



>ref|XP_004226161.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Ciona intestinalis]
Length=469

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   EAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHF  270
            E+V+GF  ++Y++E+YL  RQH+           +  VI Q  F+KSR Y++DKS + F
Sbjct  4    ESVLGFSWIVYLWESYLSKRQHSIYVNVQSVPKELTSVIDQSTFDKSRRYALDKSTYGF  62



>ref|XP_003067440.1| CAAX prenyl protease, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER25295.1| CAAX prenyl protease, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW19732.1| CaaX prenyl protease [Coccidioides posadasii str. Silveira]
Length=455

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  85   FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  264
            FP+ + +VGF +  Y+ E +L +RQ+  L+    PK L G +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKIIVGFSLGQYLLEGFLSLRQYRILQQKKPPKVLEGEVSQEVFDKSQAYGRAKAKF  75

Query  265  HFV  273
             FV
Sbjct  76   GFV  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557915310750